Canadian Patents Database / Patent 1341634 Summary

Third-party information liability

Some of the information on this Web page has been provided by external sources. The Government of Canada is not responsible for the accuracy, reliability or currency of the information supplied by external sources. Users wishing to rely upon this information should consult directly with the source of the information. Content provided by external sources is not subject to official languages, privacy and accessibility requirements.

Claims and Abstract availability

Any discrepancies in the text and image of the Claims and Abstract are due to differing posting times. Text of the Claims and Abstract are posted:

  • At the time the application is open to public inspection;
  • At the time of issue of the patent (grant).
(12) Patent: (11) CA 1341634
(21) Application Number: 617168
(54) English Title: PEPTIDES SUSCEPTIBLES D'ETRE RECONNUS PAR DES ANTICORPS INDUITS CONTRE DES RETROVIRUS D'IMMUNODEFICIENCE HUMANIN (VIRUS HIV) LEURS APPLICATIONS AU DIAGNOSTIC DES INFECTIONS DUES ACERTAINS DE CES VIRUS ET, LE CAS ECHEANT, A LA VACCINATION CONTRE LE SIDA
(54) French Title: PEPTIDES THAT CAN BE RECOGNIZED BY HUMAN IMMUNODEFIENCY VIRUSES (HIV VIRUSES) INDUCED ANTIBODIES AND THEIR APPLICATION TO DIAGNOSING INFECTIONS DUE TO SOME OF THESE VIRUSES AND IFAPPLICABLE TO VACCINATING AGAINST AIDS
(52) Canadian Patent Classification (CPC):
  • 150/9
  • 530/15.04
  • 195/1.235
  • 150/8.5
  • 167/3.7
(51) International Patent Classification (IPC):
  • C12Q 1/70 (2006.01)
  • C07K 14/55 (2006.01)
  • C12N 15/49 (2006.01)
  • G01N 33/569 (2006.01)
  • C12Q 1/68 (2006.01)
(72) Inventors :
  • ALIZON, MARC (France)
  • MONTAGNIER, LUC (France)
  • GUETARD, DENISE (France)
  • CLAVEL, FRANCOIS (France)
  • SONIGO, PIERRE (France)
  • GUYADER, MIREILLE (France)
  • TIOLLAIS, PIERRE (France)
  • CHAKRABARTI, LISA (France)
(73) Owners :
  • INSTITUT PASTEUR (Not Available)
(71) Applicants :
  • INSTITUT PASTEUR (France)
(74) Agent: LAVERY, DE BILLY, LLP
(74) Associate agent:
(45) Issued: 2013-03-19
(22) Filed Date: 1988-01-22
(30) Availability of licence: N/A
(30) Language of filing: English

(30) Application Priority Data:
Application No. Country/Territory Date
87 01739 France 1987-02-11
87 05398 France 1987-04-15

English Abstract


L'invention concerne des peptides ayant des
propriétés immunologiques en commun avec celles de
l'ossature peptidique des peptides des virus de la classe
HIV-2, notamment de la glycoprotéine d'enveloppe de
HIV-2, caractérisés en ce qu'ils ont également une
structure peptidique en commun avec l'ossature
peptidique des peptides de SIV, notamment de la glycoprotéine
d'enveloppe de SIV.L'invention concerne des compositions de

et des compositions de vaccin.
diagnostic capable de détecter une infection due à HIV-2


Note: Claims are shown in the official language in which they were submitted.

40
Les realisations de l'invention au sujet desquelles un droit exclusif de
propriété ou de privilege est revendiqué, sont définies comme il suit :

1. Utilisation, dans un procédé de diagnostic in vitro de la presence ou non
du virus HIV-2 ou d'un variant dans des échantillons de serums ou
d'autres liquides ou tissus obtenus a partir de patients suspectes d'etre
porteurs du virus HIV-2, d'un acide nucleique ayant une sequence allant
des nucleotides 6090 a 8732 de la figure 1B.

2. Procédé de diagnostic in vitro de la presence ou non du virus HIV-2 ou
d'un variant dans des échantillons de serums ou d'autres liquides ou
tissus obtenus a partir de patients suspectés d'etre porteurs de virus HIV-
2 comprenant:
a) l'extraction d'acides nucléiques a partir d'un échantillon de serum
ou d'autres liquides ou tissus obtenus a partir de patients
suspectés d'être porteurs du virus HIV-2 afin de rendre ces acides
nucléiques accessibles a l'hybridation avec une sonde;
b) la mise en contact de l'extrait d'acides nucléiques avec (i) une
sonde ayant une sequence allant des nucleotides 6090 a 8732 de
la figure 1B, ou (ii) un mélange d'une sonde ayant une sequence
allant des nucleotides 6119 a 8692 de la figure 1A et d'une sonde
ayant une sequence allant des nucleotides 6090 a 8732 de la
figure 1B; et
c) la detection de l'hybridation éventuellement produite.

3. Procédé de diagnostic de la presence ou non du virus HIV-2 ou d'un
variant, dans des échantillons de serums ou d'autres liquides ou tissus
obtenus a partir de patients suspectés d'être porteurs du virus HIV-2
comprenant les étapes suivantes:
a) une étape d'hybridation conduite dans des conditions stringentes,
par mise en contact de l'ADN de cellules de l'échantillon du patient
suspect avec une sonde marquee comprenant l'acide nucléique
selon la revendication 1, sur une membrane;

41
b) le lavage de ladite membrane avec une solution assurant la
conservation de ces conditions stringentes de l'hybridation; et
c) la detection de la presence ou non du virus HIV-2 par la detection
de la presence ou de l'absence d'hybridation de l'ADN de
l'échantillon avec la sonde.

4. Procédé selon la revendication 2, dans lequel la sonde d'acide nucléique
est marquee.

5. Procédé selon la revendication 3 ou 4, dans lequel le marquage est
radioactif, enzymatique ou fluorescent.

Note: Descriptions are shown in the official language in which they were submitted.

CA 01341634 2013-03-07


1 3 4 1 6 3 4



PEPTIDES SUSCEPTIBLES D'ETRE RECONNUS PAR DES ANTICORPS
INDUITS CONTRE DES RETROVIRUS D'IMMUNODEFICIENCE
HUMAINE (VIRUS HIV)
5LEURS APPLICATIONS AU DIAGNOSTIC DES INFECTIONS DUES
A CERTAINS DE CES VIRUS ET, LE CAS ECHEANT,
A LA VACCINATION CONTRE LE SIDA


La presente invention est relative a des pep-
tides ayant des proprietes immunologiques, le cas
echeant immunogenes, en commun avec des antigenes sus-
ceptibles d'être obtenus sous une forme purifiee, a.
partir de virus capables de provoquer des lymphadeno-
pathies susceptibles d'être relayees ensuite par le
symdrome d'immunodeficience acquise (SIDA) chez l'homme.
L'invention concerne en particulier des pep-
tides antigeniques susceptibles d'être reconnus par des
anticorps induits chez l'homme par des virus designes
par l'abreviation HIV, selon la nomenclature definie
dans NATURE. Elle concerne egalement des peptides ayant
des proprietes immunogenes ou susceptibles d'être rendus
immunogenes in vivo, cette immunogenicite etant suscep-
tible de se manifester par l'induction in vivo d'anti-
corps reconnaissant des antigenes caracteristiques des
virus HIV-2 et meme, au moms en ce qui concerne
certains de ces peptides, des antigenes issus de HIV-1.
L'invention concerne en outre des applications
de ces peptides a la fabrication de compositions pour le
diagnostic in vitro chez l'homme de potentialite de cer-
tames formes du SIDA et, en ce qui concerne certains
d'entre eux, a. la production de compositions immunogenes
et de compositions vaccinantes contre les retrovirus
HIV.
De meme l'invention concerne les applications
35aux memes fins des anticorps susceptibles d'être induits

CA 01341634 2013-03-07


1 3 4 1 6 3 4 -


2
in vivo par les peptides immunogenes ou rendus immuno-
genes et, pour certains de ces anticorps, leurs applica-
tions a la production de principes actifs de medicaments
contre ces SIDAS humains.
L'invention concerne egalement la mise en
oeuvre de certains de ces peptides dans des procedes
pour le diagnostic in vitro chez l'homme de certaines
formes du SIDA, ainsi que leur application A la consti-
tution de trousses ou "kits" de diagnostic.
Un premier retrovirus denomme LAV-1 ou HIV-1 a
ete isole et decrit dans la demande de brevet
EP. 84/401.834 publiee sous le numero 138,667 le 24 avril 1985.
Ce virus a egalement ete decrit par F.Barre Sinoussi et
al. dans Science, 220 n* 45-99, 20 pages 868-871.
LAV ELI et LAV MALI ont egalement ete isoles, caracte- Des variants de ce
virus HIV-1 designes par
rises et decrits dans la demande de brevet EP.84/-
401.834.
Les virus HIV-1 et leurs variants possedent
les proprietes suivantes :
- us ont pour cibles preferencielles les
cellules Leu3 (ou lymphocytes T4) humaines et leurs
cellules derivees "immortalisees".
- us ont une activite transcriptase inverse
necessitant la presence d'ions Mg2+ et presentent une
forte activite pour le poly(adenylate-oligo-deoxythymi-
dylase) poly(A)-oligo(dT)12-18)
- ils ont une densite de 1,16 A 1,17 sur
gradient de sucrose,
- us ont un diametre moyen de 139 nanometres
et un noyau de diametre moyen de 41 nanometres,
- les lysats de ces virus contiennent une
proteine p25 (proteine du noyau) qui ne croise pas im-
munologiquement avec la proteine p24 de HTLV-1,
- us contiennent une proteine p42 appartenant
leur enveloppe,

CA 01341634 2013-03-07



1 3 4 1 6 3 4

3
- us contiennent egalement une glycoproteine
d'enveloppe gp110 dun poids moleculaire de 110.000.
L'isolement et la caracterisation de retro-
virus appartenant a une classe distincte et n'ayant
qu'une parente immunologique redulte avec les prece-
dents, ont ete decrits dans la demande de brevet euro-
peen n 87/400.151.4 publiee sous le nuttier() no.
239,425 le
30/09/87. Ces retrovirus qui ont ete regroupes sous la desi-
gnation HIV-2, ont ete isoles chez plusieurs malades africains
presentant des symptomes d'une lymphadenopathie ou d'un SIDA.
Les retrovirus du type HIV-2 comme les retro-
virus du type HIV-1, se caracterisent par un tropisme
pour les lymphocytes T4 humains et par un effet cyto-
pathogene a l'egard de ces lymphocytes, lorsqu'ils s'y
multiplient, pour alors causer soit des poly-adenopa-
thies generalisees et persistantes, soit un SIDA.
Plus generalement les retrovirus purifies par
HIV-2 possedent en general les proprietes suivantes :
- la cible preferentielle des retrovirus HIV-2 est cons-
tituee par les cellules Leu3 (ou lymphocytes T4) humai-
nes et pour des cellules nimmortalisees" derivees de ces
lymphocytes T4 ;
- us sont cytotoxiques pour les lymphocytes T4 humains
- us ont une activite de transcriptase inverse neces-
sitant la presence d'ions Mg2+ et pre
25 sentant une forte
activite pour le poly(adenylate-oligodeoxythylmidylase)
(poly(A)-oligo(dT) 12-18) ;
- us ont une densite de 1,16 dans un gradient de
sucrose ;
- us ont un diametre moyen de 140 nanometres et un
noyau ayant un diametre moyen de 41 nanometres ;
- us peuvent etre cultives dans des lignees permanentes
du type HUT ou exprimant la proteine T4 ;
- us ne sont pas infectieux pour les lymphocytes T8 ;
- les lysats de ces virus contiennent une proteine p26

CA 01341634 2013-03-07


1 3 4 1 6 3 4


4
qui ne croise pas immunologiquement avec la proteine p24
du virus HTLV-I ou du virus HTLV-II ;
- ces lysats contiennent en outre une proteine p16 qui
nest pas reconnue immunologiquement par la pro-Leine p19
de HTLV-I ou de HTLV-II dans des essais de radioimmuno-
precipitation ;
- us contiennent en outre une glycoproteine d'enveloppe
ayant un poids moleculaire de l'ordre de 130.000-140.000
qui ne croise pas immunologiquement avec la gp110 des
HIV-1, mais qui en revanche croise immunologiquement
avec la glycoproteine d'enveloppe gp140 de STLV-III (vi-
rus isole chez le singe) ;
- ces lysats contiennent encore des antigenes marquables
par la 35S-cysteine, dont les poids moleculaires seta-
gent entre 32.000 et 42.000-45.000 : us comprennent no-
tamment un antigene ayant un poids moleculaire de l'or-
dre de 36.000 et un antigene ayant un poids moleculaire
de l'ordre de 42.000, l'un de ces antigenes (p36 et p42)
constituant vraisemblablement une glycoproteine trans-
membranaire du virus HIV-2 ;
- l'ARN genomique des HIV-2 n'hybride pas avec l'ARN
genomique de HIV-1 dans des conditions stringentes ;
- dans des conditions non stringentes, l'ARN genomique
de HIV-2 n'hybride, ni avec le gene env et le LTR qui le
jouxte, de HIV-1, ni avec des sequences de la region pol
du genome de HIV-1 ;
- dans des conditions non stringentes, ii hybride fai-
blement avec des sequences de nucleotides de la region
de HIV-1.
Un autre retrovirus denomme Sly-1, cette
denomination remplacant la denomination anterieurement
connue STLV III, a ete isole chez le singe macaque
rhesus. (M.D.Daniel et al. Science 228, 1201 (1985)
N.L.Letwin et al, Science 230, 71 (1985) sous l'appel-
lation "STLV-IIImac").

Mk 01341634 2013-03-07

1 3 4 1 6 3 4

5
Un autre retrovirus, designe "STLV-IIIAGM"
(ou SIVAGM) a ete isole chez des singes verts sauvages.
Mais, contrairement au virus present chez le singe
macaque rhesus, la presence de "STLV-IIIAGM" ne semble
pas induire une maladie du type SIDA chez le singe vert
d'Afrique.Pour les fins de la presente invention,
une souche du retrovirus SIV-1mac a ete
deposee a la CNCM le 7 Fevrier 1986 sous le n. 1-521.
Des etudes ont montre que le retrovirus SIV-1 comporte
certaines proteines possedant une certaine parente
immunologique avec des proteines ou glycoproteines
structurales susceptibles d'être obtenues dans des con-
ditions analogues, a partir de HIV-2. Ce retrovirus
SIV-1, dont on a constate le caractere infectieux chez
les singes, avait ete designe par STLVIII par les cher-
cheurs qui l'ont isole (references bibliographiques
precitees).
Pour la commodite du langage, ces virus ne
seront plus designes dans ce qui suit que par l'ex-
pression SIV (l'expression SIV est l'abreviation
anglaise de "Simian Immunodeficiency Virus" (virus
d'immunodeficience du singe)) eventuellement suivi d'une
abreviation designant l'espece de singe dont us sont
issus, par exemple, MAC (ou mac) pour le macaque ou AGM
pour le singe vert d'Afrique (abreviation de "African
Green Monkey").
En mettant en oeuvre les memes techniques que
celles rappelees plus haut, il a ete constate que l'on
pouvait egalement obtenir a. partir de SIV-1mac :
- une proteine principale du noyau p27, ayant un poids
moleculaire de l'ordre de 27 kilodaltons,
- une glycoproteine majeure d'enveloppe, gp140,
- une proteine vraisemblablement transmembranaire p32,
qui n'est guere observee en RIPA lorsque le virus a au
prealable ete marque par la 35S-cysteine, mais qui peut

CA 01341634 2013-03-07



1 3 4 1 6 3 4


6
etre observee dans les essais d'immunoempreintes
(Western blots), sous forme de bandes larges.
Des etudes plus precises ont ete realisees en
ce qui concerne les precedents virus HIV-2 et SD/. La
poursuite de l'etude des retrovirus HIV-2 a egalement
conduit a l'obtention de sequences d'ADN complementaires
(ADNc) des ARNs de leurs genomes. La sequence nucleoti-
dique complete de l'ADNc dun retrovirus representatif
de la classe HIV-2 (HIV-2 ROD) a ete deposee le 21/02/-
1986 a la CNCM sous le n 1-522, sous le nom de refe-
rence LAV-II ROD).
Cette sequence nucleotidique et les phases de
lecture ouverte qu'elle contient sont indiques a la fi-
gure 1 A.
En outre, la poursuite de l'etude d'autres re-
trovirus a egalement permis d'aboutir a l'obtention de
leurs sequences nucleotidiques completes. Ii en est en
particulier ainsi de l'ADNc derive de l'ARN genomique de
Sly.
Le clonage et le sequencage du virus SIV-1mac
qui ont permis l'obtention de sa sequence nucleotidique
ont ete realises dans les conditions suivantes
L'ADN de cellules HUT 78 infectees par le vi-
rus SIV (isolat STLV-III mac 142-83 decrit par Daniel et
al.(1985) Science, 228, p.1201-12041 digere partielle-
ment par l'enzyme de restriction Sau3A a ete clone au
site BamHI du bacteriophage vecteur Lambda ELBL3 pour
constituer une banque genomique. Les 2 millions de pha-
ges recombinants de la banque genomique ainsi constituee
ont ete cribles in situ en conditions de securite P3, a
l'aide de sequences du virus HIV2 provenant des clones
lambda-ROD4, lambda-R0D35 et E2 (Clavel et al. (1986-
Nature, 324, p.691.) et nick-translatees.
L'hybridation a ete realisee en 5xSSC a 50*C
et les lavages en 2xSSC a 50 C. Un seul clone contenant

CA 01341634 2013-03-07

1 3 4 1 6 3 4

7
l'ensemble des sequences virales a ete obtenu. Ce clone
est designe par lambda-SIV-1. L'inserat du phage lambda-
Sly-1 mesure 16,5 kb au total et comprend un provirus
integre auquel manquent seulement les 250 premieres ba-
ses du LTR gauche, alors que le LTR droit est complet.Le provirus integre a
ete sequence par la me-
thode des dideoxynucleotides apres sous-clonage de frag-
ments aleatoires dans le phage M13mp8. 300 sous-clones
ont ete analyses.
Sly-1 inseres dans des plasmides pSIV-1.1 et pSIV-1.2 Des fragments d'ADNc
provenant du clone Lambda
ont ete deposes a la CNCM le 15 Avril 1987, sous les
numeros 1-658 (pSIV-1.1) et 1-659 (pSIV-1.2).
Les resultats ont ete mentionnes dans les fi-
gures decrites ci-apres. La
figure 1B represente la sequence nucleo-
tidique du genome viral de Sly et les sequences qui en
sont deduites pour les proteines virales correspondant
aux produits des genes gag, pol, env, Q, X, R, tat, art,
F
Les figures 3 a 11 et la figure 1C repre-
sentent les comparaisons des produits theoriques des
genes viraux et des LTR entre HIV2 et SIVmac. (ASIV-1).
L'invention concerne de plus les fragments
d'ADNc deduits de l'ADNc issu du genome entier de Sly-1,
ces fragments contenant une ou plusieurs sequences is-
sues de la sequence complete d'ADNc et qui codent pour
des peptides interessants de l'invention. Ces sequences
sont indiquees a la figure 1B et, a la figure 1C pour ce
qui a trait a la sequence LTR du virus,
Les sequences nucleiques de l'ADNc de Sly ont
ete placees en correspondance avec les sequences nu-
cleiques du virus HIV-2 ROD pour ce qui concerne la se-
quence LTR (figure 1C). Cette presentation que ion re-
trouve pour le genome entier en rapprochant la figure 1B

CA 01341634 2013-03-07



1 3 4 1 6 3 4


8
des figures 3 a 11 permet de reperer ou de deduire les
acides nucleiques ayant des elements de structure essen-
tiels communs aux deux virus.
L'invention concerne naturellement aussi l'u-
tilisation des cADNs issus de Sly ou de leurs fragments
(ou de recombinants les contenant) en tant que sondes,
pour le diagnostic de la presence ou non de virus HIV-2
dans des echantillons de serums ou d'autres liquides ou
tissus biologiques obtenus a partir de patients
suspectes d'être porteurs du virus HIV-2. Ces sondes
sont de preference marquees egalement (marqueurs
radio-actifs, enzymatiques, fluorescents, etc.). Des
sondes particulierement interessantes pour la mise en
oeuvre du procede de diagnostic du virus HIV-2 ou d'un
variant de HIV-2 peuvent etre caracterisees en ce
qu'elles comprennent la totalite ou une fraction de
l'ADNc complementaire du genome du virus Sly ou encore
notamment les fragments recombinants contenus dans
divers clones.
Les sondes mises en oeuvre dans ce procede de
diagnostic du virus HIV-2 et dans les kits de diagnostic
ne sont en aucune fagon reduites aux sondes decrites
precedemment. Elles comprennent au contraire toutes les
sequences nucleotidiques issues du genome du virus SIV,
25d'un variant de Sly ou d'un virus proche par sa structu-
re, des lors qu'elles permettent la detection dans des
fluides biologiques de personnes susceptibles de
developper un SIDA, d'anticorps diriges contre un HIV-2
ou d'un virus qui en est proche.
La detection peut etre realisee de toutes
fagons en soi connues. Elle peut comprendre une mise en
contact de ces sondes soit avec les acides nucleiques
obtenus a partir des cellules contenues dans ces serums
ou autres milieux biologiques, par exemple liquides
cephalo-rachidiens, salives, etc... Elle peut aussi

CA 01341634 2013-03-07


1 3 4 1 6J /4



9
comprendre une mise en contact de ces sondes avec ces
milieux eux-memes des lors que leurs acides nucleiques
ont ete rendus accessibles a l'hybridation avec ces
sondes, et ce dans des conditions permettant l'hybri-
dation entre ces sondes et ces acides nucleiques. Lie-
tape finale du diagnostic in vitro comprend alors la
detection de l'hybridation eventuellement produite. Le
susdit diagnostic mettant en jeu des reactions d'hy-
bridation peut egalement etre realise a l'aide de me-
langes de sondes respectivement originaires dun HIV-2
et dun Sly-1 ou dun HIV-1, dun HIV-2 et dun Sly, des
lors qu'il nest pas necessaire de faire une difference
entre le type de virus recherche.
Dune fagon generale, le procede de diagnostic
de la presence ou non du virus HIV-2 ou dun variant
dans des echantillons de serums ou d'autres liquides ou
tissus obtenus a partir de patients suspectes d'etre
porteurs du virus HIV-2 comprend les etapes suivantes :
1/ au moms une etape d'hybridation conduite
dans des conditions stringentes, par mise en contact de
l'ADN de cellules de l'echantillon du patient suspect
avec l'une des susdites sondes marquees sur une membrane
appropriee,
2/ le lavage de ladite membrane avec une so-
lution assurant la conservation de ces conditions strin-
gentes de l'hybridation,
3/ la detection de la presence ou non du virus
HIV-2 par une methode d'immunodetection.
Dans un autre mode de realisation prefere du
procede selon l'invention l'hybridation precitee est
conduite dans des conditions non stringentes et le la-
vage de la membrane est realise dans des conditions
adaptees a celles de l'hybridation.
Ii va de soi que l'invention concerne les
acides nucleiques correspondant a des sequences placees

CA 01341634 2013-03-07



1 3 4 1 6 3 4


10
en des regions analogues de variants de Sly ainsi que
tous les acides nucleiques dont les modifications re-
sulteraient de la mise A profit de la degenerescence du
code genetique.
Les etudes comparatives qui ont aussi permis
d'aboutir A des resultats relatifs aux proteines de
noyau (core), ci-apres denommees "proteines gag" et aux
proteines d'enveloppes, ci-apres denommees "proteines
envTM, ont egalement ete rapportes dans la demande de
brevet EP.87/400.151.4, deja citee publi6esous le no.239,425 le 30
/09/87. Ces resultats mmtrent que les proteines du noyau (proteines
gag) dans HIV-2 presentent des differences moms ac-
centuees par rapport A celles des virus HIV-1, que les
proteines d'enveloppe (proteines env). Globalement les
proteines env dans HIV-2 se sont revelees presenter des
parentes immunologiques extremement faibles, sinon
inexistentes, avec les proteines env correspondantes des
virus HIV-1.
Au contraire des etudes comparatives effec-
tuees entre les structures des sequences d'ADNc des vi-
rus HIV-2 et Sly permettent de mettre en evidence cer-
taines caracteristiques communes qui apparaissent au
niveau des proteines.
Globalement, les proteines de HIV-2 et de
SIV-1 montrent des parentes immunologiques importantes.
La glycoproteine majeure d'enveloppe de HIV-2
s'est revelee etre plus proche immunologiquement de la
glycoproteine majeure d'enveloppe de Sly que de la gly-
coproteine majeure d'enveloppe de HIV-1.
niveau des poids moleculaires : 130-140 kilodaltons pour Ces constatations
s'imposent non seulement au
les glycoproteines majeures de HIV-2 et de SIV contre
environ 110 pour la glycoproteine majeure d'enveloppe de
HIV-1, mais aussi au niveau des proprietes immunologi-
ques, puisque des serums preleves 4 partir de malades

CA 01341634 2013-03-07



1 3 4 1 6 3 4


11
infectes par HIV-2, et plus particulierement des anti-
corps formes contre la gp140 de HIV-2 reconnaissent la
gp140 de SIV-1mac, alors que dans des essais semblables
les memes serums et les memes anticorps de HIV-2 ne
reconnaissent pas la gp110 de HIV-1. Mais les serums
anti-HIV-1 qui n'ont jamais reagi avec la gp140 de HIV-2
precipitent une proteine de 26 Kdal marquee par la 35S-
cysteine, contenue dans les extraits de HIV-2.
La proteine majeure du noyau (core) de HIV-2
semble presenter un poids moleculaire moyen (environ
26.000) intermediaire entre celui de la p25 de HIV-1 et
la p27 de Sly.
Ces observations resultent des essais realises
avec des extraits viraux obtenus a partir du HIV-2 isole
partir de l'un des patients susmentionnes. Des re-
sultats similaires ont ete obtenus avec des extraits vi-
raux du HIV-2 isole a partir du second patient.
Des etudes plus poussees ont conduit les in-
venteurs a reconnaitre une premiere classe de peptides
ayant des sequences d'aminoacides soit identiques, soit
proches de sequences contenues a l'interieur des stru-
ctures des proteines gag et env de HIV-2 ou de Sly voire
de HIV-1. Ces peptides sont notamment applicables au
diagnostic dune infection chez l'homme par le virus
HIV-2 ou de l'un de ses variants.
A cet egard la presente invention concerne
egalement des procedes et des compositions de diagnostic
pour la detection in vitro d'anticorps diriges contre un
virus HIV-2 ou de ses variants, plus particulierement
dans des echantillons biologiques, notamment des serums
de patients ayant subi une infection par le virus HIV-2,
certains de ces peptides permettant une discrimination
particulierement poussee entre les infections dues a des
virus HIV-2 et a des virus HIV-1.
Ces etudes poussees ont egalement conduit a la

CA 01341634 2013-03-07



1 3 4 1 6 3 4


12
possibilite de synthetiser des peptides immunogenes ou
susceptibles d'etre rendus immunogenes, presentant des
caracteristiques de structures leur permettant d'induire
in vivo la production d'anticorps susceptibles de re-
connaitre des proteines env a la fois dans HIV-1 et dans
HIV-2 et, au moms pour certains de ces peptides, de se
fixer tant sur des virus HIV-1 que sur des virus HIV-2,
plus particulierement aux fins de les neutraliser.
L'utilisation de ces derniers types de peptides est donc
10particulierement indiquee pour la production de princi-
pes actifs de vaccins contre les virus HIV, donc contre
le SIDA.
Pour designer ci-apres les residus d'amino-
acides entrant dans la constitution des peptides selon
15l'invention, on aura recours, pour ceux des acides ami-
nes ayant une signification univoque a la nomenclature
internationale designant chaque acide amine naturel par
une lettre unique (lettre majuscule) selon le tableau
des correspondances qui suit :
20 Methionine
Leucine
Isoleucine
V Valine
Phenylalanine
25 Serine
Proline
Threonine
A Alanine
Tyrosine
30 Histidine
Glutamine
Asparagine
Lysine
Acide Aspartique
35 Acide glutaminique

CA 01341634 2013-03-07



1 3 4 1 6 3 4
13
Cysteine
Tryptophane
Arginine
Glycine
Lorsqu'un acide amine pourra, en raison de sa
position au sein de la chaine d'aminoacides caracte-
ristique dun peptide determine, prendre plusieurs si-
gnifications, ii pourra soit etre designe par un tiret
"-", si sa signification peut etre quelconque, soit par
une lettre minuscule lorsque cet aminoacide pourra
presenter un nombre limite de significations preferees,
ce nombre etant cependant toujours superieur a 1. Dans
ce dernier cas, les significations possibles de cette
lettre minuscule seront toujours precisees en rapport
avec le peptide auquel il appartient.
Afin de faciliter la lecture, ces peptides
seront designes par une abreviation env ou gag suivie
dun indice numerique, par reference a des sequences
d'aminoacides contenues, selon le cas, soit dans les
proteines env soit dans les proteines gag de certains
HIV-1, HIV-2 ou Sly. Ii y sera encore fait reference
dans ce qui suit.
Enfin dans les definitions qui suivent
- les groupes X representent soit un groupe NH2 libre ou
amide, notamment par un ou deux groupes alcoyle com-
prenant de 1 a. 5 atomes de carbone, soit un groupe pep-
tidique comprenant de 1 a 5 aminoacides, dont l'amino-
acide N-terminal presente lui-meme un groupe NH2 libre
ou amide comme precedemment indique, et
- les groupes Z representent, soit un groupe -OH libre
ou alcoxyle et contenant alors un groupe alcoyle com-
prenant de 1 & 5 atomes de carbone, soit un groupe pep-
tidique comprenant de 1 a 5 aminoacides, dont l'ami-
noacide C- terminal presente lui-meme un groupe -OH
libre ou alcoxyle, comme precedemment indique, les

Mk 01341634 2013-03-07


1 3 4 1 6 3 4



14
groupes de 1 A 5 acides amines le cas echeant contenus
dans X ou Z ou dans les deux A la fois etant tels, que
leur presence n'est pas incompatible avec la preserva-
tion pour l'essentiel des proprietes immunologiques, le
cas echeant immunogenes, des peptides qui en sont de-
pourvus.
Les peptides selon l'invention, qui ont en
commun des proprietes immunologiques avec des antigenes
de HIV-2 et, pour certains d'entre eux egalement avec
des antigenes de HIV-1 ou de ses variants, sont caracte-
rises en ce qu'ils ont egaement une structure peptidique
en commun avec les antigenes de Sly. De fagon avanta-
geuse, ces peptides comprennent normalement au plus 40
residus d'acides amines.
envl Des peptides preferes sont les suivants :
XRV-AIEKYL-DQA-LN-WGCAFRQVCZ
env2
X-LE-AQI-QQEKNMYELQKLNZ
env3
XELGDYKLVEITPIG-APT KR
env4
X----VTV-YGVP-W--AT--LFCA-Z
env5
X---QE--L-NVTE-F--W-NZ
env6
XL---S-KPCVKLTPLCV--Z
env7
X---N-S-IT--C-K----Z
env8
X-I---YC-P-G-A-L-C-N-TZ
env9
X A C W Z
env10
X-G-DPE NC GEF YCN NZ

CA 01341634 2013-03-07


1 3 4 1 6 3 4


15
env11
X C-IKQ I G YZ
Plus particulierement l'invention concerne les
peptides suivants :
env1
XRV-AIEKYL-DQA-LN-WGCAFRQVCZ
env2
X-LE-AQIQQEKNMYELQKLNZ
env3
XELGDYKLVEITPIG-APT KR
env4
X----VTV-YGVP-W--AT--LFCA-Z
env5
X----E--L-NVTE-F--W-NZ
env6
XL---S-KPCVKL-PLC---Z
env7
X---N-S-I---C-K----Z
env8
X-I---YC-P-G-A-L-C-N-TZ
env9
X A C W---Z
env10
X-G-DPE NC GEF YC NZ
env11
X CIQI G YZ
Des peptides avantageux correspondant aux pre-
cedents, presentent les formules qui suivent :
env1
XRVTAIEKYLQDQARLNSWGCAFRQVCZ, ou
XRVTAIEKYLKDQAQLNAWGCAFRQVCZ
env2
XSLEQAQIQQEKNMYELQKLNSWZ, ou
XLLEEAQIQQEKNMYELQKLNSWZ

CA 01341634 2013-03-07

1 3 4 1 6 3 4

16
env3
XELGDYKLVEITPIGFAPTKEKRYSSAHZ, ou
XELGDYKLVEITPIGLAPTNVKRYTTO-Z
(On remarquera que les peptides env1, env2, env3
attestent de la tres grande parente entre HIV-2 et
SIV-1. En effet le premier peptide est inclu dans le
genome de HIV-2 et le second, dans celui de Sly-1).
env4
XabcdVTVeYGVPfWogAThiLFCAjZ,
dans lesquels les lettres de a d j peuvent avoir les
significations suivantes :
a est C, E ou D
b est T, K, D, N ou I
c est Q ou L
d est Y ou W
e est F ou Y
f est T, V ou A
g est N ou E
h est I ou T
i est P ou T
j est T ou S
o est K ou R
env5
XabcoEdeLfNVTEgFhiWjNZ,
dans lequel les lettres de a A j peuvent avoir les
significations suivantes :
a est D ou P
b est D ou N
c est Y ou P
d est I, V, I ou L
e est T, V, E ou A
f est V, G ou E ou -
g est A, N, G ou S
h est D ou N
i est A ou M

CA 01341634 2013-03-07



1 3 4 1 6 3 4


17
j est N, K ou E
o est Q ou S
env6
XLabcSdKPCVKLoPLCuefKZ,
dans lequel les lettres de a a f peuvent avoir les
significations suivantes :
a est F ou W
b est E ou D
c est T ou Q
d est I ou L
e est A, S ou T
f est M ou L
o est T ou S
U est V ou I
env7
XabCNxSylocdCeRfghiZ,
dans lequel les lettres de a a i et x et y peuvent avoir
les significations suivantes :
a est N ou T ou I
b est H ou S ou N
c est E ou Q
d est S, A ou C
e est D ou P
f est H, V ou D
g est Y ou S
h est W ou F
i est D ou E
x est T ou R
y est V ou A
o est T ou Q
env8
XaIbcdYCxPeGfAgLhCiNjTZ,
dans lequel les lettres de a a k et x peuvent avoir les
significations suivantes :


CA 01341634 2013-03-07


1 3 4 1 6 3 4



18
a est A ou P
b est R ou P
c est F, I ou C
d est R ou H
e est P ou A
if est Y ou F
g est L ou I
h est R ou K
i est - ou N
j est D ou K
x est A ou T
env9
XwabcxyAdCefghizWjkZ,
dans lequel les lettres de a a k et x a z peuvent avoir
les significations suivantes :
a est K ou - ou E
b est R ou -
c est P ou M ou I
d est W ou H ou Y
e est W ou N ou T ou R
f est F ou I
g est K ou S ou N ou G
h est G ou R ou E
i est - ou A ou T
j est K ou N ou D ou S
k est D ou A ou N ou K ou E
w est N, D ou I
x est R ou G ou K
y est Q ou K ou R
z est K ou E ou Q ou N
env10
XaGbDPEcdefghNCiGEFjYCokxlmnNZ,
dans lequel les lettres de a a n et x peuvent avoir les
significations suivantes :


CA 01341634 2013-03-07

1 3 4 1 6 3 4



19
a est K ou - ou G
b est S ou G ou -
C est V ou I
d est A ou V ou T
e est Y ou T ou M ou F
f est M ou H
g est W ou S
h est T ou F
i est R ou G
j est L ou F
o est N ou K
k est M ou S
1 est W ou Q ou K ou G
in est F ou L
n est L ou F
x est T ou S ou N
env11
XabcdwCeIoQfIxgyhizGjklYZ,
dans lequel les lettres de a d 1 et w a z peuvent avoir
les significations suivantes :
a est R ou T ou S ou N
b est N ou I
c est Y ou T
d est A ou L ou V
e est H ou R
f est I ou F
g est T ou M
h est H ou Q ou A
i est K ou E
j est R ou K
k est N ou A
1 est V ou M
w est P ou Q
x est N ou K
y est W ou V

CA 01341634 2013-03-07


1 3 4 1 6 3 4


z est V ou T Cu K
o est K ou R
La structure du peptide antigenique code par
le gene gag et designe par gag1 est egalement represen-
5 tee ci-apres :
XDCKLVLKGLGaNPTLEEMLTAZ,
dans lequel la lettre a designe M ou T.
Ii sera remarque que, dune facon generale,
les aminoacides ayant une signification univoque (donc
10 representes par une lettre majuscule correspondant & la
nomenclature internationale) qui interviennent dans les
definitions qui precedent des peptides selon l'inven-
tion, se trouvent etre la correspondance avec des amino-
acides identiques places dans le meme ordre dans les se-
15 quences env ou gag correspondantes de la proteine env ou
gag d'au moms l'un des HIV, ou de Sly-i.
Les positions de ces sequences sont soulignees
et reperees au sein des sequences d'aminoacides des
proteines env respectivement de HIV-2 ROD (CNCM n
20 1-532) et HIV-1 BRU (CNCM n I-232) representees a la
figure 2. Par ailleurs, les alignements des acides ami-
nes des proteines env et gag respectivement de SIV-1mac
(CNCM n' 1.521) et de HIV-2 ROD sont presentees A la
figure 3 et A la figure 4.
Les traits pleins qui apparaissent en certai-
nes localisations de ces sequences visent a. souligner
que certains aminoacides contenus dans ces sequences ont
ete volontairement deletes au plan de la presentation,
afin de permettre la mise en alignement d'aminoacides
30respectivement identiques (alors marques dun aste-
risque) Cu de deux points verticaux sur une meme ligne
verticale dans les sequences des proteines correspon-
dantes de HIV-1 et de HIV-2 dune part, de SDI et de
HIV-2 d'autre part.


Mk 01341634 2013-03-07

1 3 4 1 6 3 4



21
Outre les peptides precites, l'invention con-
cerne egalement les peptides modifies par insertion
et/ou deletion et/ou substitution dun ou plusieurs
acides amines, pour autant que les proprietes antige-
niques ou immunogenes desdits peptides ne sont pas mo-
difiees, ou que les proprietes de reconnaissance de
l'antigene ou de l'anticorps avec lesdits peptides ne
sont pas substantiellement modifiees.
Dans un mode de realisation particulierement
prefer-6, l'invention concerne des peptides ayant des
proprietes immunologiques en commun avec l'ossature
peptidique de la glycoproteine d'enveloppe des virus de
la classe HIV-2, ces peptides contenant un nombre de
residus d'acides amines n'excedant pas 40.
Ces peptides preferes selon l'invention ont
les sequences suivantes :
env1
RVTAIEKYLQDQARLNSWOCAFRQVC
AIEKYLQDQ
RVSAIEKYLKDQAQLNAWGCAFRQVC
AIEKYLKDQ
env2
SLEQAQIQQEKNMYELQKLNSW
QIQQEKN
LLEEAQIQQEKNMYELQKLNSW
env3
ELGDYKLVEITPIGFAPTKEKRYSSAH
YKLVEITPIGFAPTKEK
ELGDYKLVEITPIGLAPTNVKRYTTG-
YKLVEITPIGLAPTNVK
env4
CTQYVTVFYGVPTWKNATIPLFCAT
VTVFYGVPTWKNAT
CIQYVTVFYGVPAWRNATIPLFCAT
VTVFYGVPAWRNAT

CA 01341634 2013-03-07


1 3 4 1 6 3 4



22
EKLWVTVYYGVPVWKEATTTLFCAS
VTVYYGVPVWKEAT
EDLWVTVYYGVPVWKEATTTLFCAS
VTVYYGVPVWKEAT
5DNLWVTVYYGVPVWKEATTTLFCAS
VTVYYGVPVWKEAT
env5
DDYQEITL-NVTEAFDAWNN
L-NVTEAF
DDYSELAL-NVTESFDAWEN
L-NVTESF
PNPQEVVLVNVTENFNMWKN
LVNVTENF
PNPQEIELENVTEGFNMWKN
LENVTEGF
PNPQEIALENVTENFNMWKN
LENVTENF
env6
ETSIKPCVKLTPLCVAMK
ETSIKPCVKLSPLCITMR
DQSLKPCVKLTPLCVSLK
DQSLKPCVKLTPLCVTLN
PCVKLTPLCV
env7
NHCNTSVITESCD
NTSVIT
NHCNTSVIQECCD
NTSVIQ
TSCNTSVITQACP
NTSVIT
INCNTSVITQACP
NTSVIT
INCNTSAITQACP
NTSAIT


CA 01341634 2013-03-07


1 3 4 1 6 3 4



23
env8
YCAPPGYALLRC-NDT
YCAPAGFAILKCNNKT
YCAPAGFAILKCNDKK
YCAPAGFAILKCRDKK
env9
NKRPRQAWCWFKG-KWKD
NERPKQAWCRFGG-NWKE
N- -MRQAHCN I SRAKWNA
D - - IRRAYCTINETEWDK
I- -IGQAHCNISRAQWSK
env10
KGSDPEVAYMWTNCRGEFLYCNMTWFLN
= NCRGEFLYCN
GG-DPEVTFMWTNCRGEFLYCKMNWFLN
NCRGEFLYCK
-GGDPEIVTHSFNCGGEFFYCNSTQLFN
NCGGEFFYCN
-GGDPEITTHSFNCRGEFFYCNTSKLFN
NCRGEFFYCN
-GGDPEITTHSFNCGGEFFYCNTSGLFN
NCGGEFFYCN
env11
RNYAPCHIKQIINTWHKVGRNVY
CHIKQII
RNYVPCHIRQIINTWHKVGKNVY
CHIRQII
TITLPCRIKQFINMWQEVGKAMY
CRIKQFI
SITLPCRIKQIINMWQKTCKAMY
CRIKQII
NITLQCRIKQIIKMVAGR-KAIY
CRIKQII
craci1
DCKLVLKGLGTNPTLEEMLTA

CA 01341634 2013-03-07

1 3 4 1 6 3 4



24
Les peptides selon l'invention peuvent encore
avantageusement etre prepares par les techniques clas-
siques, dans le domaine de la synthese des peptides.
Cette synthese peut etre realisee en solution homogene
5ou en phase solide.
Par exemple, on aura recours a la technique de
synthese en solution homogene decrit par HOUBENWEYL dans
l'ouvrage intitule "Methode der Organischen Chemie"
(Methode de la Chimie Organique) &lite par E. Wunsch,
vol. 15-I et II., THIEME, Stuttgart 1974.
Cette methode de synthese consiste a condenser
successivement deux-a-deux les aminoacyles successifs
dans l'ordre requis, ou a condenser des aminoacyles et
des fragments prealablement formes et contenant déjà
plusieurs aminoacyles dans l'ordre approprie, ou encore
plusieurs fragments prealablement ainsi prepares, etant
entendu que ion aura eu soin de proteger au prealable
toutes les fonctions reactives portees par ces amino-
acyles ou fragments, a l'exception des fonctions amines
de l'un et carboxyles de l'autre ou vice-versa, qui
doivent normalement intervenir dans la formation des
liaisons peptidiques, notamment apres activation de la
fonction carboxyle, selon les methodes bien connues dans
la synthese des peptides. En variante, on pourra avoir
recours a des reactions de couplage mettant en jeu des
reactifs de couplage classique, du type carbodiimide,
tels que par exemple la 1-ethy1-3-(3-dimethyl-amino-
propy1)-carbodiimide. Lorsque l'aminoacyle mis en oeuvre
possede une fonction acide supplementaire (notamment
dans le cas de l'acide glutamique), ces fonctions seront
par exemple protegees, par des groupes t-bustylester.
Dans le cas de la synthese progressive, acide
amine par acide amine, la synthese debute de preference
par la condensation de l'amino-acide C-terminal avec
l'aminoacide qui correspond a l'aminoacyle voisin dans

Mk 01341634 2013-03-07
1 3 4 1 6 3 4


25
la sequence desiree et ainsi de suite, de proche en
proche, jusqu'a l'acide amine N-terminal. Selon une
autre technique preferee de l'invention, on a recours
celle decrite par R.D. MERRIFIELD dans l'article
intitule "Solid phase peptide synthesis" (J. Am. Soc.,
45, 2149-2154).
Pour fabriquer une chaine peptidique selon le
procede de MERRIFIELD, on a recours a une resine polyme-
re tres poreuse, sur laquelle on fixe le premier acide
amine C-terminal de la chaine. Cet acide amine est fixe
sur la resine par l'intermediaire de son groupe
carboxylique et sa fonction amine est protegee, par
exemple par le groupe t-butyloxycarbonyle.
Lorsque le premier acide amine C-terminal est
ainsi fixe sur la resine, on enleve le groupe protecteur
de la fonction amine en lavant la resine avec un acide.
Dans le cas (DU le groupe protecteur de la
fonction amine est le groupe t-butyloxycarbonyle, il
peut etre elimine par traitement de la resine a l'aide
d'acide trifluoroacetique.
On couple ensuite le deuxieme acide amine qui
fournit le second amino-acyle de la sequence recherché,
partir du residu amino-acyle C-terminal sur la fonc-
tion amine deprotegee du premier acide amine C-terminal
fixe sur la chaine. De 'Deference, la fonction carboxyle
de ce deuxieme acide amine est activee, par exemple par
la dicyclohexylcarbodiimide, et la fonction amine est
protegee, par exemple par le t-butyloxycarbonyle.
On obtient ainsi la premiere partie de la
chaine peptidique recherchee, qui comporte deux acide
amines, et dont la fonction amine terminale est
protegee. Comme precedemment, on deprotege la fonction
amine et on peut ensuite proceder a la fixation du
troisieme aminoacyle, dans les conditions analogues a
35celles de l'addition du deuxieme acide amine C-terminal.

Mk 01341634 2013-03-07



1 3 4 1 6 3 4



26
On fixe ainsi, les uns apres les autres, les

acides amines qui vont constituer la chaine peptidique

sur le groupe amine chaque fois deprotege au prealable
de la portion de la chaine peptidique déjà formee, et
qui est rattachee A la resine.
Lorsque la totalite de la chaine peptidique

desiree est formee, on elimine les groupes protecteurs
des differents acide amines constituant la chaine pepti-
dique et on detache le peptide de la resine par exemple
l'aide d'acide fluorydrique.
L'invention concerne egalement les oligomeres

hydrosolubles des peptides monomeres sus-indiques.
L'oligomerisation peut provoquer un accroissement de

l'immunogenicite des peptides monomeres selon l'inven-
15tion. Sans qu'une telle indication chiffree puise etre
consideree comme limitative, on mentionnera neanmoins

que ces oligomeres peuvent, par exemple, contenir de 2 a

10 unites monomeres.
Les unites monomeres entrant dans cet oligo-

mere sont soit toutes constituees par le polypeptide de
sequence 1 ou par le polypeptide de sequence 2, soit par
l'un et l'autre de ces polypeptides.
On peut avoir recours, pour realiser l'oligo-

merisation, a toute technique de polymerisation couram-
ment utilisee dans le domaine des peptides, cette poly-
25merisation etant conduite jusqu'a l'obtention dun oli-

gomere ou polymere contenant he nombre de motifs mono-
meres requis pour l'acquisition de l'immunogenicite
desiree.
Une methode d'oligomerisation ou de polyme-
30risation du monomere consiste dans la reaction de
celui-ci avec un agent de reticulation tel que he glu-
taraldehyde.

On peut egalement avoir recours a d'autres me-

35thodes d'oligomerisation ou de couplage, par exemple

CA 01341634 2013-03-07



1 3 4 1 6 3 4



27

celle mettant en jeu des couplages successifs d'unites

monomeres, par l'intermediaire de leurs fonctions ter-

minales carboxyle et amine en presence d'agents de cou-

plage homo- ou hetero- bifonctionnels.

On peut egalement pour la production de mole-
cules comportant un ou plusieurs motifs de 17 acides

amines tels que definis ci-dessus, avoir recours a. des

techniques du genie genetique mettant en oeuvre des

micro-organismes transformes par un acide nucleique

10determine comprenant des sequences nucleotidiques ap-
propriees correspondantes.

L'invention concerne egalement les acides nu-

cleiques contenant une ou plusieurs sequences issues de

la sequence de l'ADNc du virus HIV-2 ROD. Ces sequences

reperees par la numerotation figurant sur la sequence

precedemment decrite, codent pour certains peptides

interessants de l'invention.

Sequence codant pour env1 nucleotides 7850 a 7927

env2 8030 a 8095

env3 7601 a 7636
env4 I 6170 a 6247

env5 6294 a 6349

env6 6392 a 6445

env7 6724 a 6763

env8 6794 a 6838
env9 7112 a 7162

env10 7253 a 7336

env11 7358 a 7426

qact1 1535 A 1597

L'invention concerne enfin les acides nu-
cleiques correspondants du virus Sly, contenant une ou

plusieurs sequences issues de l'ADNc du virus Sly-i. Ces

sequences codant pour les peptides env1 a. env11 et qaq1

peuvent etre reperes sur la figure 3 par comparaison

avec les sequences correspondantes decrites pour HIV-2.

Mk 01341634 2013-03-07

1 3 4 1 6 3 4



28
Ii va de soi que l'invention concerne les
acides nucleiques correspondant d des sequences placees
en des regions analogues des ADNc derives de variants de
HIV-2 ROD ou de Sly, ainsi que tous les acides nuclei-
ques dont les modifications vis a vis des precedents
resulteraient de la mise a profit de la degenerescence
du code genetique.
L'invention concerne encore les conjugues
obtenus par couplage covalent des peptides selon l'in-
10vention (ou des susdits oligomeres) d des molecules por-
teuses (naturelles ou synthetiques), physiologiquement
acceptables et non toxiques, par l'intermediaire de
groupements reactifs complementaires respectivement por-
tes par la molecule porteuse et le peptide. Des exemples
de groupements appropries sont illustres dans ce qui
suit :
A titre d'exemple de molecules porteuses ou
supports macromoleculaires entrant dans la constitution
des conjugues selon l'invention, on mentionnera des
proteines naturelles, telles que l'anatoxine tetanique,
l'ovalbulmine, des serums albumines, des hemocyamines,
etc...
A titre de support macromoleculaires syntheti-
ques, on mentionnera par exemple des polylysines ou des
poly(D-L-alanine)-poly(L-lysine).
La litterature mentionne d'autres types de
supports macromoleculaires susceptibles d'être utilises,
lesquels presentent en general un poids moleculaire
superieur A 20 000.
Pour synthetiser les conjugues selon
l'invention, on peut avoir recours A des procedes connus
en soi, tels que celui decrit par FRANTZ et ROBERTSON
dans Infect. and Immunity, 33, 193-198 (1981), ou celui
decrit dans Applied and Environmental Microbiology,
(octobre 1981), vol. 42, n' 4, 611-614 par P.E. KAUFFMAN

Mk 01341634 2013-03-07


1 3 4 1 6 3 4


29
en utilisant le peptide et la molecule porteuse appro-
priee.
Dans la pratique, on utilisera avanta-
geusement comme agent de couplage les composes suivants,
cites a. titre non limitatif : aldehyde glutarique,
chloroformiate d'ethyle, carbodiimides hydrosolubles
[N-ethyl-N'(3-dimethylamino-propyl) carbodiimide, HC1],
diisocyanates, bis-diazobenzidine, di- et trichloro-s-
triazines, bromures de cyanogene, ainsi que les agents
de couplage mentionnes dans Scand. J. Immunol., (1978),
vol. 8, P. 7-23 (AVRAMEAS, TERNYNCK, GUESDON).
On peut avoir recours A tout procede de
couplage faisant intervenir d'une part une ou plusieurs
fonctions reactives du peptide et d'autre part, une ou
plusieurs fonctions reactives de molecules supports.
Avantageusement, ii s'agit des fonctions carboxyle et
amine, lesquelles peuvent donner lieu a une reaction de
couplage en presence dun agent de couplage du genre de
ceux utilises dans la synthese des proteines, par
exemple, le 1-ethy1-3-(3-dimethylaminopropy1)-
carbodiimide, le N-hydroxybenzotriazole, etc... On peut
encore avoir recours a la glutaraldehyde, notamment
lorsqu'il s'agit de relier entre eux des groupes amines
respectivement portes par le peptide et la molecule
support.
Les peptides selon l'invention possedent des
proprietes antigenigues. Ils peuvent donc etre utilises
dans des procedes de diagnostic pour la detection d'une
infection par le virus HIV-2.
Comme on l'a déjà mentionne, des etudes ont
penis de distinguer deux groupes de peptides pouvant
etre mis en oeuvre dans des procedes de detection d'an-
ticorps contre le virus HIV-2 dans un fluide biologique
humain, notamment un serum ou un liquide cephalo-ra-
chidien.

Mk 01341634 2013-03-07

1 3 4 1 6 3 4



30
tin premier groupe (I) comprend les peptides
ciaci1' Ces peptides reconnaissent des anticorps anti-
HIV-2 et sont donc capables de detecter une infection
par HIV-2. us reconnaissent egalement dans une certaine
mesure des anticorps anti-HIV-1.tin second groupe (II) comprend des peptides
qui correspondent plus particulierement a ceux qui sont
situes dans la partie transmembranaire et dans la fin de
la partie externe de la proteine d'enveloppe. Ces pep-
tides sont ceux precedemment designes par env1, env2 et
env3. us permettent la reconnaissance specifique de la
presence d'anticorps contre HIV-2 et permettent donc de
discriminer chez une personne les infections passees ou
presentes dues a un HIV, plus particulierement entre
celles qui ont ete provoquees par un HIV-2 et celles qui
l'ont ete par un HIV-1.
L'invention concerne egalement une composition
contenant au moms l'un des susdits peptides ou au moms
un oligomere de ce peptide, caracterisee en ce qu'elle a
la capacite d'être reconnue par des serums d'origine hu-
maine contenant des anticorps contre le virus HIV-2.
L'invention concerne un procede de diagnostic
in vitro un ou des peptides selon l'invention pour la
detection d'anticorps contre HIV-2 dans des fluides bio-
logiques, en particulier dans des serums humains.
D'une fagon generale le procede de diagnostic
in vitro ci-dessus comprend les etapes suivantes
- la mise en contact de ce liquide biologique
avec lesdits peptides,
- la detection de la presence eventuelle d'un
complexe peptide-anticorps par des methodes physiques ou
chimiques, dans ledit liquide biologique.
Dans un mode de realisation prefere de l'in-
vention, la detection du complexe antiOne-anticorps est
realisee (grace A des tests immunoenzymatiques (du type

Mk 01341634 2013-03-07


1 3 4 1 6 3 4


31
ELISA), immunofluorescents (du type IFA), radioimmunolo-
gigues (du type RIA) ou des tests de radioimmunoprecipi-
tation (du type RIPA).
Ainsi l'invention concerne egalement tout peptide selon
l'invention marque A l'aide dun marqueur adequat du
type enzymatique, fluorescent, radioactif, etc...
De telles methodes comprennent par exemple les
etapes suivantes :
- depot de quantites determinees d'une
composition peptidique selon l'invention dans les puits
dune microplaque de titration,
- introduction dans lesdits puits de dilutions
croissantes du serum devant etre diagnostique,
- incubation de la microplaque,
- ringages repetes de la microplaque,
- introduction dans les puits de la micro-
plaque d'anticorps marques contre des immunoglobulines
du sang, le marquage de ces anticorps ayant ete realise
l'aide dune enzyme selectionnee parmi celles qui sont
capables d'hydrolyser un substrat en modifiant l'absor-
ption des radiations de ce dernier, au moms a une lon-
gueur d'onde determinee,
- detection, en comparaison avec un temoin de
controle, de la quantite de substrat hydrolyse.
L'invention concerne egalement des coffrets ou
kits pour le diagnostic in vitro de la presence d'anti-
corps contre les virus HIV-2 et, dans certains cas,
HIV-1 dans un milieu biologique qui comprennent :
- une composition peptidique selon l'inven-
tion,
- les reactifs pour la constitution du milieu
propice a la realisation de la reaction immunologique,
- les reactifs permettant la detection du com-
plexe antigenes-anticorps produit par la reaction im-
munologique. De tels reactifs peuvent egalement porter

Mk 01341634 2013-03-07



1 3 4 1 6 3 4


32
un marqueur, ou etre susceptibles d'être reconnus a leur
tour par un reactif marque. Plus particulierement dans
le cas on la composition polypeptidique sus-mentionnee
nest pas marquee.
- un tissu fluide biologique de reference de-
pourvu d'anticorps reconnus par la composition polypep-
tidique sus-mentionnee,
L'invention concerne les anticorps eux-memes
formes contre les peptides de l'invention.
Ii va de soi que cette production n'est pas
limitee aux anticorps polyclonaux.
Elle s'applique encore A tout anticorps mono-
clonal produit par tout hybridome susceptible d'être
forme, par des methodes classiques, a partir des cel-
lules spleniques d'un animal, notamment de souris ou de
rat, immunises contre l'un des peptides de l'invention,
d'une part et des cellules d'une lignee de cellule
myelome approprie d'autre part, et d'être selectionne,
par sa capacite a produire des anticorps monoclonaux
reconnaissant le peptide initialement mis en oeuvre pour
l'immunisation des animaux.
L'invention concerne egalement des composi-
tions immunogenes pour la production de vaccins dont le
principe actif est constitue par au moms un peptide
selon l'invention, ou un oligomere de ce peptide, ou un
peptide sous forme conjuguee avec une molecule porteuse,
caracterisees en ce qu'elles induisent la production
d'anticorps contre les susdits peptides en quantite suf-
fisante pour aussi inhiber les proteines du retrovirus
30HIV-2, voire meme le retrovirus HIV-2 entrant en asso-
ciation avec un vehicule pharmaceutiquement acceptable.
Les compositions immunogenes pour la produc-
tion de vaccins comprennent de facon avantageuse plus
particulierement au moms l'un des peptides precedemment
designes par env4, env5, env6, env7, env8, env9, env10,

Mk 01341634 2013-03-07



1 3 4 1 6 3 4


33
env11 voir des mélanges de ceux-ci.
Parmi ces peptides aptes a constituer des
principes actifs de vaccins certains sont particulie-
rement preferes car ils possedent une structure de base
en acides amines correspondant a des regions des glyco-
proteines d'enveloppe qui presentent un important degre
de conservation, non seulement dans les HIV-2, et dans
les Sly, mais egalement dans les HIV-1. Ces peptides
particulierement preferes sont les peptides designes par
env4, certains peptides env5, env6 et env10.
Dans un mode de realisation prefere de l'in-
vention les peptides immunogenes (ou fragments de ces
peptides) aptes a constituer des principes actifs de
vaccins sont choisis parmi ceux dont les formules cor-
respondent a des sequences qui, dans les glycoproteines
d'enveloppe de HIV-2, Sly et HIV-1 presentant une
homologie en acides amines superieure a 50%, qui appar-
tiennent a la partie externe de l'enveloppe du virus,
qui sont depourvus ou presque de deletions, et qui ren-
20ferment des residus de cysteine favorables a la stabili-
sation des liaisons et a la constitution de boucles
d'ancrage.
Les peptides suivants appartiennent a cette
categorie de peptides preferes.
env4
XVTV-YGVP-W--ATZ
env5
XL-NVTE-FZ
env6 =
XKPCVKL-PLC-Z
env7
XN-S-I-Z
env10
XNC-GEF-YC-Z


Mk 01341634 2013-03-07

1 3 4 1 6 3 4



34
env11
XC-I-Q-IZ
Des compositions pharmaceutiques avantageuses
sont constituees par des solutions, suspensions ou li-
5posomes injectables contenant une dose efficace d'au
moms un produit selon l'invention. De preference, ces
solutions, suspensions ou liposomes sont realises dans
une phase aqueuse sterilisee isotonique, de preference
saline ou glucosee.
L'invention concerne plus particulierement de
telles suspensions, solutions ou forme liposome qui sont
aptes a etre administrees par injections intradermiques,
intramusculaires ou sous-cutanees, ou encore par scari-
fications.
Elle concerne egalement des compositions phar-
maceutiques administrables par d'autres voles, notamment
par vole orale.
Les compositions pharmaceutiques selon l'in-
vention, utilisables en tant que vaccins pour etre effi-
caces dans la production d'anticorps contre le virus
HIV-2, peuvent a titre d'exemple etre administrees a des
doses situees entre 10 et 500 pg/kg, de peptides selon
l'invention, de preference de 50 A 100 pg/kg.
Ces doses sont citees a titre d'exemple et ne
possedent en aucun cas un caractere limitatif.
Comme on la déjà indique plus haut les dif-
ferents peptides qui ont ete definis peuvent comprendre
des modifications qui n'ont pas pour effet de modifier
de fagon fondamentale leurs proprietes immunologiques.
Les peptides equivalents qui en resultent entrent dans
le champ des revendications qui suivent. A titre d'exem-
ples de peptides equivalents on mentionnera ceux dont
les structures en correspondance avec des regions des
ADNc d'autres variants de HIV-2 de SIV ou de HIV-1,
35lorsque ces regions ont ete mises en alignement dans des

Mk 01341634 2013-03-07

1 3 4 1 6 3 4



35
conditions semblables a celles qui ont ete evoquees
ci-dessus, a propos de HIV-2 ROD, SIV et HIV-1 BRU. A
titre d'autres de ces peptides, on mentionnera ceux dont
les structures sont en correspondance avec de telles
regions dans les ADNc qui ont fait l'objet de depots a
la CNCM, notamment sous les numeros 1-502, 1-642 (HIV-2
IRMO), 1-643 (HIV-2 EHO) ainsi que, dans les cas
appropries, des variants de HIV-1 qui ont fait l'objet
de depots a la CNCM sous les numeros 1-232, 1-240,
1-241, 1-550, 1-551.
Les peptides selon l'invention peuvent encore
etre definis par les formules suivantes (dans lesquels
X, Z et les tirets "-" ont les significations sus-indi-
quees) :



'

CA 01341634 2013-03-07


. 1 3 4 1 6 3 4


36
XRV-AIEKYL-DQA-LN-WGCAFRQVCZ
XAIEKYL-DZ


X -LE -AQIQQEKNMYELQKLNSWZ
XQIQQEKNZ

XELGDYKLVEITP IG -APT KR Z
XYKLVEITPIG-APT--KRZ


X- - - -VTV-YGVP-W- -AT- -LFCA- Z
XVTV-YGVP-W- -AT Z


X- ---E- -L-NVTE-F- -W-NZ
XL-NVTE-FZ

XL- - -S -KPCVKL-PLC- - - - Z
XKPCVKL-PLC- Z
XS -KPCVKL-PLC- Z


X---N-S-I---C-Z
XN-S-I-Z


XYC-P-G-A-L-C-N-TZ


X A C W Z

NKRPRQAWCWFKG-KWKD


X-G-DPE NC -GEF YC NZ

X C-I Q I G YZ




Mk 01341634 2013-03-07


1 3 4 1 6 3 4



37
L'invention concerne egalement outre les pep-
tides de Sly déjà decrits, les proteines codees par
l'ADNc du virus SIV. Elle concerne egalement les pro-
teines de tout virus immunologiquement etroitement ap-
parent& a SIV-1mac, en particulier tout virus dont les
proteines et les glycoproteines d'enveloppe croisent
immunologiquement et dont les ADNc presentent un pour-
centage d'homologie d'au moms 95% et de preference d'au
moms 98%.
En particulier l'invention concerne :
1/ les proteines et glycoproteines de l'enveloppe codees
par le gene env et representees a la figure 3,
2/ la proteine GAG representee a la figure 4,
3/ la proteine POL representee a la figure 5,
4/ la proteine Q representee a la figure 6,
5/ la proteine R representee a la figure 7,
6/ la proteine X representee a la figure 8,
7/ la proteine F representee a la figure 9,
8/ la proteine TAT representee a la figure 10,
Les acides amines des proteines precitees de
Sly, ont ete representees en alignement avec les se-
quences d'acides amines des proteines correspondantes du
virus HIV-2 ; les points verticaux figurant entre les
deux sequences correspondent aux acides amines communs
25entre les proteines des deux virus.
Les sequences d'ADNc codant pour les proteines
precitees apparaissent sur la figure 1B. L'invention
concerne, outre les sequences nucleiques precitees toute
sequence nucleiques modifiee, qui code egalement pour
30les proteines du retrovirus Sly ou dun variant.
Ces sequences d'ADNc reperees par la numerota-
tion figurant sur les sequences decrites precedemment
(figure 1B) sont les suivantes :




CA 01341634 2013-03-07



1 3 4 1 6 3 4



38

-sequence codant pour GAG, nucleotides 551 a 2068

POL, 1726 a 4893

Q, 4826 a 5467

X, 5298 a 5633

R, 5637 a 5939
F, 8569 a 9354
TAT-1 1 5788 a 6084

ART-1 6014 a 6130

TAT-2 8296 a 8391

- ART-2 8294 a 8548
ENV 11 6090 a 8732

L'invention concerne donc naturellement les

proteines precedemment decrites, lorsqu'elles sont

obtenues a partir du virus Sly ou lorsqu'elles sont

preparees par une methode de synthese, notamment par

l'une des methodes déjà citees en rapport avec la syn-

these des peptides de plus petite taille.

L'invention concerne egalement l'utilisation

des proteines precedentes pour le diagnostic de la pre-

sence eventuelle d'anticorps diriges contre les pro-
teines de HIV-2, voire contre HIV-2 en entier, ou pour

certaines d'entre elles l'utilisation aux fins de dia-

gnostic dune infection due a l'un des virus HIV. Ainsi

le peptide GAG code par le gene correspondant peut etre

utilise pour reperer la presence eventuelle d'anticorps

anti-HIV-1 ou anti-HIV-2. Les proteines ENV sont utili-

sees de preference pour le diagnostic specifique dune

infection due a HIV-2 ou un de ses variants, parfois

pour le diagnostic dune infection par HIV-2 ou HIV-1.

L'invention concerne donc egalement un procede
de diagnostic in vitro de detection d'anticorps contre

HIV-2 et eventuellement contre HIV-1 dans des fluides

biologiques et en particulier dans des serums humains.

De tels procedes applicables pour l'utilisation des pro-

teines precedentes de Sly comme proteines de diagnostic,

Mk 01341634 2013-03-07


1 3 4 1 6 3 4



39
ont déjà ete decrits dans la presente invention.
L'invention concerne aussi des coffrets ou
"kits" pour le diagnostic in vitro de la presence d'an-
ticorps le virus HIV-2 et dans certains cas contre HIV-1
dans un milieu biologique. De tels kits mettant en oeu-
vre les peptides precedents ont egalement ete decrits
dans la presente invention.
L'invention concerne egalement des composi-
tions immunogenes pour la production de vaccins, dont le
principe actif est constitue de fagon avantageuse par au
moms la partie de la pro-Leine ENV du virus Sly, cette
proteine pouvant etre sous forme conjuguee avec une mo-
lecule porteuse. Ces compositions immunogenes induisent
la production d'anticorps contre le susdit peptide en
15quantite suffisante pour inhiber les proteines du re-
trovirus HIV-2, voire le retrovirus HIV-2 lui-meme.
Toutefois l'utilisation aux fins de diagnostic
des proteines de Sly n'est en mien limitee a celle des
seuls proteines ENV ou GAG. D'autres proteines parmi
celles decrites peuvent etre envisagees, pour preparer
des compositions de diagnostic voire de vaccin.




CA 01341634 2013-03-07

1 3 4 1 6 3 4

39a

L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine
d'enveloppe des virus de la classe HIV-2 et du virus Sly-1, ayant l'une des
formules
suivantes :
XAIEKYL-DZ

dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la
mesure oU les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5
residus
d'acides amines, et chacun des tirets correspond a un residu aminoacyle choisi
parmi
ceux qui permettent de conserver audit peptide les proprietes immunologiques
de
l'une des sequences suivantes :

AIEKYLQDQ
AIEKYLKDQ.

L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine
d'enveloppe des virus de la classe HIV-2 et du virus SIV-1, ayant l'une des
formules :

X-LE-AQIQQEKNMYELQKLNSWZ
XQIQQEKNZ

dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la
mesure oU les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en
trouvent pas essentiellennent modifiees, des groupes comportant de 1 a 5
residus
d'acides amines, et chacun des tirets correspond a un residu aminoacyle choisi
parnni
ceux qui permettent de conserver audit peptide les proprietes immunologiques
de l'une
des sequences suivantes :

SLEQAQIQQEKNMYELOKLNSW
QIQQEKN
LLEEAQIQQEKNMYELQKLNSW.

CA 01341634 2013-03-07

1 3 4 1 6 3 4
'

39b
L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine
d'enveloppe des virus de la classe HIV-2 et du virus Sly-1, ayant l'une des
formules :
5 XELGDYKLVEITPIG-APT- KR

Z
XYKLVEITPIG-APT- -RZ

dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la
mesure o0 les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en
10 trouvent pas essentiellement modifiees, des groupes
comportant de 1 a 5 residus
d'acides amines, et chacun des tirets correspond a un residu aminoacyle choisi
parmi
ceux qui permettent de conserver audit peptide les proprietes immunologiques
de l'une
des sequences suivantes :

15
ELGDYKLVEITPIGFAPTKEKRYSSAHYKLVEITPIGFAPTKEK
ELGDYKLVEITPIGLAPTNVKRYTTG-
YKLVEITPIGLAPTNVK.

20
L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine
d'enveloppe des virus de la classe HIV-2 et du virus Sly-1, ayant l'une des
formules :

25 X¨VTV-YOVP-W¨AT¨LFCA-Z
XVTV-YGVP-W-ATZ

dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la
mesure CI les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en
trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5
residus
30 d'acides amines, et chacun des tirets correspond a un
residu aminoacyle choisi parmi
ceux qui permettent de conserver audit peptide les proprietes immunologiques
de l'une
des sequences suivantes :

35
CTQYVTVFYGVPTWKNATIPLFCAT VTVFYGVPTWKNAT

CA 01341634 2013-03-07

1 3 4 1 6 3 4

= 39c

CIQYVTVFYGVPAWRNATIPLFCAT
VTVFYGVPAWRNAT
EKLVVVIVYYGVPVWKEATTTLFCAS
VTVYYGVPVVVKEAT.
L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine
d'enveloppe des virus de la classe HIV-2 et du virus Sly-1, ayant l'une des
formules
suivantes :
X- - - -E- -L-NVTE-F- -W-NZ

XL-NVTE-FZ
dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la
mesure ot) les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en
trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5
residus
d'acides amines, et chacun des tirets correspond a un residu aminoacyle choisi
parmi
ceux qui permettent de conserver audit peptide les proprietes immunologiques
de
rune des sequences suivantes :
DDYQEITL-NVTEAFDAWNN
L-NVTE
DDYSELAL-NVTESFDAWEN
PNPQEVVLVNVTENFNMWKN
PNPQEVVLVNVTENFNMWKN
LVNVTE.

L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine
d'enveloppe des virus de la classe HIV-2 et du virus SIV-1, ayant l'une des
formules
suivantes :

XL- - -S-KPCVKL-PLC- - - -Z
XKPCVKLTPLCVZ
LWDQSLKPCVKLTPLCVTLN

CA 01341634 2013-03-07


1 3 4 1 6 3 4


39d


XS-KPCVKLTPLCVZ



dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la

mesure ou les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en
trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5
residus

d'acides amines, et chacun des tirets correspond a un residu aminoacyle choisi
parmi

ceux qui permettent de conserver audit peptide les proprietes immunologiques
de l'une
des sequences suivantes :


LFETSIKPCVKLTPLCVAMK
LFETSIKPCVKLSPLCITMR

LWDQSLKPCVKLTPLCVSLK

KPCVKLTPLCV

KPCVKLSPLCI
SLKPCVKLTPLCV.

L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine

d'enveloppe des virus de la classe HIV -2 et du virus Sly-1, ayant l'une des
formules

suivantes :


LFETSIKPCVKLTPLCVAMK
LFETSIKPCVKLSPLCITMR

LWDQSLKPCVKLTPLCVSLK

LWDQSLKPCVKLTPLCVTLN
PCVKLTPLCV
KPCVKLSPLCI.


L'invention concerne egalement un peptide ayant des proprietes

immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine

d'enveloppe des virus de la classe HIV-2 et du virus SIV-1, ayant l'une des
formules

suivantes :



X- - -N-S-I- - -C-Z au
XN-S-I-Z

CA 01341634 2013-03-07


1 3 4 1 6 3 4


39e



dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la
mesure ou les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5
residus
d'acides amines, et chacun des tirets correspond a un residu aminoacyle choisi
parmi
ceux qui permettent de conserver audit peptide les proprietes immunologiques
de l'une
des sequences suivantes :


NHCNTSVITESCD
NTSVIT
NHCNTSVIQECCD

NTSVIQ

TSCNTSVITQACP.


L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine
d'enveloppe des virus de la classe HIV-2 et du virus SIV-1, ayant l'une des
formules
suivantes :


XYC-P-C3-A-L-C-N-T7


dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la
mesure 00 les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5
residus
d'acides amines. et chacun des tirets correspond a un residu aminoacyle choisi
parmi
ceux qui permettent de conserver audit peptide les proprietes immunologiques
de rune
des sequences suivantes :


YCAPPGYALLRC-NDT
YCAPAGFAILKCNNKT.


L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine
d'enveloppe des virus de la classe HIV-2 et du virus Sly-1, ayant l'une des
formules
suivantes :

CA 01341634 2013-03-07
1 3 4 1 6 3 4
39f

YCAPPGYALLRC-NDT
YCAPAGFAILKCNNKT
YCAPAGFAILKCNDKK
YCAPAGFAILKCRDKK.
L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine
d'enveloppe des virus de la classe HIV-2 et du virus Sly-1, ayant l'une des
formules
suivantes :

X A-C W Z

dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la
mesure 00 les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5
residus
d'acides amines. et chacun des tirets correspond a un residu aminoacyle choisi
parmi
ceux qui permettent de conserver audit peptide les proprietes immunologiques
de l'une
des sequences suivantes :
NKRPRQAWCWFKG-<
NERPKQAWCRFGG-NWKE
N- -MRQAHCNISRAKWNA.
L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine
d'enveloppe des virus de la classe HIV-2 et du virus Sly-1, ayant l'une des
formules
suivantes :
X-G-DPE NC GEF-YC NZ
XNC-GEF-YC-Z
dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la mesure oü
les proprietes immunologiques du peptide depourvu de ces groupes ne s'en
trouvent
pas essentiellement modifiees, des groupes comportant de 1 a 5 residus
d'acides

CA 01341634 2013-03-07

1 3 4 1 6 3 4


39g

amines, et chacun des tirets correspond a un residu aminoacyle choisi parmi
ceux qui
permettent de conserver audit peptide les proprietes immunologiques de l'une
des
sequences suivantes :

KGSDPEVAYMVVTNCRGEFLYCNMTWFLN
NCRGEFLYCN
GG-DPEVTFMVVTNCRGEFLYCKIVINWFLN
NCRGEFLYCK
-GGDPEIVTHSFNCGGEFFYCNSTQLFN
NCGGEFFYCN.


L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine
d'enveloppe des virus de la classe HIV-2 et du virus SIV-1, ayant l'une des
formules
suivantes :

X ----- C-I-Q I G XZ


XC-I-Q-IZ

dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la
mesure o0 les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5
residus
d'acides amines, et chacun des tirets correspond a un residu aminoacyle choisi
parmi
ceux qui permettent de conserver audit peptide les proprietes immunologiques
de l'une
des sequences suivantes :

RNYAPCHIKQIINTVVHKVGRNVY
CHIKQII
RNYVPCHIRQIINTVVHKVGKNVY
CHIRQII

TITLPCRIKQFINMWOEVGKAMY

CRIKOFI_

L'invention concerne egalement un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine

CA 01341634 2013-03-07


1 3 4 1 6 3 4

39h

d'enveloppe des virus de la classe HIV-2 et du virus Sly-1, ayant l'une des
formules
suivantes :

RNYAPCHIKQIINTVVHKVGRNVY
CHIKQII
RNYVPCHIRQIINTVVHKVGKNVY
CHIRQII
TITLPCRIKOFINMWQEVGKAMY
CRIKOFI
SITLPCRIKQIINMWQKTCKAMY

CRIKQII
NITLOCRIKQIIKMVAGR-KAIY.

L'invention concerne egalement un peptide antigenique qaql,
caracterise par l'une des structures de base:

XDCKLVLKGLGMNPTLEEMLTAZ
XDCKLVLKGLGTNPTLEEMLTAZ


dans laquelle X et Z sont des groupements NH2 et OH, respectivement ou, dans
la
mesure oü es proprietes immunologiques du peptide depourvu de ces groupes ne
s'en trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5
residus d'acides amines.


L'invention concerne egalement une sequence nucleotidique
caracterisee en ce qu'elle renferme la sequence d'acides nucleiques du virus
Sly-1
definie a la figure 1B, ou une partie de cette sequence qui encode un peptide
tel qu'il
est susmentionne, et qui peut etre utilisee comme sonde pour detecter la
presence du
virus HIV-2.
L'invention concerne egalement une sequence nucleotidique
caracterisee en ce qu'elle renferme la sequence d'acides nucleiques du virus
Sly-1
definie a la figure IC, ou une partie de cette sequence pouvant etre utilisee
comme
sonde pour detecter la presence du virus HIV-2.

CA 01341634 2013-03-07


1 3 4 1 6 3 4
39i

L'invention concerne egalement un peptide ayant une structure
peptidique en commun avec celles de l'ossature peptidique de SIV-1,
caracterise en
ce qu'il comprend au moms l'une des sequences d'acides amines des proteines de

SIV-1 parmi les sequences suivantes :
GAG representee a la figure 4
POL " 5
6
7
X 8
F II 9
TAT " 11 1/ 10
ART " 11

ou une partie de ces sequences ayant des proprietes imnnunologiques communes
avec
la proteine correspondante.

L'invention concerne egalement un acide nucleique recombinant
caracterise en ce qu'il comprend un acide nucleique tel qu'il est
susmentionne, insere
dans un acide nucleique provenant dun vecteur.

L'invention concerne egalement une composition antigenique
contenant, conjugue avec une molecule porteuse, un peptide qaq tel qu'il est
susmentionne, au moms un peptide qaq1 tel qu'il est susmentionne ou au moms un
oligornere de ce peptide, caracterisee en ce qu'elle a la capacite d'être
reconnue par
des fluides biologiques d'origine humaine contenant des anticorps anti-HIV-2
et, dans
une certaine mesure, des anticorps anti-HIV-1.

L'invention concerne egalement une composition antigenique
contenant, conjugue avec une molecule porteuse, au moms un peptide tel qu'il
est
susmentionne ou au moms un oligomere de ce peptide, caracterisee en ce qu'elle

reconnait specifiquement la presence d'anticorps contre HIV-2.

L'invention concerne egalement une composition immunogene
contenant au moms un peptide ou au moms un oligornere de ce peptide ou ce
peptide

CA 01341634 2013-03-07



1 3 4 1 6 3 4

39j


sous forme conjuguee avec une molecule porteuse, tel qu'il est susmentionne,
en

association avec un vehicule pharmaceutique acceptable pour la production de
vaccins,

caracterisee en ce qu'elle induit la production d'anticorps contre les susdits
peptides en

quantite suffisante pour inhiber efficacement les proteines du retrovirus HIV-
2.


L'invention concerne egalement un procede de diagnostic in vitro de

l'infection par HIV-2 dans un liquide biologique comprenant:



- la mise en contact de ce liquide biologique avec au moms un peptide tel
qu'il

est susmentionne ou un conjugue de ces peptides avec une molecule

porteuse ou des peptides qaq tel qu'il est susmentionne, et

- la detection de la presence eventuelle dun complexe antigene-anticorps par

des methodes physiques ou chimiques, dans ledit liquide biologique.



L'invention concerne egalement un kit pour le diagnostic in vitro de

l'infection par HIV-2 dans un liquide biologique caracterise en ce qu'il
comprend :



- une composition peptidique contenant un peptide tel qu'il est susmentionne,
ou

un mélange de ces peptides, ou un conjugue de ces peptides avec une

molecule porteuse, ou les peptides qaq tel qu'il est susmentionne,

- un reactif pour la constitution du milieu propice a la realisation dune
reaction

immunologique,

- un ou plusieurs reactifs eventuellement marque(s) pour la detection du

complexe antigene-anticorps forme par la reaction immunologique, et
- un liquide biologique de reference depourvu d'anticorps reconnus par ladite

composition peptidique.



L'invention concerne egalement une sequence nucleotidique codant

pour un peptide constitue de 50 acides amines ou moms comprenant la sequence
d'acides amines CAFRQVC (CysAlaPheArgGInValCys), ledit peptide etant capable

d'immunoreaction avec des anticorps diriges contre le virus d'immunodeficience


humaine de type 2 (HIV-2, aussi appele LAV 2).



L'invention concerne egalement un vecteur d'expression comprenant

une sequence nucleotidique codant pour un peptide constitue de 50 acides
amines ou

CA 01341634 2013-03-07

1 3 4 1 6 3 4
39k
moms comprenant la sequence d'acides amines CAFRQVC
(CysAlaPheArgGInValCys), ledit peptide etant capable d'immunoreaction avec des

anticorps diriges contre le virus d'immunodeficience humaine de type 2 (HIV-2,
aussi
appele LAV-2).
L'invention concerne egalement une cellule transformee avec une
sequence nucleotidique codant pour un peptide constitue de 50 acides amines ou
mains comprenant la sequence d'acides amines CAFRQVC
(CysAlaPheArgGInValCys), ledit peptide etant capable d'immunoreaction avec des
anticorps diriges contre le virus d'immunodeficience humaine de type 2 (HIV-2,
aussi
appele LAV-2).

L'invention concerne egalement un procede pour la preparation dun
peptide constitue de 50 acides amines ou mains comprenant la sequence d'acides
amines CAFRQVC (CysAlaPheArgGInValCys), qui comprend la transformation de
cellules bacteriennes avec un vecteur comprenant une sequence nucleotidique
codant
pour un peptide constitue de 50 acides amines ou mains comprenant la sequence
d'acides amines CAFRQVC (CysAlaPheArgGInValCys) la culture desdites cellules
bacteriennes, et l'isolement dun peptide constitue de 50 acides amines ou
mains
comprenant la sequence d'acides amines CAFRQVC (CysAlaPheArgGInValCys)
produit par lesdites cellules.

L'invention concerne egalement une sequence nucleotidique marquee
codant pour un peptide constitue de 50 acides amines ou mains comprenant la
sequence d'acides amines CAFRQVC (CysAlaPheArgGInValCys).

L'invention concerne egalement une utilisation dune sequence
nucleotidique tel qu'il est susmentionne, comme sonde dans un procede de
diagnostic
in vitro de la presence ou non du virus HIV-2 ou dun variant dans des
echantillons
de serums ou d'autres liquides ou tissus obtenus a partir de patients
suspectes d'être
porteurs du virus HIV-2.

L'invention concerne egalement un procede de diagnostic in vitro de la
presence ou non du virus HIV-2 ou d'un variant dans des echantillons de serums
ou
d'autres liquides ou tissus obtenus a partir de patients suspectes d'être
porteurs du

CA 01341634 2013-03-07


1 3 4 1 6 3 4

391


virus HIV-2 comprenant :


- l'extraction d'acides nucleiques a partir d'un echantillon de serum ou
d'autres liquides ou tissus obtenus a partir de patients suspectes d'etre
porteurs du virus HIV-2 afin de rendre ces acides nucleiques accessibles
l'hybridation avec une sonde;
- la mise en contact de l'extrait d'acides nucleiques avec une sonde etant une
sequence nucleotidique tel que susmentionne ou un mélange de sondes
etant des sequences nucleotidiques tel que susmentionne; et
- la detection de l'hybridation eventuellement produite.


L'invention concerne egalement une utilisation, dans un procede de
diagnostic in vitro de la presence ou non du virus HIV-2 ou d'un variant dans
des echantillons de serums ou d'autres liquides ou tissus obtenus a partir de
patients suspectes d'être porteurs du virus HIV-2, d'un acide nucleique
refermant une sequence qui encode un peptide ayant des proprietes
immunologiques en commun avec celles de l'ossature peptidique de la
glycoproteine d'enveloppe des virus de la classe HIV-2, caracterise en ce
qu'il
a egalement une structure peptidique en commun avec l'ossature peptidique
de la glycoproteine d'enveloppe de SIV-1.


L'invention concerne egalement un procede de diagnostic in vitro de
la presence ou non du virus HIV-2 ou d'un variant dans des echantillons de
serums ou d'autres liquides ou tissus obtenus a partir de patients suspectes
d'être porteurs du virus HIV-2 comprenant :


a) l'extraction d'acides nucleiques a partir d'un echantillon de
serum ou d'autres liquides ou tissus obtenus a partir de patients
suspectes d'être porteurs du virus HIV-2 afin de rendre ces
acides nucleiques accessibles a l'hybridation avec une sonde;
b) la mise en contact de l'extrait d'acides nucleiques avec une
sonde ou un mélange de sonde originaires d'un HIV et/ou d'un
SIV;
c) la detection de l'hybridation eventuellement produite.

CA 01341634 2013-03-07

1 3 4 1 6 3 4


39m


L'invention concerne egalement un procede de diagnostic de la
presence ou non du virus HIV-2 ou d'un variant, dans des echantillons de
serums ou
d'autres liquides ou tissus obtenus a partir de patients suspectes d'être
porteurs du
virus HIV-2 comprenant les etapes suivantes :
a) une etape d'hybridation conduite dans des conditions stringentes,
par mise en contact de l'ADN de cellules de rechantillon du patient
suspect avec une sonde telle qu'elle est susmentionnee, sur une
membrane;
b) le lavage de ladite membrane avec une solution assurant la
conservation de ces conditions stringentes de l'hybridation ; et
c) la detection de la presence ou non du virus HIV-2 par la detection de
l'hybridation eventuellement produite.


L'invention concerne egalement l'utilisation en tant que sonde d'hybridation
d'un
ADNc issu de SIV-1 ou d'un fragment de cet ADNc caracterise en ce que cet ADNc

ou ce fragment d'ADNc code pour un peptide ayant une sequence commune a SIV-1
et a HIV-2 permettant de detecter les anticorps diriges contre un HIV-2 ou un
variant
dans les fluides biologiques de personnes ayant le SIDA.


L'invention concerne egalement un procede de diagnostic in vitro de
l'infection par
HIV-2 comprenant :
a) depot de quantites determinees dune composition peptidique ayant
l'une des formules suivantes :
XAIEKYL-DZ
X-LE-AQIQQEKNMYELQKLNSWZ
XQIQQEKNZ
XELGDYKLVEITPIG-APT -KR Z
XYKLVEITPIG-APT--RZ
XDCKLVLKGLGMNPTLEEMLTAZ
XDCKLVLKGLGTNPTLEEMLTAZ
dans laquelle X et Z sont des groupements NH2 et OH respectivement ou, dans la

mesure ou les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5
residus d'acides amines, et chacun des tirets correspond a un residu
aminoacyle
choisi parmi ceux qui permettent de conserver audit peptide les proprietes
immunologiques de l'une des sequences suivantes :


A

CA 01341634 2013-03-07


1 3 4 1 6 3 4

39n

AIEKYLQDQ
AIEKYLKDQ
SLEQAQIQQEKNMYELQKLNSW
QIQQEKN
LLEEAQIQQEKNMYELQKLNSW
ELGDYKLVEITPIGFAPTKEKRYSSAH
YKLVEITPIGFAPTKEK
ELGDYKLVE1TPIGLAPTNVKRYTTG
YKLVEITPIGLAPTNVK
dans les puits dune microplaque de titration,
b) introduction dans lesdits puits de dilutions croissantes du serum
devant etre diagnostique,
c) incubation de la microplaque,
d) rincages repetes de la microplaque,
e) introduction dans les puits de la microplaque d'anticorps marques
contre des immunoglobulines du sang, le marquage de ces anticorps
ayant ete realise a l'aide dune enzyme selectionnee parmi celles qui
sont capables d'hydrolyser un substrat en modifiant l'absorption des
radiations de ce dernier, au moms a une longueur d'onde determinee,
et
f) detection de la quantite de substrat hydrolyse, en comparaison avec
un temoin de controle.


L'invention concerne egalement l'utilisation dun peptide ayant l'une des
formules
suivantes :
XAIEKYL-DZ
X-LE-AQIQQEKNMYELQKLNSWZ
XQIQQEKNZ
XELGDYKLVEITPIG-APT -KR Z
XYKLVEITPIG-APT--RZ
XDCKLVLKGLGMNPTLEEMLTAZ
XDCKLVLKGLGTNPTLEEMLTAZ
dans laquelle X et Z sont des groupements NH2 et OH respectivement ou, dans la

mesure ob les proprietes immunologiques du peptide depourvu de ces groupes ne
s'en trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5

CA 01341634 2013-03-07


1 3 4 1 6 3 4



390


residus d'acides amines, et chacun des tirets correspond a un residu
aminoacyle

choisi parmi ceux qui permettent de conserver audit peptide les proprietes

immunologiques de l'une des sequences suivantes :

AIEKYLQDQ

AIEKYLKDQ

SLEQAQIQQEKNMYELQKLNSW

QIQQEKN
LLEEAQIQQEKNMYELQKLNSW

ELGDYKLVEITPIGFAPTKEKRYSSAH

YKLVEITPIGFAPTKEK

ELGDYKLVEITPIGLAPTNVKRYTTG

YKLVEITPIGLAPTNVK

pour production d'anticorps polyclonaux qui reconnaissent les proprietes

immunologiques de HIV-2.


L'invention concerne egalement l'utilisation dun peptide ayant l'une des
formules

suivantes :
XAIEKYL-DZ

X-LE-AQIQQEKNMYELQKLNSWZ
XQIQQEKNZ
XELGDYKLVEITPIG-APT--KR Z

XYKLVEITPIG-APT--RZ

XDCKLVLKGLGMNPTLEEMLTAZ

XDCKLVLKGLGTNPTLEEMLTAZ

dans laquelle X et Z sont des groupements NH2 et OH respectivement ou, dans la

mesure ou les proprietes immunologiques du peptide depourvu de ces groupes ne

s'en trouvent pas essentiellement modifiees, des groupes comportant de 1 a 5

residus d'acides amines, et chacun des tirets correspond a un residu
aminoacyle

choisi parmi ceux qui permettent de conserver audit peptide les proprietes
immunologiques de rune des sequences suivantes :
A1EKYLQDQ

A1EKYLKDQ

SLEQAQIQQEKNMYELQKLNSW

QIQQEKN
LLEEAQIQQEKNMYELQKLNSW

CA 01341634 2013-03-07


1 3 4 1 6 3 4

39p


ELGDYKLVEITPIGFAPTKEKRYSSAH
YKLVEITPIGFAPTKEK
ELGDYKLVE ITP I GLAPTNVKRYTTG
YKLVEITPIGLAPTNVK
pour production d'anticorps monoclonaux qui reconnaissent les proprietes
immunologiques de HIV-2.


L'invention concerne egalement l'utilisation, dans un procede de diagnostic in
vitro
de la presence ou non du virus HIV-2 ou d'un variant dans des echantillons de
serums ou d'autres liquides ou tissus obtenus a partir de patients suspectes
d'être
porteurs du virus HIV-2, d'un acide nucleique renfermant une sequence qui code

pour un peptide ayant des proprietes immunologiques en commun avec celles de
l'ossature peptidique de la glycoproteine d'enveloppe des virus de la classe
HIV-2,
caracterise en ce qu'il a egalement une structure peptidique en commun avec
l'ossature peptidique de la glycoproteine d'enveloppe de SIV-1 represente par
les
nucleotides 6090 a 8732 de la figure 1B.


L'invention concerne egalement un procede de diagnostic in vitro de la
presence ou
non du virus HIV-2 ou d'un variant dans des Ochantillons de serums ou d'autres
liquides ou tissus obtenus a partir de patients suspectes d'être porteurs de
virus HIV-
2 comprenant:
a) l'extraction d'acides nucleiques a partir d'un echantillon de serum ou
d'autres
liquides ou tissus obtenus a partir de patients suspectes d'être porteurs du
virus HIV-2 afin de rendre ces acides nucleiques accessibles a l'hybridation
avec une sonde;
b) la mise en contact de l'extrait d'acides nucleiques avec une sonde ou un
mélange de sondes originaires d'un HIV-2 represente par les nucleotides 6119
a 8692 de la figure 1A et d'un Sly represente par les nucleotides 6090 a 8732
de la figure 1 B; et
c) la detection de l'hybridation eventuellement produite.


L'invention concerne egalement un procede de diagnostic de la presence ou non
du
virus HIV-2 ou d'un variant, dans des echantillons de serums ou d'autres
liquides ou
tissus obtenus a partir de patients suspectes d'être porteurs du virus HIV-2
comprenant les etapes suivantes:

CA 01341634 2013-03-07

1 3 4 1 6 3 4


39q


a) une etape d'hybridation conduite dans des conditions stringentes, par mise
en
contact de l'ADN de cellules de rechantillon du patient suspect avec une sonde

marquee comprenant l'acide nucleique susmentionne, sur une membrane;
b) le lavage de ladite membrane avec une solution assurant la conservation de
ces conditions stringentes de l'hybridation; et
c) la detection de la presence ou non du virus HIV-2 par une methode
d'immunodetection.


L'invention concerne egalement l'utilisation, dans un procede de diagnostic in
vitro de la presence ou non du virus HIV-2 ou d'un variant dans des
echantillons de serums ou d'autres liquides ou tissus obtenus a partir de
patients suspectes d'être porteurs du virus HIV-2, d'un acide nucleique ayant
une sequence allant des nucleotides 6090 a 8732 de la figure 1B.


L'invention concerne egalement un procede de diagnostic in vitro de la
presence ou non du virus HIV-2 ou d'un variant dans des echantillons de
serums ou d'autres liquides ou tissus obtenus a partir de patients suspectes
d'être porteurs de virus HIV-2 comprenant:
a) l'extraction d'acides nucleiques a partir d'un echantillon de serum
ou d'autres liquides ou tissus obtenus a partir de patients
suspectes d'être porteurs du virus HIV-2 afin de rendre ces acides
nucleiques accessibles a l'hybridation avec une sonde;
b) la mise en contact de l'extrait d'acides nucleiques avec (i) une
sonde ayant une sequence allant des nucleotides 6090 a 8732 de
la figure 1B, ou (ii) un mélange d'une sonde ayant une sequence
allant des nucleotides 6119 a 8692 de la figure 1A et d'une sonde
ayant une sequence allant des nucleotides 6090 a 8732 de la
figure 1B; et
c) la detection de l'hybridation eventuellement produite.
L'invention concerne egalement un procede de diagnostic de la presence ou
non du virus HIV-2 ou d'un variant, dans des echantillons de serums ou
d'autres liquides ou tissus obtenus a partir de patients suspectes d'être
porteurs du virus HIV-2 comprenant les etapes suivantes:

CA 01341634 2013-03-07

1 3 4 1 6 3 4
39r

d) une etape d'hybridation conduite dans des conditions stringentes,
par mise en contact de l'ADN de cellules de rechantillon du patient
suspect avec une sonde marquee comprenant l'acide nucleique
selon la revendication 1, sur une membrane;
e) le lavage de ladite membrane avec une solution assurant la
conservation de ces conditions stringentes de l'hybridation; et
f) la detection de la presence ou non du virus HIV-2 par la detection
de la presence ou de l'absence d'hybridation de l'ADN de
rechantillon avec la sonde.

Sorry, the representative drawing for patent document number 1341634 was not found.

For a clearer understanding of the status of the application/patent presented on this page, the site Disclaimer , as well as the definitions for Patent , Administrative Status , Maintenance Fee  and Payment History  should be consulted.

Admin Status

Title Date
Forecasted Issue Date 2013-03-19
(22) Filed 1988-01-22
(45) Issued 2013-03-19

Abandonment History

There is no abandonment history.

Maintenance Fee

Description Date Amount
Last Payment 2020-02-21 $200.00
Next Payment if small entity fee 2021-03-19 $100.00
Next Payment if standard fee 2021-03-19 $200.00

Note : If the full payment has not been received on or before the date indicated, a further fee may be required which may be one of the following

  • the reinstatement fee set out in Item 7 of Schedule II of the Patent Rules;
  • the late payment fee set out in Item 22.1 of Schedule II of the Patent Rules; or
  • the additional fee for late payment set out in Items 31 and 32 of Schedule II of the Patent Rules.

Payment History

Fee Type Anniversary Year Due Date Amount Paid Paid Date
Filing $0.00 1988-01-22
Maintenance Fee - Patent - Old Act 2 2015-03-19 $100.00 2015-02-16
Maintenance Fee - Patent - Old Act 3 2016-03-21 $100.00 2016-02-17
Maintenance Fee - Patent - Old Act 4 2017-03-20 $100.00 2017-02-20
Maintenance Fee - Patent - Old Act 5 2018-03-19 $200.00 2018-02-16
Maintenance Fee - Patent - Old Act 6 2019-03-19 $200.00 2019-02-14
Maintenance Fee - Patent - Old Act 7 2020-03-19 $200.00 2020-02-21
Current owners on record shown in alphabetical order.
Current Owners on Record
INSTITUT PASTEUR
Past owners on record shown in alphabetical order.
Past Owners on Record
ALIZON, MARC
CHAKRABARTI, LISA
CLAVEL, FRANCOIS
GUETARD, DENISE
GUYADER, MIREILLE
MONTAGNIER, LUC
SONIGO, PIERRE
TIOLLAIS, PIERRE
Past Owners that do not appear in the "Owners on Record" listing will appear in other documentation within the application.

To view selected files, please enter reCAPTCHA code :




Filter Download Selected in PDF format (Zip Archive)
Document
Description
Date
(yyyy-mm-dd)
Number of pages Size of Image (KB)
Cover Page 2013-03-07 1 27
Abstract 2013-03-07 1 21
Description 2013-03-07 57 1,941
Claims 2013-03-07 2 54
Drawings 2013-03-07 35 1,446
Examiner Requisition 2012-07-03 2 44
Examiner Requisition 2006-12-11 6 391
Prosecution Correspondence 2007-06-11 12 493
Examiner Requisition 2009-05-01 8 568
Prosecution Correspondence 2009-10-29 5 278
Examiner Requisition 2011-06-09 10 605
Prosecution Correspondence 2011-12-08 10 554
PCT Correspondence 2012-12-28 1 41
Office Letter 2006-11-10 1 19