Note: Descriptions are shown in the official language in which they were submitted.
~ W096l03438 2 1 q ~ 8 6 8 1 . I/L~
ANTIBODIES ~HIC~ ACTIVATE
A~ ERYT~ROPOIETIN RECEPTOR
Field of the Invention
This invention relates to antibodiçs which
recognize an erythropoietin receptor. More
particularly, the invention relates to antibodies which
activate ap erythropoietin receptor and stimulate
erythropoiesis.
Backr~rollnd of the Invention
Erythropoietin ~EPO) is a glycoprotein hormone
involved in the growth and maturation of erythroid
progenitor cells into erythrocytes. EPO is produced by
the liver d~riPg fetal life and by the kidney of adults
and stimulates the production of red bLood cells irom
erythroid precursors. Decreased production of EPO, which
commonly occurs in adults as a result of renal failure,
leads to anemia. EPO has been produced by qenetic
engineering technir~ues involving expression and secretion
of the protein frbm a host cell transfected with the gene
encoding erythropoietin. Administration of recombinant
EPO has been effective in the treatment of anemia. For
25 example, Esc~bach et al. ~N. Engl J Med 316, 73 ~1987))
describe the use of EPO to correct anem~a resulting from
chronic renal failure.
The purification of human urinary EPO was described
by Miyake et al. (J. Biol_ Chem. 2~, 5558 ~1977)). The
idep~if r~ n, cloning, and expression of genes
~ encoding erythropoietin is described in g. S. Patent ~o
4,703,008 to Lin. A description of a method for
purificatio~ of recombinant EPO from cell medium is
included in U. S Patent ~o. 4,667,016 to Lai et al.
W096l0~8 ~ V~ 5~ ~
- 2 2 ~ 9 58 68
Little is known about the mechanism by which EPO
stimulates erythropoiesis. While it is clear that EPO
activates cells to grow and/or~differentiate by binding
to specific cell surface receptors, the specific
mechanism of activation as well as the structure of the
receptor and any associated protein(s) is not completely
understood. The erythropoietin receptor (EPO-R) is
thought to exist as a multimeric complex. Sedimentation
studies suggested its molecular weight is 330+48 kDa
(Mayeux et al. Eur. J. Biochem. 194, 271 (1990)).
Crosslinking studies indicated that the receptor complex
consists of at least two distinct polypeptides, a 66-72
kDa speciesr and 85 and 100 kDa species (Mayeux et al.
J. Biol. Chem. 266, 23380 ll99i)); McCaffery et al. J.
Biol. Chem. ~, 10507 (1991)). A distinct 95 kDa
protein was also detected by immunoprecipitation of EPO
receptor (Miura & Ihle Blood 81, 1739 (1993)). ~Another
crosslinking study revealed three EPO containing
complexes of 110, 130 and 145 kDa. The liO and i45 kDa
complexes contained EPO receptor since they could be
immunoprecipitated with antibodies raised against the
receptor (Miura & Ihle, supra). Expression of a
carboxy-terminal truncated EP~O receptor~resulted in
detection of the 110 kDa complex but not the 145 kDa
complex. This suggests that the higher molecular weight
complex contains polypeptides present in the 110 kDa
complex and an additional 35 kDa protein.
Further insight into the structure=and function of
the EPO receptor complex was obtained~upon cloning and
expression of the mouse and human EPO receptors
(D'Andrea et al. Cell 57, 277 (1989); Jones et al. Blood
76, 31 (19gO); Winkelmann et ~al. Blood 76, 24 (1990);
PCT ~pplication No. WO90/08822, U.S. Patent No.
5,278,065 to D'Andrea et al.) The full-length human EPO
receptor is a 483 amino acid transmembrane protein with
an approximately 224 amino acid extracellular domain and
~ W096/03438 2 1 9 5 8 6 8 r~ . 3~s~
- 3
a 25 amino acid signal peptide. Th: hu-~n receptor
shows about an 82% amino acid seque -e .?mology with the
mouse receptor. The cloned full length EPO receptor
expressed in 1 lAn cells (66-72KDa) has been shown
to bind EPO with an affinity (100-300 nM) ~similar to
that of the native receptor on erythroid progenltor
cells Thus this form is thought to contain the main
EPO binding determinant and is referred to as the EPO
receptor. The 85 and 100 KDa proteins observed as part
of a cross-linked complex are distinct from the EPO
receptor but must be in close proximity to EPO because
EPO can be crosslinked to them. The 85 and 100KDa
proteins are related to each other and the 85KDa protein
may be a proteolytic cleavage product of the 100KDa
15 species (Sawyer J. Biol. Chem. 264, 13343 ~(1989)).
A soluble (truncated) form of the EPO receptor
cnntA1n1ng only the P~trAnPllular domain has been
produced and found to bind EPO with an affinity of about
lnM, or about 3 to 10-fold lower than the full-length
20 receptor (Harris et al. J. Blol. Chem. 267, 15205
(1992); Yang & Jones Blood 82, 1713 (1993)). The reason
for the reduced affinity as compared to the full length
protein=is not known. There is a posslbility that other
protein species may also be part of the EPO~ complex and
contribute to EPO binding thus increasing the affinity.
In support-of this possibility is the observation of
Dong & Goldwasser (Exp. Hematol. ~ 83 (1993)) that
fusion of a cell line with a low affinity EPO receptor
with a CHO cell which does not bind EPO resulted in a
~hybrid cell l~ne e~hibiting high EPO binding affinity of
the receptor for EPO. In addition, transfection of a
full length EPOR into CHO cells resulted in a cell line
with both high and low affinity receptors as measured by
Scatchard analysis. Amplification of the EPOR copy
number increased the low affinity but not high affinity
binding. These results are cons ~tent with the presence
W096/03438 r~ ,os ~-r ~
2~ 95868
-- 4 --
of a limited quantity of a protein preaent in CHO cells
that converts the low affinity EPOR to high affinity.
Activation of the EPO receptor results in several
biological effects. Three of the activities include .
stimulation of proliferation, stlmulation of
differentiation and lnhibitlon of apoptosis (Liboi et
al. Proc. Natl. Acad. Sci. USA 90, 11351 (1993~; ~oury
Science 2~, 378 (1990)). The signal transduction
pathways resulting in stimulation of proliferation and
stimulation of diffe=rentiation appear to be separable
(Noguchi et al. Mol. Cell. Biol. 8, 2604 (1988); Patel
et al. J. Biol. Chem. 267, 21300 (1992), Liboi et al.
ibid). Some results suggest that an accessory protein
may be necessary for mediating the differentiation
signal (Chiba et al. Nature 3~2, 6g6 (1993); Chiba et
al. Proc. Natl. Acad. Sci. USA 90, 11553 (1993)).
However there is controversy regarding~the role of
accessory proteins i~ differ~nt;~t1~n since a
constitutively activated form of the receptor can
stimulate both proliferation and differentiation (Pharr
et al. Proc. Natl. Acad. Sci. USA 90, 938 (1993~).
Activation of the EPO receptor may be due to its
dimerization. That is, EPO may act as a crosslinker
between two EPO receptor molecules. There is evidence
in support of this proposal. An arginine to cysteine
mutation at position 129 of the murine EPO receptor
results in constitutlve activation of the receptor,
presumably because of a disulfide bond formed between
two receptors subunits (Yoshimura et al. Nature 348, 647
(1990)). In addition EPOR is=found in mul~imeric
complexes in cells (Miura & Ihle Arch. Biochem. Biophys.
30~, 200 (1993)). However, isolation -of a stable
multimeric form of purified EPO soluble receptar has nat
been reported. In addition, dimeri2ation af EPOR may be
required, but not by itself be sufficient for complete
activation of cells. For example, dimeri2ation may
21 95868
~ W096f03438 r~l,u~ 58
~ - 5
result in a proliferative signal but not a
diff~r~nt;At;r~n signal. That is, accessory proteins may
be required to send the differentiation signal.
The possible relationship between EPO receptor
dimeri-ation and activation may be exploited to iàentify
compounds which are dif~erent from EPO but activate the
receptor. For example, antibodies~possess two identical
binding sites for antigen. An anti-EPOR antibody can
bind two EPOR molecules and could bring them into close
proximity to each other to allow dImerization. In order
to function ~ vivo, these antibodies must recognize the
EPOR on surfaces of cells and bind in a way that allows
activation of the signal transduction pathway. In
addition, it is desirable that activation result in both
prol;fPrAtirn and diff~nrnt;At1rn of erythroid
progenitors. A similar approach to understand the
activation of human growth hormone receptor (Fuh et al.
Science 256, 1677 (1992~) and epidermal growth factor
receptor (Schreiber et al. Proc. Natl. Acad. Sci. USA
78, 7535 (1981)) has been reported .
It would be desirable to i~entify molecules which
have the property of activating the EPO receptor and
St; lAt;ng erythropoie5is. In order to do so, an
understanding of the mechanism of EPO receptor
activation and signal transduction is important. One
approach to elucidating this r ~hAn;qm may ~e to
identify antibodies which recognize the EPO receptor so
as to activate the receptor and stimulate
erythropoiesis. Such antibodies are useful in
therapeutic and diagnostic appl;rAt;rnc and would also
be useful folapro~ing EPO receptor function.
The following references describe antibodies which
bind to the mouse or human EPO receptor:
D'Andrea et al. in Th~ B;olory of ~emtaopoiesis
Wiley-1iss, Inc~ (lg90) pp. 153-159, generated
polyclonal aAti-peptide antibodies against an amino-
W096/03438 r~~ ,r'~.~58 ~
~ 958~
6 - ~- ~
teIminal and a carboxy-terminal peptide of murine EPO
receptor. The antibodies we:re shown to react with mouse
EPO receptor in a Western blot.
Bailey et al. Exp. Hematol. ~1, 1535-1543 (1993)
generated polyclonal anti-peptide antibodies agalnst
synthetic peptides homologous to the extraceulIular and
cytoplasmic domains of the mouse EPO receptor.~ Receptor
activation by these antibodies:, as measured by 3H
thymidine uptake into spleen cells from phenylhydrazine
treated'mice, was not detected .
Baynes et al. Blood ~, 2088-20~5" ~1993) generated
a polyclonal antibody to an amino-termInal peptide in
the human EPO receptor. The antibody was shown to react
with a soluble form of the receptoI present in human
serum.
D'Andrea et al. Blood 82, 46-52 (1993) generated
monoclonal antibodies to human EPO receptor. The
antibodies bind to Ba~F3 cells transfected with the
human EPO cDNA clone and some ~inhibit EPO binding and
neutalize EPO-dependent growth.
Fisher et al. Blood 8~,' lg7A (1993) used the same
monoclonal antibodies as desc~ibed in D'Andrea, supra to
distinguish erythroid progenitor cells having EPO-
dependent growth and maturation from those having EPO-
independent growth and maturation.
None of the antibodies descIibed in theafoIementioned references were reported to zctivate the
EPO receptor or stimulate the:growth and~or maturation
of erythroid progenitor cells.
Therefore, it is an object of the invention to
produce antibodies~which recognize an EPO receptor and
bind to it such that the receptor is activated. It is a
further ob~ect of the invention to produce antibodies
which bind to an EPO receptor~and stimulate
erythropolesis by stimulating the proliferation and/or
21 q5868
~ W096/03438 ~ J~-~
- 7 -
dlfferentiation of erythroid progenitor cells to
erythrocytes. Such antibodies are useful in the
treatment of anemia or in the diagnosis of disea3es
characterized by dysfunctional EPO receptor. Further,
such antibodies ma~ lead to the identification of
therapeutic agents for the treatment of anemia.
S ry of the Inventlon
The invention relates to antibodies or fragments
thereo_ which activate an erythropoietin receptor.
Screening of antibodies which=recognize the human EPO
receptor has revealed that two antibodies, designated
Mab 71 and Mab 73, stimulated the proli~eration of UT7-
EPO cells, an EPO-dependent cell line that does not
prol if er~te=in the absence of added EPO. Further, Mab
71 stimulated erythoid colony formation ~rom erythroid
progenitors in human blood. The antibodies encompassed
by the invention may recognize an epitope on an EPO
receptor which is recognized by Mab 71 or Mab 73. The
antibodies are preferably monoclonal antibodies and may
be humanized or human antibodies.~ Also included are
hybridoma cell lines which produce the antibodies of the
invention.
Also provided for are methods and kits ~or
detecting EPQ receptors in biological samples wherein
the methods and kits comprise EPO receptor antibodies of
the invention. Pharmaceutical compositions comprising
EPO receptor antibodies and pharmaceutically acceptable
ad~uvants are also encompassed by the invention. Such
compositons may be used to treat patients having
disorders characterized by low red blood cell levels.
W0 96/03438 ~ ~,r ~, .~A ~
2~ 9~8~ .
-- 8 --
Descri~tion of 8he Flgures
Figure l shows the results of an E~ISA assay that
measured the binding to the Lndicated concentratLons of
synthetLc peptLdes by Mab 71. The peptLdes cor~espond to
the LndLcated amLno acLd residues of human EPO receptor.
Residue 1 is the amLno termLnal prolLne found Ln
secreted EPOR upon cleavage of the leader sequence. ==
FLgure 2 shows the effect o~ varying amounts of
rXuEPO protein and purLfLed Mabs 71 and 73 on 3X
thymLdLne uptake of U~7-EPO cells.= ~ ~ =
Figure 3 shows the e~fec~ of varying amounts of ~=
rXuEPO protein, Mab 71, Mab 73 or a non neutrali~ing
control Mab directed agaLnst EPO ~Mab Fl2) on LnhLbLtion
of 125I EPO bindLng to EPO receptors on the surface of
OCIM1 cells.
FLgure 4 shows a coomassie stained SDS gei of
purified ~Le~ala~ions of monoclonal antLbodies 71 and 73
as well as monoclonal antibody fragments ~Fabs) derived
from Mabs 71 and 73. Samples were run under either
reducing (plus 2-mercaptoethanol) or nonreducing (minus
2-mercaptoethanol) conditions.
Figure 5 shows the effect of varyLng amounts of
purLfLed rHuEPO proteLn, Mab 71 or Fab 71 on 3X
thymLdine uptake of UT7-EPQ celIs.
Figure 6 shows the effect of varyLng amounts of
purified Mab 71 or Fab 71 on 3H thymidine uptake of U~7-
EPO cells to which are also added 30 munits/ml of
recombinant human EPQ (rHuEPQ).
~ W096/03438 ~195868 r~ 458
Figure 7 shows a photograph of purified CD 34+
cells from peripheral blood which were grown 21 days in
methylcellulose in the presence o~ EP0 or Mab 71 under
serum free growth conditions. Photos are of cells
incubated with 500 munlts/ml EP0 ~A), 25 munits/ml EP0
(B), or 2.1 micrograms/ml Mab 71(C).
Figure ~8 shows the effect of varying amounts of
rHuEPO, Mab 71 and a control monoclonal antibody raised
to Her2~neu on the formation of erythroid colonies from
erythroid precursors when grown under serum free growth
conditions in soft agar.
Detailed Description of the Invention
Monoclonal antibodies (Mabs) which recognize the
erythropoietin receptor have been generated by
~ ~7~ng mice with purified soluble human EP0
receptor_ Soluble human EP0 receptor was expressed and
purifiea as aescrIbed in ExampIes l and 2. Of those
Mabs which reacted with soluble human EP0 receptor in
en_yme-linked immunosorbent assays (ELISAs), 96 mabs
were selected for further screening. These mabs were
tested for EP0 receptor binding by BIAcore analysis
(Example 4A) and for binding to EP0 receptor on the
surface of transfected CH0 cells by FACS (Example 4C).
The results of these screenings are shown in Table l.
While a number of antibodies bound EP0 receptor as
determined by BIAcore analysis, only five antibodies of
the 96 tested bound EP0 recep~or displayed on the
surface of transfected CH0 cells as determined by FACS
scanning. 24 antibodies which were positive in ELISA
assays (including those five which were positive by FACS
scanning) were tested for stimulation of ~T7-EP0 cell
proliferatlon. Surprisingly, it was fo:und that two
W096/03438 r.l~u~ 8
~ ~5~8
-- 10 -
antibodies, designated Mab 71 a~d Mab 73, stimulated the
uptake of 3~ thymidine into a UT7-EP0 cell line ~omatsu
et al. Blood 32, 456 (1993)) in the absence of EP0
(Example 8A). The UT7-EP0 cell line requires the
presence of EP0 in its medium for growth. Therefore,
the stimulation of UT7-EP0 cell growth is likely due to
the activation of EP0 receptor by Mab 71 and Mab 73. As
shown ln Figure 2, the response of UT7-EP0 cells was
greater in the presence of Mab 71 than Mab 73. It was
further found that Mab 71 stimulated erythroid molony
formation from human erythroid precursors (see
Example 9). This is the first instance of an antibody
stimulating the formation of erythroid colonies from
erythroid precursors.
The invention provides for an antibody or fragment
thereof which activates an erythropoietin receptor. As
used herein, the term "actlvatlon of an EP0 receptor"
denotes one or more molecular processes which an EP0
receptor undergoes that result in transductlon of a
signal to the interior of a receptor-bearing cell,
wherein the signal ultimately brings about one or more-
changes in cellular physiology. Cellular responses to
EP0 receptor activation are typically changes in the
proliferation or~dlfferentation of receptor-bearlng
cells. Receptor-bearlng cells are typically erythroid
progenitor cells. Presently, the molecular events
leading to signal transduction by EP0 receptor are
poorly understood. ~owever, as indlcated in the
background, some evidence suggests-that EP0 receptor
dlmerizatlon ls at least one event whlch ls llkely to be
required for activation. The present disclosure also -
provides support for this idea. As shown in Figure 5,
stimulation of 3~-thymidine uptake in UT7-EP0 c:ells by
Mab 71 is abollshed when substltuted by the
corresponding Fab fragment designated Fab 71.
~1 9~8
~ W096/03438 .~~ /C~5
Thereforer replacement of the intact, bivalent antibody
with a corresponding monovalent fragment eliminates the
proliferative response. In addition Mab 71 inhibits
activation of the EPO receptor at high concentrations.
Pjoth of these observations support the dimerization
model of activation for the EPO receptor. Mab 71 has
been shown to interact with a synthetic peptide of
residues 49 to 78 of the human EPO-R (see example ~.
Thus this region of EPO-R when bound by a cross linker
such as Mab 71 can result in activation of EPO-R. It is
understood that molecules that cross-link two EPO-R
molecules by binding to residues 49 to 78 are also
encompassed by the invention. These molecules could be
antibodies or other bivalent moLecular entities that
have the property of crosslinking two EPO receptors by
bindlng to residues contained within the region between
resldues 49 and 78 thereby resulting in dimerization and
activation of the EPO receptor.
EPO receptors of the invention will preferably be
1; ~n EPO receptors and, in a particularly preferred
embodiment, will be human EPO receptor. It is
understood that analogs of human EPO receptors are also
encompassed by the invention. Such analogs are
constructed by insertions, deletions, extensions or
substitutions of ~amino acids in the human EPO receptor
sequence. Examples of EPO-R analogs have been described
in U.S. Patent No. 5,292,659 to Yoshimura et al. wherein
substitu~iQn of a cysteine~residue at~position 129 of
the EPOR amino acid sequence resulted in constitutively
activated EPOR. In general, EPO-R analogs having amino
acids changes in regions other than the antibody binding
domains necessary for activation wherein sald analogs
retain secondary and tertiary structure of the human EPO
receptor may be recogni~ed by the antibodies of the
W096l03438 r~ 05: ~
21 95868
- 12 -
present invention. It has been shown that Mab 71
lnteracts with a synthetic peptide of residues 49 to 78
of the human EPO-R (see E~ample 6~. Therefore, EPO-R
analogs having changes in amino- acid re-sidues other than
those at positions 49 tP 78 and retaining the human EPO
receptor secondary and tertiary structure are likely to
be recognized by Mab 71. The numbering of amino acid
residues in the human EPOR polypeptide as used herein
starts with proline at position 1, which is the amino
terminal residue after cleavage of the 25 amino acid
signal peptide. ~ :
Antibodies of the invention bind to an epitope on
an EPO receptor which is involved in receptor
activation. In one embodiment, antibodies recognize an
epitope on an EPO receptor which is recognized by Mab 71
or an epitope which is recognized by Mab 73. Mab 71
recognizes a synthetic peptide spanning amino acid
residues 49 to 78 in the human EPO-R. Therefore, it is
likely that Mab 71 recognizes an epitope on EPO-R which
is defined in whole or in part by this sequence. As
used herein, the term "epitope" refers to the region of
an EPO-R bound by an antibody wherein the binding
prevents assoc~ation of a second antibody to an EPO-R.
The invention also provide-s polyclonal antibodies,
and monoclonal antibodies and ~agments thereof.- --
Antibody fragments encompass those fragments which
activate an EPO receptor. Also encompassed are
humanized antibodies, typically~ produced by recombinant
methods, wherein human sequences coIm~rise part or all of
an antibody which activates an EPO re~cepto~. Examples
of humanized antibodies include chimeric or CDR-grafted
antibodies ~VS Patent Nos. 4,816,567 and 5,225,539).
Also included are-fully human antibodies to EPO receptor
produced in genetlcally-altered mice (see PCT ==
2~ 958~
~ W096/03438 l~
t~ ~e
- 13 -
Application No.93/12227). Antibodies of the invention
may also have a detectable label attached thereto. Such
a label may be a fluorescent ~e.g., fluorescein
isothiocyanate, FITC), enzymatic (e.g, horseradish
peroxidase), affinity (e.g., biotin) or isotopic label
(e g , 12~I)
Also encompassed by the inventlon are hybridoma
cell lires producing a monoclonal antibody which
activates an EPQ receptor. In one embodiment, the
hybridoma cell line produces a mono=clonal antibody which
recognizes an eptitope on an EPO rcceptor which is
recognized by Mab 71 or Mab 73. Generation of hybridoma
cell lines producing monoclonal antibodies to human EPO-
R are described in Example 3. ~he hybridoma cell linewhich produces Mab 71 has been deposited with the
American Type Culture Collection, Rockville, MD on July
26, 1994 under accession no. HB11689. The hybridoma
cell lire which produces Mab 73 has been deposited with
the American Type Culture Collection, Rockville, MD on
July 26, 1994 under ~rceqq~n no. PB11690.
The antibodies oi the present invention are useful
in diagnosing anemia and other diseases characterized by
dysfunctional EPO-R. In one embodiment, a method of
detecting in a biological sample an EPO receptor which
is capable of which being activated comprising the steps
of: (a) contacting the sample with an antibody which
activates an EPO receptor; and (b) detecting activation
of the receptor by the antibody. The biological samples
include tissue specimens, intact cells, or extracts
thereof.~ Antibodies may be used as part of a dlagnostic
kit to detect the presence of_EPO receptors in a
biological sample. Such kits employ antibodies having
3S an attached label to allow for detection. The
antibodies are useful for idertifying normal or abnormal
. . _
WO~G/03438 2 1 9 5 8 6 8 r~
- 14 -
receptors. ~The presence of Ahnor~l receptors in a
biological sample may be indlcatlve of dlsorders such as
Diamond Blackfan anemia, where it is believsd that the
EPO receptor is dysfunctional.
Antibodies of the invention are uséful for treating
disorders charaterized by low red blood cell levels.
Included in the invention are methods of modulating the
endogenous actlvity of an EPO receptor in a mammal,
preferably methods of lncreasfng the activlty of an EPO
receptor. In general, any condltion treatable by
erythropoletin, such as anemia, may also be treated by
the antibodies of the invention. Therapeutic antibodies
are administered by an amount and route of delivery that
is appropriate for the nature and severity of the
condltlon being treated and may be ascertained by one
skilled in the art. Preferably, administration is by
in~ection, elther subcutaneous, lntramuscular, or
intravenous.
The invention provides for a pharmaceutical
composltlon comprlslng a therapeutically effectlve
amount of an antibody which activates an EPO-R:together
with a pharmaceutically acceptable ad~uvant, wherein the
ad~uvant may be selected from one or more of a dlluent,
carrler, preservative, emulsifier, anti-oxidant and/or
stabilizer. A "therapeutically effective amount" as
used herein refers to that amount of antibody which
provides a therapeutlc effect=for a given rrn~t~rn and
administration regimen. In ~he present~ invention, the
therapeutic effect is stimulation o~ red blood cell
production~ as evidenced by a rise in hematocrit in the
patlent being treated. In a preferred embodimeht, the
antibodies are humanized or human antlbodies which may
be prepared using procedures-known to the skilIed
worker. Pharmaceutically acceptable adjuvants are known
to one skilled in the~art and are surveyed extensively
~ W096/03438 2 1 ~ 5 8 6 8 E~~ /58
- 15 -
in Remlngtonls Pharmaceutical Sciences, 18th ed. A.R.
Gennaro, ed;~~Mack, Easton, PA (1990).
The following examples are offered to more fully
illustrate the invention, but are not construed as
limiting the scope thereof.
EXAMPLE 1
Production of soluble human erythropoietin receptor
A. Isolation of clones for expression of soll~hle human
erythro~oiet;n rece~tor.
Using a clone containing the human erythropoietin
rereptor as described by ~ones et al. ~lU~, the PCR
technique was used to obtain a clone for expression of
soluble h~ erythropoietin receptor (sHuEPOR).
Primers for PCR amplification of human erthropoietin
receptor were:
5' primer:
CTC CAA GCT TGC CGT C C CAT GGA CCA CCT CGG GGC GTC CCT
(SEQ. ID NO:l); and
3' primer:
CAG GTC TAG ATT ACT AGG GAT CCA GGT CGC TAG GC
(SEQ. ID NO:2)
PCR reactions were carried out using 2.5 ng of a
plasmia containing human EPOR, 5 pmoI of each of the
above oligonucleotide primers, 10 mM Tris HC1 ~pH 8.3),
50 mM KCl, 1.5 mM Mg C12, 200 UM each dNTP and 1 unit of
Taq polymerase. Amplification wa-s for 5 cycles of 30
sec. at 94~C, 1 mln. at 50~C, 1 min at 72~C, followed by
20=cycles of~30 sec. at 94~C, 1 mln. at 55~C, 1 mln at
72~C. DNA was purified by passage through a G-50 si~e
21 ~58~8
WO9~/03438 r~ s
- 16 -
exclusion column (Boehringer MAnnh~tm Corp.~, then
dlgested with Hind III and XbaI and ligated into the
expression vector pDSRc2 (DeClerck et al. J. Biol. Chem.
266, 3893 (1991)) which has also been digested ~lth Hind
III and XbaI. Clones containing the desired insert were
verified by DNA se~uence analysis.
The d40EPOR clone was made by PCR from a full
length human EPOR clone (see above). The carbo~y
terminus of d40EPOR is tyr467, the result of adding a
stop codon within the primer. Primers for-PCR
amplification were:
5' primer:
5'-CTC CAA GCT TGC CGT CAC CAT GGA CCA CCT CGG GGC GTC
CCT-3'
lSEQ. ID NO:1); and
3' primer:
5'-AGG TCG ACT ACT AGT AGT CAG TTG AGA-3'
(SEQ. ID NO:3)
PCR amplification used pfu polymerase in pfu buffer2
~Stratagene, Ea Jolla, CA). Reaction nnn~tttnn~ were: 1
cycle at 96~ for 30 sec., 45~ for 1 min., 72~ for 1
min.; 25 cycles at 96~ for 1 min., 55~ for 1 min., 72~
for 2 min. A final 72~ incubation for 5 min. was then
~ performed. The reaction products were separated by
agarose gel electrophoresis and the d~Lv~ tely 1.3 Xb
band was isolated uslng a gene~clean kit ( BIO 101,
Vista, CA.). The purified fragment was ligated into PCR
II (TA cloning kit, Invitrogen, San Diego, CA).
Recombinants were identified by restrictlon analysis and
se~uenced to confirm the desired inserts were present,
A HindIII-SalI fragment was isolated as described above
and ligated into an isolated pDSRc2 vector that had been
previously cut with HindIII and SalI. The resultant
21 95868
~ W096/03438 l~ 'Ju5:~
vector, pDSR~EPORd40 was used for expression in CHO
cells.
B. E~pression of solnhle hnmAn EPOR snd ~d40 EPOP~ in CHO
cells -
The expression plasmid pDSRc2-EPOR-X contains
sequences ~nC~ng human EPOR amlno acids Metl-Pro249 as
shown in Jones et al. supra. Plasmid pDSR~EPORd40
contains sequences encoding Metl-Tyr467. Ten micrograms
of each pIasmid were $ndependently introduced into CHO
cells by calclum phosphate m~;At~ transfection (Wigler
et al. Cell 11, 233 (1977)). Indivldual colonies were
selected based upon expression of the dihydrofQlate
red~ctase gene from the vector. Expression of human
EPOR was monitored by RNA hybri~; 7At 1 ~n (Hunt et al.,
Exp. Hematol, 19: 779 (1991~) and by Western immuno
blotting using an affinity purified ar,tibody. Cell
lines which were positive in these assays were selected
for further eXpansion. Cell lines were adapted to 30nM
Methotrexate (Mtx) to stimulate amplification of EPO-R
expression.
Generation of conditioned media containing soluble
human EPOR was done in both roller bottles and a hollow
fiber bioreactor. Roller bottles were innoculated with
25 2 x 107 cells in 200 ml growth medium (DMEM: Ham's F12
(1:1) supplemented with non-essential amino acids
(NEAA), 30nM Mtx and 5% fetal bovine serum (FBS)
(reagents frPm GIBCO, Grand Island, NY)). Upon reaching
rnnflu~nce In 3-4 days, the medla was replaced with 200
- 30 ml DMEM: Ham's F12, NEAA, 30 nM Mtx with no serum.
Condltioned media was harvested after 6-7 . days and
replaced with fresh serum-free media. Second and third
harvests were collected.
A Cell Pharm biorector cartridge was innoculated
with 5 X 108 cells in growth medium (as above)
supplemented with 5 ug/mL gentamicln. The pH was
.. . . . . ~ _ _
W096/03438 2 1 9 5868 r~ r~ ~
- 18 -
maintained at 7.3. Beginning on day 12 after ~ =
lnnoculation the cells were weaned off of serum to
generate serum-free conditioned media. Harvesting of
conditioned media ~egan on day 17.
.-
EXAMPLE 2
Purification of soluble human eryt~ropoeitin receptor
Four different preparations of soluble recombinant
human EPOR were made. In the first preparation, Epoxy-
activated Sepharose 6B (Pharmacia, Piscataway, NJ) is
coupled with recombinant human erythropo-ietin (rHuEPO)
es~n~l~lly as per manufacturer's instructLons. 218 mg
of rHuEPO in 4.5 mL of 32 mM ZnC12 is added to 7.2 g of
Epoxy-activated Sepharose 6 B previously hydrated and
washed with H2O. This slurry is titrated to pH 10.8
then mixed overnight at room tempurat~re. Any L ~ 1 n 1 ~g
reactive groups are~then blocked ~y addition of
ethanolamine to a final conc~ntr~ n of 1 ~ and mixed
for 4 hours at room temperature. The subsequent steps
are performed at 8~ i 2~ C. T~e coupled resin ~(Epoxy-
EPO) is packed into a column and washed with alternating
cycles of 0.5 _ NaCl ~ 0.1 M HOAc pH 4 and 0.5 ~ NaCl ~
0.1 ~ Borate pH 8. The column is equilibrated with 140
mM NaCl / 10 mM Tris pH 7.6 ~TBS). It is loaded with
1560 mL of roIler bottle produced conditioned media from
CHO cells expressing solu~e EPO-R ~sHuEPO-R). After f
loading is complete, the column is washed with 300 m~
NaCl / 10 m~ Tris pH 7.6 then the bound sHuEPOR~is
eluted with 1 M NaCi / 3 M urea / 10 m~ Tris pH 7.6.
Two UV280 absorbing peaks elute with this buffer. The
second peak to elute, which contains the sHuEPOR, is
pooled and diluted 20 foldlwith H2O. The diluted pool
is then loaded to a 1 mL prep:acked column of Mono Q
~Pharmacia) and eluted with a NaCl gradient in 10 m~
~ W096l03438 2 1 9 ~ 8 6 8 r~
Tris pH 7.6. A single peak elutes, which is pooled,
aliquoted and stored frozen at -80~ C
In the second preparation, a larger Epoxy-EPO
column is made. 20.4 g of Epoxy-activated Sepharose 6 B
is hydrated and washed with H2O, then with acetone and
finally with 50~ f~rr~m;~A in ~2~ pH 10.6. 729 mg oi
rHuEPO in 15 mL of H2O is titrated to p~ 10.6, added to
the resin and mlxed overnight at room tempurature. Any
remalning reactive groups ar.e then blocked by addition
of e~hanolamine to a final concentration of 1 ~ and
mixed for 140~minutes at room temperature. The
subsequent steps are performed at 8~ + 2~ C. The Epoxy-
EPO is packed into a column and washed with 3 ~ urea /
750 m~ NaCl / 10 m~ Tris p~ 7.6, the column is then
equilibrated with TBS. 100 mL of bioreactor produced
conditioned media from C~O cells expressing sHuEPOR are
mixed with 2 mL of Q Sepharose Fast Flow (Pharmacia).
It is ir,cubated for 30 minutes at 8~ + 2~ C with
frequent mixing, then filtered through a 0.45 micron
~ q5 nitrate bottle top filter (Corning). The
filtrate is loaded to the Epoxy-EPO column, washed with
250 m~ NaCl / 10 m~ Tris pH 7.6, then eluted wLth 3 ~
urea / 750 m~ NaCl / 10 m~ Tris pH 7.6. The eluted peak
is pooled and diluted 20 fold with H2O. The diluted
pool is then loaded to a 15 mL coIumn o~ Q Sepharose
Fast Flow and eluted with a NaCl gradient in 10 m~ Tris
pH 7.6. The single peak that elutes is pooled,
aliquoted and stored frozen at -80~ C.
In the third preparation, the same Epoxy-EPO column
~ 30 used in preparation 2 is used. 850 mL of roller bottle
produced conditioned media from CHO cells expressing
~ sEPO-R are mixed with 1.7 mL of Q-Sepharose Fast Flow.
It is processed in the same manner as is done in
prer~r~t; ~n 2.
In th ~ourth preparation, 7.25 L of bioreactor
produced conditioned media from CHO cells expressing
21 95868
WO ~/03438
.
- 20 -
sHuEPOR are mixed wlth 110 mL of Q Sepharose Fast Flow.
It is incubated for 1 hour at 8~ + 2~ C with frequent
mixing, then filtered through a 0.45 micron cellulose
nitrate bottle top filter The filtrate is then diluted
with 7.25 L of H2O and loaded =to a 770 mL column of Q~
Sepharose Fast Flow equilihrat:ed in 20 m~ Tris pH 7.6.
The column is eluted with a NaCl gradient in 20 m~ Tris
pH 7.6. Fractions containing significant amounts of ~
sHuEPO~ based on SDS-PAGE anal=ysis are pooled. ~ Solid
(NH4)2SO4 is added to the pool to a final concentration
of 1.2 ~ then filtered through a 0.45 micron cellulose
nitrate~bottle top filter The filtrate is loaded to a
60 mL column of Phenyl Sepharose 6 lIow sub, Pharmacia)
and eluted with a decreasing qra-dient of 1.2 ~ to 0 ~
(NH4)2S04 in 20 m~ Tris pH 7.6. The ma~or elutin~ peak
is pooled and made 2.4 ~ in (NH4)2SO4 to precipitate the
sHuEPORt. The precipitated sHuEPO~ i5 harvested by
centrifugation, resuspended with H2O and titrated to pH
7.9 with Tris HCl. The resultant solution is filtered
through a 0.45 micron cellu7Ose nitrate filter,
aliquoted and stored frozen at -80~ C.
EXAMPLE 3
Preparation and Screening of hybridoma cell lines
A. En7yme-l;nked I nosorhent Aqsay tEI~
EIAs were /nitially per~formed to determine serum
antibody (Ab) titres of lndividual animals, and later
for scr~ening of potential hybridomas. ~Fl'at bQttom,
high-binding, 96-well microtitration EIA~RIA plates
(Costar CorporaSion, Cambridge, MA) were coated with
purified sHuEPO~ at 5 ~g per ml carbonate-bicar~onate ~
buffer, pH 9.2 (0.015 M Na2CO3, 0.035 M NaHCO3). Fifty
~1 of the Ab were added to e~ch well. Pla~es were ~hen
covered with acetate film (ICN Bi ~;c~l~, Inc'., Cos~-a
~ W096l03438 2 1 9 5 8 6 8 ~ r
- 21 -
Mesa, CA) and were lncubated at room temperature (RT) on
a rocking platform for 2 hours or over-nlght at 4~C.
sHuEPOR lot #1 was used after the flrst and second
boost, lot #2 was used after the third boost. sHuEPOR
lots ~3 and 4 were used for screenirg of hybridomas.
Plates were blocked for 30 mlnutes at RT wlth 250 ~l per
well 5~ BSA solutlon prepared by mixlng 1 part BSA
diluent/blocking solution concentrate (Kirkegaard and
Perry Laboratories, Inc.) with l part ~nn~7ed water
(dH2O). Blocking solution havlng been discarded, 50 ~l
of serum 2-fold dilutions (1:400 through 1:51,200) or
hybridoma tissue culture supern~t~nt~ were added to each
well. Serum diluent was 1% BSA (10~ BSA
diluent/blocking solution concentra~e diluted 1:10 in
Dulbecco's Phosphate Buffered Saline, ~-PBS; Gibco BRL,
Grand Island, NY), while hybridoma supernatants were
tested undiluted. In the case of hybridoma testing, one
well was maintained as a con~ugate control, and a second
well as a positive Ab control Plates were again
lncubated at RT, rocklng, for 1 hour, then washed 4
tlmes using a lx preparation of wash solution 20x
concentrate (Kirkegaard and Perry 1aboratories, Inc.) in
dH2O. Goat anti-mouse IgG heavy- and light- chain
specific horseradish peroxidase cQn~ùgated secondary Ab
(Boehringer Mannheim Biochemicals, Indlanapolis, IN)
dlluted I:1000 in l~ BSA was then incubated in each well
for 30 minutes. Plates were washed as before, blotted
dry and ABTS Peroxidase single component substrate
(Kirkegaard and Perry Laboratories, Inc.) was added.
Absorbance was read at 405 nm for each well using a
Microplate EL310 reader (Bio-tek Instruments, Inc.,
~inooski, VT). Half-maximal titre of serum antibody was
calculated by plotting the loglo Of the serum dilution
versus the optical density at 405 nm, then extrapolating
at the 50% point of the maximal optical density obtained
by that serum. Hybridomas were selected as positive if
2~ 95868
W096/03438 .~ J~IJ~
optical density scored greater than 5-fold above
background.
B . T ization _ _
Ten, 4.5 week old Balb/c mice (CharLes Rivers
Laboratories, Wilmington, MA) were subcutaneously
injected (SQI) with 50 ~g sHuEPOR; lot 1; antigen~
emulsified ir Complete Freund's Adjuvant ~CFA; 50
vol/vol; Difco Laboratories, Detroit, MI). These
animals were boosted (SQI) 4 weeks later with 25 ~g
antigen (Ag; lot 1) prepared in similar fashion using
Incomplete Freund's Adjuvant (ICFA; Difco Laboratories,
Detroit, MI). Mice were bled via the tail 9 days later
and serum antibody (Ab) titres determined by enzyme-
linked immunosorbent assay (EIA). As the 1/2 maximaltitre for each mouse rose above 5000, individual animals
were selected for the hybridoma preparation. The three
animals (~7, 8 and 9) which were used~to generate the
hybrids of interest ($71A and 73A) reguired additional
boosts at 5 weeks and again at 29 weeks using=12.5 ~g Ag
(lot 1) and 25 ~g Ag (lot 2) respectively. These boosts
were performed in the same manner as the initial boost;
that is, as an emulsion in 50~ vol/vol ICFA. Serum Ab
titres continued to be monitorçd 9 days follow~ing each
boost. The final titres of these mice~prior tr fusioP
were 5026, 6842; and 12,945 for animals 7, 8 and 9,
respectively.
C. Ce~l Fusion ~
A~imals 7, 8 and 9 were intravenously injected w~ith
25 ~g of s~uEPOR (lot ~3) 8 weeks following the final
boost. Four days later, mice were sacrificed by carbon
dio~ide and spleens collecte~ under sterlle rrn~;};~ns
into 25 ml Dulbecco's Modified Eagle's Medium containing
200 ~/~iL Penicillin G, 200 ~g/ml Streptomycin sulfate,
and 4 mM glutamine (2x P/S/G DMEM). The spleens were
21 95~68
~ W0 96l03438 r~ u..,_., I'r
- 23 -
trimmed of excess fatty tlssue, thën rinsed through 3
dishes of clean 2X P/S~G DMEM. They were next
transferred to a sterile stomacher bag (Tekmar,
Cincinnati, OH) containing 10 ml of 2x P/S/G DMEM, and
disrupted to single cell~suspension with the Stomacher
Lab Blender 80 (Seward Laboratory UAC House; London,
England). As cells were released from the spleen
capsuie into the media, they were remov~d from the bag
and passed through a 70 llm nylon mesh cell strainer
(Becton Dickinson and Company; Lincoln Park, NJ). Fresh
media was replaced in the bag and the process continued
until the entire cell content of the spleens were
released. These splenocytes were washed 3 times by
centrifugation at 225 x g for 10 minutes. In the first
~usion, splenocytes from animal #9 were used; in the
second fusi-on, splenocytes from anlmals #7 and 3 were
pooled.
Concurrently, log phase cultures of Sp2/0-Agl4
mouse myeloma cells (available from the American Type
20 Culture Collection, Rockviile, MD under accession no.
CRL 1581) grown in complete medium (DM~M, 10% fetal
bovine serum, 2 mM glutamine, 0.1 mM non-essential amino
acids, 1 mM sodium pyruvate, and 10 mM Hepes Buffer;
Gibco Laboratories, Inc., Grand Island, NY), were washed
25 in similar fashion. From this myeloma population, 4 x
107 cells (fusion 1) or 3 x 107 cells (fusion 2) were
taken, mixed with the suspension of-splenocytes, and
pelleted once again. The media was aspirated from the
cell pellet and 2 ml of polyethyiene glycol (PEG 1500
- 30 MWt; Boehringer Mannheim Biochemicals, Indianapolis, IN)
for fusiorl 1 of 3.5 ml of P~G for fusLon 2 at 37~C were
gently mixed into the media over the course of 1 minute.
Thereafter, an equal volume of 2X P/S,'G DMEM was slowly
added. The cells were allowed to rest at 37~C for 2
35 mi~utes, then an additional 9 ml of 2xP/S/G DMEM added.
The cells were again set at 37~C for 4 minutes.
. . .
W096/03438 21 ~ 5868 r~ o~J~ ~
- 24 -
Finally, 30 ml o~ 2x P/S~G DMEM was added to the cell
suspension, and the cells pelleted by centrifugation.
Media was aspirated from the pellet and the cells gently
resuspended into approximately 56 ~1 (fusion l) or 74 ml
(fusion 2) of complete medium containing 100 U/ml
Penicillin G and 100 ~g/ml Streptomycin Sulfate. Cells
were distributed over 10 ~6-we~ll flat bottom ~lssue
culture plates (Becton Dickinson Labware; Lincoln Park,
N~) by single drops from a 5 ml pipette. Plates were
incubated in humidified conditions at 37~C, 5~ C02,
overnight. The next day, an equal volume of selection
medium was added to each well. Selection consisted of
0.1 mM hypoxanthine, 4 x 10-4 mM aminopterin, and 1.6 x
10-2 mM thymidine in complete medium. The fusion plates
were incubated for 7 to lO days with 2 changes~of medium
during this time; HAT selection medium was used after
each fluid change. Tissue culture supernatants were
taken from each hybrid-containing well and tested by EIA
for specific antibody reactivity to sHuEPOR. 96 wells
which were positive in EIA were subjected to further
screening.
D. Dot Blots
Dot blots of reduced sHuEPOR ~lot ~4) were used as
a secondary screening method for EIA positive
hybridomas. The Dot Blot SF Microtitration Apparatus
(Bio-Rad Laboratories, Inc.; Richmond, CA) was set-up
according to the instruction manual; nitrocellulose
membranes t9 x 12 cm; Bio-Rad Laboratories, Inc.;
Richmond, CA) were employed. Antigen was first prepared
by boiling for 5 minutes under reduci~ng conditions with
2-mercaptoethanol (5% vol/vol; Bio-Rad Laboratories,
Inc.; Richmond, CA) in Tris-bufie~ed saline solution
(TBS; lO mM Tris pH 7.5, 154 mM NaCl, 0.01% wt/vol Na
azide). Twenty-five ng of s~uEBOR (lot #4) was loaded
into e~ch well=and aspirated through the nitro~cellulose
~ W096l03438 r~l~u~ s:~
2~ ~5868
.~ ., ~
- 25 -
membrane for binding. The wells were filled with 250 ~l
Blotto-Tween solution (block solution; 2% wt/vol non-fat
dry milk, 50 mM Tris, pH 7.5, 25 mM NaCl, 0.1 mM EDTA,
0.09% vol/vol Tween 20, 0.01% vol/vol anti-foam A) and
ir,cubated at RT for 30 mlnutes. Block solution was
aspi=rated from the wells and the procedure repeated for
a second time to ensure complete blocking of non-
specific sites on the membrane. This was followed by 3
washes through the membrane wlth D-PBS containing 0.1%
vol/vol polyoxyethylene sorbitan monaiaurate (Tween-20;
Bio-Rad Laboratorles, Inc.; Richmond, CA). Ninety-five
~l of EIA-positive hybridoma conditioned medium was next
added to each well and incubated for 45 minutes at RT.
Wells were washed 3x with TBS-Tween (20 mM Tris, pH 7.5,
15 50 mM NaCl, 0.02% vol~vol Tween 20) and 2x with
TBS-Tween (20 mM Tris, pH 7.5 0.5 M NaCl, 0.09% vol/vol
Tween 20) at 250 ~l per wash, aspirating through the
membrane after each addition. One-hundred ~l of goat
anti-mouse IgG, heavy- and light-chain specific,
~RP-con~ugated secondary antibody (1:1000 diluted in
TBS-Tween; Boehringer M~nnh~m Bio~h~m~nlq;
Indianapolis, IN) was incubated in each well for 45 min
at RT. Membranes were washed as before, removed from
the blot apparatus, dipped into prepared Enhanced
Chemiluminescent Reagent (ECL reagent; Amersham Life
Sciences, Corporation; Arlington Heights, ILj, and
exposed to X-OMAT AR film (Kodak Scientific Imaging,
Rochester, ~ew York). Fifteen seconds later, the film
was removed from fiIm cassettes and developed. Each
well was =scored 3+~to 0 based on intensity of dots for
indivldual hybridoma supernatants.
W096/03438 2 1 9 5 8 6 8 . ~ ~ ~ 438 ~
- 26 -
EXAMPLE 4
Anti-EPOR antibody binding to EPOR
~. ~ntihodv bin~ln~ to EPO-R by B~rore An~lysis
Real-time biospecific in~r~r~;~n analysis ~BIA,
Pharmacia Biosensor AB, Uppsala, Sweden) based on
surface plasmon resonance (SPR) (Fiagerstam et al. J.
Mol. Recognition 3, 208 ~1990)~; Malmbory et al. Scand.
J. Immunol. 35, 643 (1992)) was used to screen the ELISA
positive monoclonal antibodies. : ~s
Soluble HuEPOR prepared as described in E~amples ~1
and 2 was covalently coupled to the sensor chip CM5 via
the primary amine group. The immobilization was
performed at a flow of 5 ul/min in HBS (lOmM HEPES
pH7.4, 150 mM NaCl,3.4 mM EDTA, 0.05~ BIAcore sllrfArt~nt
P-2C). The carboxylated matrix of the sens=or chip was
first activated with a 40 ul injection of 1:1 mixture
of EDC ~400 mM N-ethyl-N-(dimethylamine-
propyl)carbodiimide in water, Pharmacia Biosensor AB)and NPIS (lOOmM N-hydroxysuccinimide in water, Pharmacia
Biosensor AB). 65 ul of soluble ~PO-R(50 ug/ml-in 10mM
Na-acetate p~4.0) was iniected to ; ,h;l;7e onto the
sensor chip. The excess reactive groups of the sensor
chip were deactivated with an injection of 50 u~l of
ethanolamine (Pharmacia Biosensor AB)
Each analysis cycle included an injeCtion of 20ul
of hybridoma supernatant,followed by iniection of 10ul
of 10mM HCl for regeneratlon ~of the chip. The SPR
response is measured in Resonance Units (RU). ~For most
proteins,l000 RU corresponds to a surface concentration
of approximately 1 ng/mm2. Results of screening 96
wells which were positive in EIAs are shown in Table 1.
In these experiments, background is typically about 20
RU. Binding to EPOR is slgn~ficant at 50 RU and above.
~W096103438 21 9 F~868 r~ 3 -A
7 _
RT.l;'.
EPO-R Monoclonal Antibodies
ANTIEODY BIACORE PIACOP~E (3) EACS (4) Tnhih;t;nn Stimulation
(1) (2)COMPETITION ME8N of EPO of UT7-EPO
GROUP FLOURE- Activity Cells (6)
SCENCE (s)
1 98 A - - -
2 8 NT - NT NT
3 7 NT - NT NT
4 65 NT - NT NT
13 NT _ NT NT
6 9 NT
7 89 C - NT NT
8 46 NT - NT NT
9 29 NT - NT NT
69 NT - NT NT
11 4 NT - NT NT
12 153 C - NT NT
13 1499 B _ NT NT
l4 8 7 NT - NT NT
29 NT _ NT NT
l6 8 NT - NT NT
17 7 NT - NT NT
18 46 NT
19 9 NT - NT NT
7 NT - NT NT
21 49 NT - NT NT
22 8 NT - NT NT
23 4 NT
2 4 26 NT - NT NT
2 5 8 NT - NT NT
2 6 84 NT - NT NT
27 2 NT - NT NT
2 8 11 NT - NT NT
29 1 NT - NT NT
270 A
31 16 NT - - NT
32 18 NT - NT NT
33 15 NT - NT NT
3 4 2 5 NT - NT NT
363 A - NT NT
36 4 NT - NT NT
37 16 NT
3 8 13 NT - NT NT
39 574 B
NT - NT NT
41 22 NT - NT NT
4 2 23 NT - NT NT
4 3 6 NT - NT NT
44 13 NT - NT NT
13 NT - NT NT
W096/03438 ~ 95~8 r~ 0~158 ~
- 28 -
TAB~ 1 (Con't)
ANTIBOLY BIACORE BIACORE (3) FACS (4) Tnhih;t;nn St;~~ t;nn
(1) (2)COMPETITIONMEAN of EPOof UT7-EPO
GROUP FLOURE-ActivityCells (6)
SCENCE ~5)
46 7 NT - NT NT
47 10 NT - NT NT
4 8 5 NT - NT NT
49 69 NT - NT NT
345 C
51 31 NT - NT NT
52 6 NT - NT NT
53 130 A - NT NT
54 13 NT - NT NT
34 NT - NT NT
56 11 NT - NT NT
57 10 NT - NT NT
58 15 NT 14.99 + ?
59 10 NT - NT NT
NT - NT NT
61 48 NT - NT NT
62 814 A
63 1539 B - NT NT
64 1222 C - NT NT
-5 NT - +/- ?
66 975 C - NT NT
67 1000 A - - ?
6 8 495 C - NT NT
69 877 A
789 A - - ?
71 1584 C 23.55 + (7) +++
72 ll90 B
73 354 C 13.71 - +
74 408 A 18.53
7 5 947 B - NT NT
7 6 6 NT - NT NT
77 434 C
78 119 A - NT NT
79 8 NT - NT NT
11 NT - NT NT
81 -4 NT - NT NT
8 2 4 NT - NT NT
82B -13 NT NT NT NT
8 3 1025 C
84 5 NT - NT NT
11 NT - NT NT
8 6 859 C - NT NT
87 4 NT 12.81
8 8 4 NT - +/- -
89 -1 NT - +/-
9 NT - NT NT
91 0 NT
.
~ W096/03438 ~ l 9 ~ 8 6 8 r~ /C3~5
- 29 -
TABLE 1 (Con't)
ANTIBODY BIACORE BIACOP~E (3) FACS (4) Inhibition St; lA~
(1) (2)CO~PETITIONMEAN o~ EPOo~ UT7-EPo
GROUP FLOURE- Acti~ityCells (6)
SCENOE (5)
92 -3 NT - NT NT
93 2 NT - NT NT
94 5 NT - NT NT
417 A - NT NT
96 7 NT - NT NT
Tissue culture medium conditloned by hybrldomas
secretlng the lndicated antibodies were tested with the
assays indicated. Supernatants ~ ln;ng all the
antibodies~shown gave a positlve signal ln ELISA assays.
+++, ++, + indicate a positive response with +++
indicatlng those having the greatest effect.
- indicates a response less than or equal to the
response of control medium. NT indicates samples were
not tested.--- ? indicates samples that could not be
assigned a response.
(1) Antibodies 1-61 are from mlce number 7 and 8.
Antibodies 62-96 are from mlce number 9.
(2) Response units by Mabs using biacore chip with
attached sHuEPOR.
(3) Competition on BrACORE was to anti sHuEPOR Mab lG2.
sHuEPOR bound to a sensor chip was incubated with lG2
then effect on Mab binding compared ~o binding to EPOR
not preincubated with lG2 was de~rmln~ Antibodies
whose binding was completely blocked (80-100~) are A.
Antibodies whose binding was blocked 50-80% are C.
Antibodles whose blnding was blocked less than 50% are
B.
(4) Values for antibodies that gave cells, a mean
fluorescence greater than the control (12.73) are shown
"-" indicates antibodies with a mean fluorescence less
30 ~ that or equal to control.
(5) Inhibition of 3H uptake by UT7-EPO cells. 30 munits
of EPO and varying amounts of an~ibody were incubated
with cells. After an overnight incubation cells were
pulse labele~d with 3H thymidine and the amount of counts
taken up were determlned. A positive response was
defined as one that had a progressive decrease with
increasing amounts of antibody
21 9586~
W096/03438 ~ ,~'U,4J8
- 30~
~6) Stimulation of 3H uptake by UT7-EPO cells. Varying
amounts of antibody were incubated with cells. After ~n
overnight incubation, cells were pulse labeled with 3H
thymidine and the amount of counts taken up were ~
determined. A positive response was defined as one that
had a progressive increase in incorporation with
increasing amounts of antibody.
(7) Inhibition was at concentrations higher than
required to activate.
8. EDitope C~r,etition Analysis
~ he sensor chip which was immobili~ed with sHuEPOR
could be saturated by an injection of 65 ~1 of hybridoma
supernatant lG2. lG2 is a monoclonal antibody raised to
sHuEPOR using procedures described in3Example 3. Each
analysis cycle included injections of 20 ul of the
hybridoma supernatant with and without one epitope being
saturated by the injection o~ 65 ul of lG2. ~he ratio of
the binding signal in RU of 20 ~1 injection after lG2
saturation versus the binding:signal in RU of 20 ~1
injection alone is defined as ~ blocking by lG2. Those
antibodies with 80-100~ blocking are assigned as group
A, those with less than 50 % blocking as group B, and
those with 50-80~ blocking as group C. The results are
shown in Table 1.
C. Ant~hody Bin~lng to d40EPOR on Transfected CHO Cells
by Fluorescence-activated Cell Sorting (FACS) ~n~ly5i5
Hybrido~a supernatants raised against EPOR were
tested for binding to EPO rec.eptor on the surface of
pDSRaEPORd40 trznsf~ected CHO cells by FACS analysls.
CHO cells transfected with DNA encoding d40 EPO receptor
were constructed as des~rl hr~ n Example 1. CHO/EPOR
cells were scrap-ed from tissue culture dishes and
resuspended as single cells in a solution of PBS/0.5
BSA and were then distributed into a 96 well round-
bottom plate at approximately 3 x 105~well. The plate
~ W096/~3438 . 2 1 q 5 8 6 8 "~,5,~4s8
?
- 31 -
was then placed ln the centrlfuge at 1000 x g for 5 min.
After centrifugatlon, the PBS/BSA supernatant was
removed and each of the pelleted cells were resuspended
ln elther a control media or ln one of~he EPOR
hybridoma supernatants. The cells were incubated at 4~ C
for 1 hour. After the lncubation, cells were washed wlth
PBS/BSA and then resuspended in a solution of
fluoresclne isothiocyanate (FITC) labelled Coat anti
Mouse monoclonal antibody (Southern Biotech, Birmingham
Ala.). The cells were ~ncubated again at 4~ C for 1
hour, washed and analyzed by FAC~. Of the 96
supernatants tested, five had a mean cell fluorescence
greater than control media (see Table 1). Mab 71 gave
the highest level of fluoresence followed by Mabs 74,
58, 73 and 87. No other supernatants tested exhibited
fluorescence above control values.
EXAMPLE 5
~ Purification of anti-EPOR antibodies
and Fab fragments
A. ~cites Producti~n
Balb/c mice (Charles Rivers Laboratories,
Wilmington, MA), greater that 5 weeks of age were primed
with 2,4,10,14-tetramethyl-pentadecane (Pristane; Sigma,
St. Louis, MO) 7 to IO days prior to in~ection of cell
lines. Each mouse received a single intraperitoneal
in~ection of 0.5 ml; 10 to 20 animals were in~ected for
each cell line for which ascites fluid was to be
prepared.
Hybridoma lines grown in complete medium until
confluency was attained, were washed once with D-PBS
then counted using a Neubauer ~emacytometer. Each mouse
was then lntraperltoneally in~ected wlth 107 cells, and
maintalned on Rodent ~ab Chow and water ad libitum
W096/03438 2 1 ~ 58 68 ~ 4J~ -
- 32 - ~
until ascites fluid developed. Mice were monitored for
maximum ascites formation, sacrificed under CO2, and
tapped for fluid collection using an 18G needle inserted
into the fluid-filled cavity. The fluid was clarified
by centrifugation at 225 x g for 15 min or for 3 minutes
in a microcentrifuge ~Eppendorf~. Four ml aliquots were
then stored at -20~C until purified by Protein-A column
chromatography.
B. Protein-A nlrification of Monoclonal ~ntibo~;es:
Immunoglobulin from 4 ml of asci~es fluid or 10 ml
of hybridoma conditioned medium was purified by Protein-
A column chromatography. The Bi~-~ M~n~clonal
Antibody Purification System II (MAPS II; Bio-Rad
Labor~t~r;oq; Richmond, CA~ was used~ Briefly, 5 ml of
Affi-gel Protein-A suspension was settled into a 1 x 10
cm disposable glass column. The Protein-A gel was
washed with approximately 30 ml of D-PBS then prepared
by running 20 ml of Binding Buffer SMAPS II Binding
Buffer; Bio-Rad~ through the column. Ascites fluid or
conditioned medium diluted l:l:with binding buffer was
then added to the top of the column and allowed to=flow
through. After binding of immunoglobulin to Protein-A,
the unbound fraction was discarded. ~he column was next
rinsed~of unbound protein with 30 ml of binding buffer
to yield an absorbance at 280 nm of less than 0.01. ~he
immunoglobulin-containing fraction was then eluted with
Bio-Rad Plution buffer, approximately 30 ml This
fraction was buffer-exchanged overnight at 4~C by
dialysis against 4 liters D-PBS. The resulting PBS-
equilibrated immunoglobulin was concentrate~ by
centrifugation at 1700 x g in Centricon Concentrator
units (Amicon Inc., Beverly, M~).
~ W096l03438 2 1 ~ 5 8 6 8
C. Fraction~tl~n of the ~nt;~ody-bin~n~ Do-~n
Proteln-A purified immunoglobulin was further
fractionated into its 2 component Farts, the
crystallizable fraction (Fc) and the antibody-binding
fraction (Fab), using a Pierce ImmunoPure Fab
Preparation kit (Pierce Chemical Company, Rockford, I~).
The proteln-A purified immunoglobulin was dialyzed into
20 mM phosphate/10 mM EDTA buffer at p~ 7.0, then
concentrated to approximately 20 mg7mI Ten~mg of
immunoglobulin was fractionated. Immobilized papain gel
was rinsed twice with digestion buffer containing 42 mg
cystelne in 12 ml phosphate buffer as supplied. The
immunoglobulin sample was then added to the gel and
incubated at 37~C, on a rotating shaker, overnlght. The
solublized Fabo was separated from the Fc and undigested
lmmunoglobulin by protein-A purificatlon; unbound
fraction was collectea here as the Fab sample. This
unbound portion was dialyzed overnight against 4 liters
D-PBS at 4~C, and concentrated as before.
EXAMPLE ~
Mapping of Mab 71 epitope on EPOR
Overlapping synthetic peptides 17 to 30 amino acids
in length were made that spanned residues 1 to 224 of
the human EPO receptor, where resldue 1 ls prollne and
residue 22~ is aspartlc acld. The ten different
peptides~overlapped by six amlno acids at both ends.
The sequences of the peptides and their iocation within
the human EPO-R amlno acid sequence are as follows:
SE-l PPPNLPDPKFESKAALLAARGPEELCFTE
(residuses 1-30)
SE-2A LLCFTERLEDLVCFWEEA
(residues 25-42)
W096l03438 2 1 9 ~868 ~ 5 j:~ ~
SE-2B CFWEEAASAGVGPGNYSF
(residues 37-54)
SE-3 PGNYSFSYQLEDEPW~LCRLHQAPTARGAV
(residues 49-78)
SE-4 TARGAV~FWCSLP~ADTSSFVPLELRVTAA
(residues 73-102) : :
SE-5 LRVTAASGAPRY~vL~LN~:vVLLDAPVGL
(residues 97-126
SE-6 DAPVGLVARLADESGH W LRVLPPPETPMT
(residues 121-150)
SE-7 PETPMTSHIRYEVDVSAGNGAGSVQRVEIL
(residues 145-174) ~ =
SE-8 QRVEILEGRTECVLSNLRGRTRYTFAVRAR
(residues 169-198)
SE-9 FAVR~P~MEAPSFGGFWSAWSEPVSLLTPSDLD
(residues 193-224) .~
Polystyrene wells (Costar, Cambridge, M~) were
coated with the above EPO-R peptides at concentrations
of 100~g/ml, 20 ~g/ml and 0.8 ~g/ml respectively in
carbonoate-biocarbonate buffer (0.015M Na2C03, 0.035M _
NaHCO3, pH 9.2~. The plate was incubated at room
temperature ~RT) for~2 hours then Qvernight at_4~C.
Soluble HuEPOR was coated at concentrations of 10~g/ml,
2~g/ml, 0.4~g/ml and 0.08ug/ml as positive controls
under the same conditlons. After blocking with 5% BSA
in PBS at RT for 30 minutes, the plate was incubated
with Mab 71 purified as described in Example 5~at a
concentration of 51Lg/ml in 1% BSA at RT for 2 hours.
After washing with washing buffer (Kirkegard and Perry
Labs, Inc.) the plate was incubated with 5:1000 dilution
of Goat anti-mouse IgG con~ugnted with horse Radish
pero~idase (Boehringer Mannheim~ for one hour zt RT.
The plate was washed and developed with ABTS (Kirkegard
and Perry Labs, Inc.) substrate solution. Colorimetry
was conducted at 405 nm. The results of Mab binding to
~ W096l03438 2 T 9 5 8 ~ ~ r~l,u~ ~ t58
- - 35 -
the synthetlc peptides are shown in Figure 1 and
indicate that Mab 71 binds slgnlficant amounts of
peptlde SE-3 (amino acld resldues 49 to 78 inclusive of
human EPO-R) compared to the other peptides tested.
This indicates that Mab 71 binds to a region of the
human EPO-R containing or overlapping residues 49 to 78.
EXAMPLE 7
Activity of anti-EPOR antibodies
in cell proliferation assays
Antibodies in condltioned medium prepared as
described above were assayed for their ability to
stimulate uptake of 3H-thymidine by UT7-EPO cells
(~omatsu et al., ~ ca) UT7-EPQ cells are responsive to
EPO and expres human EPO receptors on their cell
surface. ~T7-EPO cells were grown in Growth medium(lX
Iscove's Modified Dulbecco's Medium with L-glutamine, 25
mM HEPES buffer, and 3024 mg/1 sodium bicarbonate, but
without either alpha-thioglycerol or beta-
mercaptoethanol (GIBCO)/ 10% v~v Fetal Bovine Serum/ 1%
v/v L-glutamine-Penicillin-Streptomycin solution (Irvine
Scientific)/ 1 Unit/ml rHuEPO ) to approximately 3x105
cells/ml. Cells were collected by centrifugation
(approx. 5~0xG] washed twice wlth phosphate buffered
saline and resuspended at 5x104 cells/ml in Assay medium
(lx RPMI Medium 1640 without L-glutamine (Gibco)/1% L-
glutamine/4% fetal bovine serum). Test samples or EPO
standard (rHuEPO),100 ~L diluted in assay medium at
~ least 5-fold, were added to wells in a 96 well
microtiter plate. 50~L cells were then added (5000
cells/well) and plates were incubated in:a humidified
incubator at 37~C and 5% CO2. After 72 hours, 50~L
methyl-3H-Thymidine (1 mCi/ml; 20 Ci/mMole) diluted
1:100 in assay medium was added. Cells were incubated
21 95~6~d
W096/03438 ~ J~58
for an addltional 4 hours at 37~C and 5% CO2. Labeled
cells were harvested onto glass fiber filtermats using
a PHD cell harvester(Cambridge Technology Inc.) and
deionized water as a washing solution. Eilters were
rinsed a final time with 2-propanol then dried and
counted in a Beckman Model LS6~00IC scintillation
counter.
Conditioned medium from tissue culture plates
containing antiEPOR Mabs were tested for their ability
to stimulate proliferatlon as descrlbed above. Samples
at several dilutions were tested. Positive responses
were defined as those that stimulated ,thymidine uptake
at least 2-fold~over backgrou~d levels and also resulted
in decreasing stimulation as the samples were diluted.
As shown in Table l, two samples out of 24 tested gave a
positive response (Mabs 71 and 73). Four samples may
have a weak stimulatory activity (? in Table 1). The
remaining samples did not give a significant i~crease
over background. A polyclonal serum from the mouse used
to generate monoclonals also st~mulated~thymidine
uptake. This suggests that the polyclonal antibody in
this serum was also capable of stimulating prol; f~r=t ~ nn
of UT7-EPO cells'. ~' : ~ -
The supernatants were also tested for their abil'ity
to inhibit EPO-induced stimulation of thymidine uptake
by UT7-EPO cells. Cells were,~incubated wit,h 25
munits/ml r~uEPO and varying amounts of antibody
containing conditioned medium. Thymidi,ne uptake was _
measured as described above~ The results are sh~own in
Table l Most antibodies~did,not signlficantly differ
from control medium. Of the antibo,dies~ showing
inhihition of thymidine uptake, two samples ~Mabs 58rand
73) showed definite inhibition while three samples (Mabs
65, 88 and 89) showed possible inhibition. Mab 73
inhibited at the highest doses but~at lower doses it
stimulated thymidine uptake over control values.
~ W096l03438 - P~ ~ S~ ~
21 9~6~
- 37 -
EXAMPLE 8
Actlvation of EPOR by
5anti-EPOR antibodies and fragments
A. UT7-EPO Prol;feratlon ~qsay
Mabs 71 and 73 were purifled as descrlbed in
Example 5. Proliferative activity was determined wlth
UT7-EPO thymidlne uptake assays descrlbed in Example 7.
Both Mabs 71 and 73 stimulated uptake by UT~-EPO cells
in a dose dependent manner as did rHuEPO Isee Figure 2).
Activity was reduced at high doses-of Mab 71. Peaks in
stimulatory activity were observed at doses of 1-2 ~g/ml
15 for Mab 71 and >100~g/ml for Mab ~3. A nonneutralizing
control antibody (AntiEPO Mab F12) did not stimulate
which suggests that the stlmulation is specific for EPO
receptor antibodies.
B. EPO cold d~qplac~m~nt assays.
Antibodies to the EPO receptor may blnd to the same
region as EPO binds. To test this posslbility, cold
displacement assays were performed using OCIMl cells.
OCIMl cells are from human orlgln and known to contain
EPO ~receptors~bn thelr cell surface (Broudy et al. Proc.
Nat. Acad. Sci. USA 85, 6517 (1988)). Cells were grown
in OCIMl growth medium (Iscove~s modlfled Dulbecco
medlum(IMDM)/10% fetal bovine serum/1% pen-strep-
funglsone) to approximately 2-5x~05 cells/ml. Cells
were collected~by centrifugation, washed two times ln
blndlng buffer (RPMI 1640/ 1%BSA/ 25mM HEPES pH 7.3)
then resuspended ln binding buffer containing 0.1% azide
and 10 ~g/ml cytochalisin B at 1-2x107 cells/ml. Cells
(100~L) in 96 well tissue culture plates were then
35 incubated with 10~L sample and 10~L l25I-EPO (Amersham
high specific actlvity; 3000Ci~mMole, 2 ~Ci/ml) in a 37~
2~ q5868
W096/03438 P~ 5
- 38 -
hllm;~f;~ tissue culture incubator. After 3 hours cells
were centrifuged through phthalate oil (60:40 (v/v)
dibutyl/dinonyl phthalate) in titer tubes. The tubes
containing cells were quick frozen in a dry ice-ethanol
bath and the cell pellet was clipped and then counted in
a LKB 1277 gammamaster automatic gamma counter.
Figure 3 shows the results oi the cold displacement
experiment. Increasing amounts of 125I-EPO were
displaced from EPO receptors on cells as the amount of
added unlabeled rHuEPO was increased. In a similar
manner, Mab 71 purified as described in Example 5 also
displaced increasing amounts Of 125~-E~o with increasing
amounts of antibody. In this case, approximately 4,000
fold more Mab 71 was needed than rHuEPO-to displace
equivalent amounts of 125I-EPQ. In contrast Mab 73
showed indications of displacement st the highest doses
but a nonneutralizing anti rHuEPO Mab ~F12) did not
significantly displace. ~hese results indicate that Mab
F12 did not interfere with binding of EPO to its
receptor but Mab 71 and 73 do. This result also
indicates that Mab 71 binds to the EPO receptor and
activates it by binding at or close ~o the EPD binding
site.
C. Co~rarison o~ activities of M~h 71 and Fab 71
EPO receptor fragments of Mab ~71 were prepared as
described in Example 5. ~he preparations were
characterized by SDS gel electrophoresis (~aemmli et al.
Nature 227, 680 (1970~ a-s shown in ~iqu:re 4. Samples
were boiled in 2% SDS containing sample bu~ffer~-with or
without 0.7M 2-mercaptoethanol, to distinguish reduced
(2-mercaptoethanol) from nonreduced (no
2-mercaptoethanol) proteins, then run on 12.5%~ K
acrylamide SDS gels. ~he gels were stained with
coomassie hlue to visualize the proteins. ~he sizes of
the proteins were estimated by comparing their
~ W096l03438 2 1 9 5 ~ 68 P~ 8
- 39 -
mobllities to the mobilities of proteln standards. Mabs
- 71 and 73 separated into light and heavy chains when run
under reduclng conditions. The heavy chains were
approxlmately 52 RDa. The light chain for 73 was
slightly smaller (28 KDa) than for Mab 71 (28.5 KDa).
The Fab fragments also had two chains: 28.3 and 27.3 KDa
for Fab 71 and 27.5 and 26.5 KDa for Fab 73. When these
Fab fragments were run under non reducing condltions,
the sizes of Fabs 71 and 73 were approximately 48 and 47
KDa respectively. This indicates that the Fab fragments
are monovalent, the complex has one each of the light
and heavy chains. In contrast the mobilities on
nonreducing SDS gels for Mabs 71 and 73 indicated that
their sizes were approximately 200 KDa. This indicates
that these Mabs are bivalent, there are two each of the
heavy and light chains.
To see if monovalent Fab 71 fragments would
activate the EPO receptor, Mab 71 and the Fab 71
fragment were Lncubated with UT7-EPO cells and thymidine
uptake was measured as described in Example 7. As shown
in figure 5, both rHuEPO and Mab 71 stimulated thymidine
uptake. However the monavalent Fab 71 fragment did not.
A control monoclonal antibody raised against an
unrelated receptor (Her2/neu) also did not stimulate
thymidine uptake. This indicates that the antibodies
must be bivalent in order to activate the receptor.
. StimnlAtion of thy~;~1ne upt~ke by M~ 71 ~nd F~ 71
in the ~res~nce of r~E~O.
The iact that Mab 71 inhibits binding of EPO to EPO
receptors suggested that the antibody may not activate
the EPO receptor in the presence of EPO. To test this
possibility UT7-EPO cells were:incu~ated with 30
munits/ml rHuEPO and varying amounts of purified Mab 71,
Fab 71 or Mab control (raised against Her2/neu).
Thymidine uptake was measured as described above. As
WO96/03438 2~ 95868 1~11U~ IS
- 40 -
shown in figure 6 Both Mab 71 and Fab 71 inhibited
thymidine uptake at high dDses. However at doses
between approximately 30 and 3000 ~g/ml, Mab 71
stimulated thymidine uptake above levels stimulated by
rHuEPO alone. Fab 71 and control antibodies did not
have this effect. This indicates that Mab 71 and rHuEPO
can have an additive effect in EPO receptor activation.
EXAMPLE 9
Stimulation of erythroid cQlony formation
by anti-EPOR antibodies
To see if purified Mab 71 would stimulate fr~rr~tirsn
of erythroid cells frDm precursors in peripheral blood a
BFUe assay was done. To purify erythroid cell ~
precursors, normal human donors were lymphopheresed
according to standard protocol. The lymphopheresed cells
~250 ml) were washed with 25D ml HanX's RA 1 Anrr~rl Salt
Solution ~HBSS~. The cells were resuspended in HBSS and
separated by density centrifugation over a
gradient(Ficoll-paque) for 30 min at 500xg. The low
density cells~LD) were cr~lle~t~ from the gradient and
washed with 500ml HBSS and resuspended in PBS
supplemented with 0.5% bovine,serum albumin and 5mM EDTA
at a concentration of 5x103 cells/ml. The LD cells were
then further purifi~d using a CD34 progenitor Cell
Isolation Kit ~QBend/10) made=by Miltenyi Biotech GmbH.
In brief cells were tagged with an anti CD34 mQnoclonal
antibody they were then bound to magnetic~microspheres
according to protocol. The tagged celLs were ne~t passed
through pre-filled M;n~MArc separation columns, the
columns were washed and the CD34+ cells,were then eluted
from the coIumn. This process was repeated once moregto
achieve a higher purity of CD34+ cells.,The in ~YitrO ~
assay was done on the purified CD34+ cells as described
~ w096l03438 2 1 9 5 8 6 8 ~ h ~
by Iscove et. al.(J. Cell. Physiol 83, 309 ~1974)) with
the following modifications. The clllture medium was
obtained from Gibco ERL (Human bone marrow stem cell
proliferation kit; Grand Island, NY). ~o plate out
duplicate lml:samples on 35xlOOmm tissue culture
plates, an excess of 3 ml was prepared in 17xlOO sterile
polystyrene tubes. Each tube received 2.5 ml Stem Cell
Growth medium, 0.1 ml CD34+ cells (resuspended at 90,000
cells/ml) 0.015 ml Stem Cell Factor (20 ~g/ml), and a
combination o~ sample and Stem Cell Dilution medium
equaling 0.385 ml. The tubes were vortexed and allowed
to settle to allow bubbles to rise.: The contents were
then aliquoted uslng a 3ml syringe with a 17xl-1/2
needle. The plates were incubated at 37~C and 10% C02
in a humidified tissue culture incubator. Erythroid
colonies (orange to red in color) were scored after 21
days. No erythroid colonies were seen in plates lacking
EPO or Mab 71. rHuEPO (30mUnits~plate) gave an excess
of 400 colonies per plate. Mab 71 also produced
erythroid colonies. Peak activity was seen at 2-~ ~g/ml.
This result indicates that Mab 71 stimulates formation
of erythroid colonies.
The activity of purified Mab 71 was also tested for
the ability to form erythroid colonies using serum free
growth conditlons in methylcellulose. CD34+ cells were
isolated as described above and incubated using the
serum free growth medium described in co-pending and co-
owned U.5. Serial No. 08/079,719, ~éreby incorporated by
reference, with the folIowing modifications. The assay
tubes were set up without using extracellular matrix
molecules, hydrocortisone, and the -growth factors EGF,
FGF, and PDGF. As described above:3 mL of sample was
prepared to plate out duplicate l mL samples on plates.
Each tube receLved .030ml each of lOOx Stock Solutions
(2-Mercaptoet~anol, nucleosides, cholesterol, Sodium-
Pyruvate, Hu-Transferrin, lipids, Hu-Insulin), 0.4ml
W096/03438 2 ~ 9 5 8 ~ 8 . ~ . o~ - ~
- 42 -
deioni~ed BSA (15%), 0.015ml SCF (20 ug/ml), 0.1 ml
CD34+ cells (resuspended at 30D,000 cellslml), 1.080ml
methylcellulose (2.3~), and a combination of sample and
IMDM e~ualing 1.195ml where the sample did not exceed .
150 ~1. The plates were~then incubated as described ~
above and colonies were scor~d a~ter 21 days. Erythroid
colonies were observed when grown in the presence o~ EPO
or Mab 71 but not under conditions lacking these two ~
factors. An example of the erythroid colony types seen
is shown in figure 7. Colonies incubated with 25 munits
of rPuEPO looked similar to those grown wlth 2.1 ~g/ ml
of purified Mab 71. Higher doses of r~uEPO gave larger
colonies. A dose response curve is shown ln Figure 3.
Mab 71 had a peak in activity at doses=between 1 and 5
~g/ml. Lower and higher doses resulted in fewer
erythroid colonies. A control monoclonal antibody raised
to Her2/~eu did not produce any colonies over this dose
range. This result indicates that the Mab 71 will
stimulate the formation of erythroid ~olonies from
erythroid precursors and that there is not an additional
re~uirement for serum. Thus Mab 71 can stimulate
differentiation of erythroid precursors into erythroid
cells.
* ~ ~
While the present invention has been described in
terms of the pre~ferred embodiments, it is understood
that variations and modifIca~ions will occur to those
skilled in the art. ~herefore, it is intended that the
appended claims cover all such e~uivalent~variations ~
which come within the scope of the invention as claimed.
~ W 096l03438 2 1 9 ~ 8 6 8 , ~ 5~
SEQUENCE LISTING
~1) GENERAB INFORMATION:
(i~ APPLICANT Amgen Inc.
(ii) TITLE OF INVENTION: ANTIBODIES nHIcH ACTIVATE AN
ERYTHROPOIETIN RECEPTOR
(iii) NUMBER OF SEQUENCES: 3
(iv) CORRESPONDENCE ADDRESS:
(A) ADDRESSEE: Amgen Inc.
(B) STREET: 1840 Dehavilland Drive
(C) CITY: Thousand Oak~
tD) STATE: r~l; f~rn;
(E) COUNTRY: USA
(F) ZIP: 91320-1759
(v) COMPUTER READAB~E FORM:
IA) MEDIUM TYPE: Floppy dlsk
(B) COMPUTER: IPM PC - yt;hle
(C) OPERATING SYSTEM: PC-DOS/MS-DOS
(D) SOFTWARE: PatentIn Release #l.t~, Version #1.25
(vi) CURRENT APPLICATION DATA:
(A) APPLICATION NUMBER:
(B) FILING DATE:
(C) CLASSIFICATION:
(viii) ATTORNEY/AGENT INFORMATION:
(A) NAME: Winter, Robert B.
(C) REFERENCE/DOCXET NUMBER: A-307
(2) INFORMATION FOR SEQ ID NO:l:
(i) SEQUENCE ~R~FRTcTIcs:
(A) LENGTH: 42 base pairs
(B) TYPE: nucleic acid
(C) s~R~r F.nNFCiS single
(D) TOPOLOGY: linear
tii) ~OLECULE TYPE: cDNA
W 096103438 1~1/U~. _.'09 ~r ~
21 9586~
- 44 -
~xi) SEQUENCE DESCRIPTION: SEQ ID NO:l:
CTCCAAGCTT GCCGTCACCA TGGACCACCT ~l~.CT _ _ . , 42
(2) INFORMATION FOR SEQ ID NO:2:
(i) SEQUENCE CHARACTERISTICS~
(A) LENGT~: 35 base pairs
~B) TYPE: nucleic acid
(C) sTR~Nn~nNEcs: single
(D) TOPOLOGY: linear
~ii) MOLECULE TYPE: cDNA
Ixi) SEQUENCE DESCRIPTION: SEQ ID NO:2:
CAGGTCTAGA TTACTAGGGA TCCAGGTCGC TAGGC ~ ~ 35
(2) INFORMATION FOR SEQ ID No:3:
(1) SEQUENCE ~R~T~R~STICS:
(A) LENGT~: 27 base pairs
~B~ TYPE: nucleic ~cid
(C~ S~P~ Rl-NRSC: single
(D~ TOPOLOGY: linear
NOLECULE TYPE: CDNA
(xi~ SEQUENCE DESCRIPTION: SEQ ID NO:3:
AGGTCGACTA CTAGTAGTCA GTTGAGA 27
