Note: Descriptions are shown in the official language in which they were submitted.
CA 02230823 1998-03-20
W O9711~185 ~CTAJS95/15864
DszD UTILIZATION IN DES ~ FURIZATION OF
DBT BY Rhodococcus sp. IGTS8
BACKGROUND OF THE INVENTION
The microbial desulfurization of fossil fuels has been
an area o~ active investigation ~or over ~ifty years. The
object o~ these investigations has been to develop
biotechnology based methods for the pre-combustion removal
of sulfur from fossil fuels, such as coal, crude oil and
petroleum distillates. The driving -Eorces ~or the devel-
opment of desulfurization methods are the increasing levelsof sulfur in fossil fuel and the increasingly stringent
regulation o~ sul~ur emissions. Monticello et al.,
"Practical Considerations in Biodesulfurization o~
Petroleum," IGT's 3d Intl. Symp. on ~as, Oil, Coal and Env.
Biotech., (Dec. 3-5, 1990) New Orleans, LA.
Many biocatalysts and processes have been developed to
desulfurize ~ossil ~uels, including those described in U.S.
Patent Nos. 5,356,801, 5,358,870, 5,358,813, 5,198,341,
5,132,219, 5,344,778, 5,104,801 and 5,002,888, incorporated
herein by re~erence. Economic analyses indicate that one
limitation in the commercialization o~ the technology is
improving the reaction rates and specific activities o~ the
biocatalysts, such as the bacteria and enzymes that are
involved in the desul~urization reactions. The reaction
rates and speci~ic activities (sul~ur removed/hour/gram o~
biocatalyst) that have been reported in the literature are
much lower than those necessary ~or optimal commercial
technology. There~ore, improvements in the longevity and
speci~ic activity o~ the biocatalyst are desirable.
.
CA 02230823 1998-03-20
- W O 97/11185 PCT~US9~/15864
SUMMARY OF THE INVENTION
The invention relates to the discovery that a class of
proteins, one of which was recently puri~ied from
Rhodococcus sp. IGTS8, activates two monooxygenases (DszC
and DszA) involved in the desulfurization of fossil fuels.
Neither DszC nor A are enzymatically active when purified
to homogeneity; however, upon the addition of this
additional protein (designated DszD herein), enzymatic
activity is restored. The function of this protein is
believed to couple the oxidation of NADH with the
oxygenation of the substrate molecule. A search of the
sequence databases revealed that DszD is equivalent to
another recently identified Rhodococcus protein, ThcE,
which is induced by growth in the presence of atrazine,
thiocarbamate herbicides and primary alcohols. Based upon
sequence similarity, ThcE appears to be a member of the
group III alcohol dehydrogenases, or oxidoreductases,
designated alcohol: N,N'-dimethyl-3-nitrosoaniline
oxidoreductases. DszD has a monomer molecular weight of
approximately 50,000 (by SDS-PAGE) but behaves as a
multimeric protein (decamer) on HPLC size exclusion
chromatography. The activation of DszC and A by DszD
follows saturation kinetics.
Thus, the invention relates to the discovery that the
rate of microbial desul~urization o~ fossil ~uels is
enhanced or activated by or dependent upon the addition of
an oxidoreductase to the biocatalyst or reaction medium.
The invention is drawn to a method for enhancing the rate
of desulfurizing a fossil fuel containing organic sulfur
compounds, comprising the steps o~:
a) contacting the fossil fuel with an aqueous phase
containing a biocatalyst or biocatalysts capable of
cleaving carbon-sul~ur bonds (such as Dsz A, Dsz B and/or
Dsz C) and a rate-enhancing amount of an oxidoreductase,
thereby forming a fossil fuel and aqueous phase mixture;
-
CA 02230823 1998-03-20
- W O97111185 ~CT~US95/15864
b) maintaining the mixture o~ step (a) under condi-
tions su~ficient ~or cleavage of the carbon-sulfur bonds of
the organic sulfur molecules by the biocatalyst, thereby
resulting in a fossil fuel having a reduced organic sulfur
content; and
c) separating the fossil fuel having a reduced
organic sulfur content from the resulting aqueous phase.
The invention also relates to enhancing the rate of the
reaction catalyzed by DszA and/or DszC with a rate
enhancing amount o~ oxidoreductase. This can be
accomplished, for example, by adding lhe oxidoreductase to
a biocatalyst or by causing expression or overexpression of
the oxidoreductase in a biocatalyst.
In yet another embodiment, the invention relates to a
recombinant microorganism containing one or more
recombinant DNA molecules which encode a biocatalyst
capable of catalyzing one or more steps in a process for
desulfurizing a fossil fuel containiny organic sulfur
molecules and which encode an oxidoreductase.
The invention includes a composition comprising (a) a
biocatalyst capable of catalyzing one or more steps in a
process for desulfurizing a fossil fuel containing organic
sul~ur molecules and (b) an oxidoreductase.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 is a graphic illustration of DszC and A
activity after ion exchange chromatography. DszC (15 ~g)
was added to each ~raction and tested ~or conversion ~rom
DBT to DBTO and DBTO2. DszA (5 ~g) was added to each
~raction and tested ~or DBT sultone to BHBP conversion,
Endogenous DszC activity was also test,ed.
Figure 2 is a graphic illustration o~ DszC activity
a~ter Superdex 75 size exclusion chromatography. DszC (15
~g) was added to each ~raction and tested for conversion
CA 02230823 1998-03-20
W O 97/11185 PCT~US95/15864
from DBT to DBTO2. DszA activity after Superdex 75 size
exclusion chromatography. DszA (5 ~g) was added to each
fraction and tested for DBTsultone to BHBP conversion.
Figure 3 is an electrophoretic gel illustrating SDS-
PAGE (14~ acrylamide) of the purification of DszD. ~ane 1presents the molecular weight standards (Biorad, 200, 116,
97.4, 66, 45, 31, 21.5 and 14.5 kDa); lane 2, crude cell
lysate; lane 3, after Q-sepharose; lane 4, after Toyopearl-
DEAE; lane 5, after MonoQ, and; lane 6, after Superdex 75.
Figure 4 illustrates the activation of DszC by the
addition of increasing amounts of DszD. A fixed amount of
DszC (0.33 nmol)) was titrated with increasing amounts of
DszD.
Figure 5 illustrates activation of DszA by increasing
amounts of DszD. A fixed amount of DszA (0.16 nmol) was
titrated with increasing amounts of DszD.
Figure 6 sets forth the DNA sequence and putative amino
acid sequence of the ThcE (DszD) gene.
DETAILED DESCRIPTION OF THE INVENTION
In the petroleum extraction and refining arts, the term
"organic sulfur" i6 generally understood as referring to
organic molecules having a hydrocarbon ~ramework to which
one or more sulfur atoms (called heteroatoms) are covalently
joined. These sulfur atoms can be joined directly to the
hydrocarbon framework, e.g., by one or more carbon-sul~ur
bonds, or can be present in a substituent joined to the
hydrocarbon framework of the molecule, e.g., a sulfate
group. The general class of organic molecules having one or
more sulfur heteroatoms are referred to as "organosulfur
compounds". The hydrocarbon portion of these compounds can
be aliphatic, aromatic, or partially aliphatic and partially
aromatic.
Cyclic or condensed multicyclic organosulfur compounds
in which one or more sulfur heteroatoms are linked directly
CA 02230823 l998-03-20
- W 097J11185 PCTnJS95115864
or indirectly to adjacent carbon atorns in the hydrocarbon
framework by aromatic carbon-sulfur bonds are referred to as
~ "sulfur-bearing heterocycles". The sulfur that is present
in many types of sulfur-bearing heterocycles is referred to
as "thiophenic sulfur" in view of the five-membered aromatic
ring in which the sulfur heteroatom :is present. The
simplest such sulfur-bearing heterocycle is thiophene, which
has the composition C4H4S.
Sulfur-bearing heterocycles are ]~nown to be stable to
conventional desulfurization treatments, such as
hydrodesulfurization (HDS). Sulfur-bearing heterocycles can
have relatively simple or relatively complex chemical
structures. In complex heterocycles, multiple condensed
aromatic rings, one or more of which can be heterocyclic,
are present. The di~iculty of desulfurization increases
with the structural complexity of the molecule. That is,
refractory behavior is most accentuated in complex sulfur-
bearing heterocycles, such as dibenzothiophene (DBT,
C12H8S).
DBT is a sulfur-bearing heterocycle that has a
condensed, multiple aromatic ring structure in which a five-
membered thiophenic ring is flanked by two six-membered
benzylic rings. Much of the residual post-HDS organic
sulfur in fossil fuel refining intermediates and combustible
products is thiophenic sulfur. The majority of this
residual thiophenic sulfur is present as DBT and derivatives
thereof having one or more alkyl or aryl groups attached to
one or more carbon atoms present in one or both flanking
benzylic rings. DBT itself is accepted in the relevant arts
as a model compound illustrative of the behavior of the
class of compounds encompassing DBT and derivatives thereo:E
in reactions involving thiophenic sulfur. Monticello and
Finnerty, Annual Reviews in Microblology 39:371-389 (1985)
at 372-373. DBT and derivatives thereof can account for a
significant percentage of the total sulfur content of
CA 02230823 1998-03-20
- W O97/11185 PCTAUS95/15864
particular crude oils, coals and bitumen. For example,
these sulfur-bearing heterocycles have been reported to
account for as much as 70 wt~ of the total sulfur content of
West Texas crude oil, and up to 40 wt~ of the total sulfur
content of some Middle East crude oils. Thus, DBT is
considered to be particularly relevant as a model compound
for the forms of thiophenic sulfur found in fossil fuels,
such as crude oils, coals or bitumen of particular
geographic origin, and various refining intermediates and
fuel products manufactured therefrom. Id. Another
characteristic of DBT and derivatives thereof is that,
following a release of fossil fuel into the environment,
these sulfur-bearing heterocycles persist for long periods
of time without significant biodegradation. Gundlach et al.
Science 221:122-129 (1983). It is, therefore, desirable to
remove these organosulfur compounds from fossil fuels or
other carbonaceous materials which contain them.
A fossil fuel or carbonaceous material that is suitable
for desulfurization treatment according to the present
invention is one that contains organic sulfur. Such a
fossil fuel is referred to as a "substrate fossil fuel".
Substrate fossil fuels that are rich in thiophenic sulfur
are particularly suitable for desulfurization according to
the method described herein. Examples of such substrate
fossil fuels include Cerro Negro or Orinoco heavy crude
oils; Athabascan tar and other types of bitumen; petroleum
refining fractions such as light cycle oil, heavy
atmospheric gas oil, and No. 1 diesel oil; and coal-derived
liquids manufactured from sources such as Pocahontas #3,
Lewis-Stock, Australian Glencoe or Wyodak coal.
Biocatalytic desulfurization, or BDS, is the excision,
liberation or removal of sulfur from organosulfur compounds,
including refractory organosulfur compounds such as sulfur-
bearing heterocycles, as a result of the oxidative cleavage
(preferably selectively) of carbon-sulfur bonds in said
CA 02230823 1998-03-20
-W O97111185 PCT~US95/15864
compounds by a biocatalyst BDS treatment yields the
desulfurized hydrocarbon framework of the former refractory
~ organosulfur compound, along with inorganic sulfur
substances which can be readily separated from each other by
known techniques such as fractional d:istillation or water
extraction. For example, DBT is "converted" into
hydroxybiphenyl when subjected to BDS treatment.
BDS is carried out by biocatalyst(s). Biocatalysts
include one or more non-human organisms (e.g., recombinant
and non-recombinant, viable and non-viable microorganisms)
that functionally express one or more enzymes that direct,
singly or in concert with each other, the removal of sulfur
from organosulfur compounds, including sulfur-bearing
heterocycles, by the oxidation of sulfur and/or the cleavage
of carbon-sulfur bonds in said compounds; one or more
enzymes obtained from such organisms; or a mixture of such
organisms and enzymes. Organisms that exhibit one or more
biocatalytic activities required for the desulfurization of
a fossil fuel or other carbonaceous material are referred to
herein as being Dsz+. Organisms that lack such a
biocatalytic activity are referred to herein as being Dsz-.
A "biocatalyst" is defined herein as a biological material,
or a material of biological origin, which possesses the
ability to catalyze one or more reactions, in the presence
of appropriate co-factors and/or co-enzymes, for example.
The invention relates to the improved removal of sulfur
from carbonaceous materials, such as fossil fuels,
containing organic sulfur molecules comprising adding a
rate-enhancing amount of an oxidoreductase to the
biocatalyst capable of desulfurizing the carbonaceous
material.
The biocatalysts employed herein are, generally, known
in the art. Several investigators have reported the genetic
modification of naturally-occurring bacteria into mutant
strains capable of catabolizing DBT. Kilbane, J.J., Resour.
CA 02230823 1998-03-20
- W O 97/11185 PCT~US95/15864
Cons. Recycl. 3:69-79 (1990), Isbister, J.D., and R.C.
Doyle, U.S. Patent No. 4,562,156 (1985), and Hartdegan, F.J.
et al., Chem. Enq. Proqress 63-67 (1984). Many of these
mutants desulfurize DBT nonspecifically. Thus, a portion of
the fuel value is lost through this microbial action.
Isbister and Doyle reported the derivation of a mutant
strain of Pseudomo~as which appeared to be capable of
selectively liberating sulfur from DBT.
Kilbane has reported the mutagenesis of a mixed
bacterial culture, thereby producing a bacterium which is
capable of selectively liberating sulfur from DBT by an
oxidative pathway. This culture was composed of bacteria
which can be obtained from natural sources, such as sewage
sludge, petroleum refinery wastewater, garden soil, coal,
tar-contaminated soil, etc., and maintained in culture under
conditions of continuous sulfur deprivation in the presence
of DBT The culture was then exposed to the chemical
mutagen 1-methyl-3-nitro-l-nitrosoguanidine. The major
catabolic product of DBT metabolism by this mutant culture
was hydroxybiphenyl; sulfur was released as inorganic water-
soluble sulfate, and the hydrocarbon portion of the molecule
remained essentially intact as monohydroxybiphenyl.
Kilbane, J.J., Resour. Cons. RecYcl. 3:69-79 (1990), the
teachings of which are incorporated herein by reference.
Kilbane has also isolated a mutant strain of
Rhodococcus from this mixed bacterial culture. This mutant,
IGTS8 or ATCC No. 53968, is a particularly preferred
biocatalyst for use with the instant invention. The
isolation and characteristics of this mutant are described
30 in detail in J.J. Kilbane, U.S. Patent No. 5,104,801, the
teachings of which are incorporated herein by reference.
This microorganism has been deposited at the American Type
Culture Collection (ATCC), 12301 Park Lawn Drive, Rockville,
Maryland, U.S.A. 20852 under the terms of the Budapest
35 Treaty, and has been designated as ATCC Deposit No. 53968.
CA 02230823 1998-03-20
- W O 975~185 PCT~US9511586~
One suitable ATCC No. 53968 biocatalyst preparation is a
culture of the living microorganisms, prepared generally as
described in U.S. Patent No. 5,104,801 and mutants or
derivatives thereof (see, e.g. U.S. Patent. No. 5,358,869).
Cell-free enzyme preparations obtained from ATCC No. 53968
or mutants thereof generally as described in U.S. Patent
Nos. 5,132,219, 5,344,778 and 5,358,870 can also be used.
These enzyme preparations can further be purified and
employed.
Other examples of microorganisms that appear to behave
in the same or similar manner include the microbial
consortium (a mixture of several microorganisms) disclosed
in Kilbane (1990), 3 Resour. Conserv. Recycl. 69-79, the
microorganisms disclosed by Kilbane in U.S. Patent Nos.
5,002,888 (issued Mar. 26, 1991), 5,104,801 (issued Apr. 14,
1992), 5,344,778, 5,132,219, 5,198,341, 5,34g,778,
5,356,813, 5,356,801, 5,358,869, 5,35~,870 [also described
in Kilbane (1990), Biodesulfurization: Future Prospects in
Coal Cleaning, in Proc, 7th Ann. Int'l. Pittsburgh Coal
Conf. 373-382], and 5,198,341 (issued Mar. 30, 1993); and by
Omori et al. (1992), Desulfurization of dibenzothiophene by
Corynebacterium sp. strain SY1, 58 Appl. Env. Microbiol.
(No. 3) 911-915; and Izumi et al., Applied and Environmental
Microbiology 60:223-226 (1994) all incorporated herein by
reference.
Each of the foregoing microorganisms can function as a
biocatalyst in the present invention because each produces
one or more enzymes (protein biocatalysts) that carry out
the specific chemical reaction(s) by which sulfur is excised
from refractory organosulfur compounds. Mutational or
genetically engineered derivatives of any of the foregoing
microorganisms, as exemplified by the U.S. patents listed
above, can also be used as the biocatalyst herein, provided
that appropriate biocatalytic function is retained.
CA 02230823 1998-03-20
- WO97/11185 PCTrUS95/15864
--10 -
Additional microorganisms suitable for use as the
biocatalyst or biocatalyst source in the desulfurization
process now described can be derived from naturally
occurring microorganisms by known techniques. As set forth
above, these methods include culturing preparations of
microorganisms obtained from natural sources such as sewage
sludge, petroleum refinery wastewater, garden soil, or coal,
tar-contaminated soil under selective culture conditions in
which the microorganisms are grown in the presence of
refractory organosulfur compounds such as sulfur-bearing
heterocycles as the sole sulfur source; exposing the
microbial preparation to chemical or physical mutagens; or a
combination of these methods. Such techniques are recounted
by Isbister and Doyle in U.S. Patent No. 4,562,156 (issued
15 Dec. 31, 1985); by Kilbane in 3 Resour. Conserv. Recycl. 69-
79 (1990), U.S. Patent Nos. 5,002,888, 5,104,801 and
5,198,341; and by Omori and coworkers in 58 Appl. Env.
Microbiol. (No. 3) 911-915 (1992), all incorporated by
reference.
As explained above, enzymes are protein or peptide
biocatalysts which can be made by living cells. Enzymes
promote, direct or facilitate the occurrence of a specific
chemical reaction or series of reactions (referred to as a
pathway), generally, without themselves becoming consumed as
a result thereof. Enzymes can include one or more
unmodified or post-translationally or synthetically modified
polypeptide chains or fragments or portions thereof, which
catalyze the desired reaction or series of reactions when in
the presence of the appropriate additional coenzymes,
cofactors, or coreactants. The reaction or series of
reactions relevant to one embodiment of the present
invention culminates in the excision of sulfur from the
hydrocarbon framework of a refractory organosulfur compound,
such as a sulfur-bearing heterocycle. The hydrocarbon
framework of the former refractory organosulfur compound
CA 02230823 1998-03-20
- W O 97111185 PCTnUS95/15864
remains substantially intact. Microorganisms or enzymes
employed as biocatalysts in the present invention preferably
and advantageously do not consume the hydrocarbon framework
of the former refractory organosulfur compound as a carbon
source for growth. As a result, the :Euel value of substrate
fossil fuels exposed to BDS treatment does not deteriorate.
Although living microorganisms (e.g., a çulture) can be
used as the biocatalyst herein, this is not required.
Biocatalytic enzyme preparations that are useful in the
present invention include microbial l~sates, extracts,
fractions, subfractions, or purified products obtained by
conventional means and capable of carrying out the desired
biocatalytic function. Generally, such enzyme preparations
are substantially free of intact microbial cells. Kilbane
and Monticello disclose enzyme preparations that are
suitable for use herein in U.S. Patent No. 5,132,219 (issued
Jul. 21, 1992), and 5,358,870 (filed Jun. 11, 1992), for
example. Rambosek et al. disclose recombinant
microorganisms and enzyme preparations, engineered from
20 Rhodococcus sp. ATCC No. 53968 and suitable for use herein,
in U.S Patent 5,356,813. In a particularly preferred
embodiment, the biocatalyst is overexpressed in the
recombinant host cell (such as a cell which contains more
than one copy of the gene or genes). For example, The
desulfurization of dibenzothiophene by Rhodococcus sp. IGTS8
has been shown to involve at least three enzymes (designated
DszA, B and C), of which DszA and C are now appreciated to
be monooxygenases. As such, in a particularly preferred
embodiment, the biocatalyst includes one or more o~ the
enzymes, Dsz A, Dsz B and/or Dsz C.
Enzyme biocatalyst preparations suitable for use herein
can optionally be affixed to a solid support, e.g., a
membrane, filter, polymeric resin, glass particles or beads,
or ceramic particles or beads. The use of immobilized
enzyme preparations ~acilitates the separation of the
CA 02230823 1998-03-20
- WO 97/11185 PCT~US95/15864
-12-
biocatalyst from the reaction medium, such as the treated
fossil fuel which has been depleted of refractory
organosulfur compounds.
The specific activity of a given biocatalyst is a
measure of its biocatalytic activity per unit mass. Thus,
the specific activity of a particular biocatalyst depends on
the nature or identity of the microorganism used or used as
a source of biocatalytic enzymes, as well as the procedures
used for preparing and/or storing the biocatalyst
preparation. The concentration of a particular biocatalyst
can be adjusted as desired for use in particular
circumstances. For example, where a culture of living
microorganisms (e.g., ATCC No. 53968) is used as the
biocatalyst preparation, a suitable culture medium lacking a
sulfur source other than sulfur-bearing heterocycles can be
inoculated with suitable microorganisms and fermented until
a desired culture density is reached. The result~ing culture
can be diluted with additional medium or another suitable
buffer, or microbial cells present in the culture can be
retrieved e.g., by centrifugation, and resuspended at a
greater concentration than that of the original culture.
The concentrations of microorganism and enzyme biocatalyst
can be adjusted similarly. In this manner, appropriate
volumes of biocatalyst preparations having predetermined
specific activities and/or concentrations can be obtained.
As set forth above, a protein (designated DszD) has now
been purified from Rhodococcus sp. IGTS8 which activates and
enhances the activity of two monooxygenases integral in the
biodesulfurization pathway (DszC and DszA). The function of
this protein is believed to couple the oxidation of NADH
with the oxygenation of the substrate molecules by DszA and
DszC.. A search of the se~uence databases revealed that
DszD is e~uivalent to another recently isolated Rhodococcus
protein, ThcE, which is reported to be induced by growth in
the presence of atrazine, thiocarbamate herbicides and
CA 02230823 l998-03-20
- W O 97J1118S ~CT~US95/15864
-13-
primary alcohols. ThcE is a member of the group III alcohol
dehydrogenases, or oxidoreductases, designated alcohol:
N,N'-dimethyl -3 -nitrosoaniline oxidoreductases and has been
described in Nagy et al., Arch. Microbiol (19g5) 163: 439-
446, which is incorporated herein by :reference in itsentirety DszD has a monomer molecular weight of
approximately 50,000 (by SDS-PAGE) but behaves as a
multimeric protein (decamer) on HPLC size exclusion
chromatography. The activation of DszC and A by DszD
~ollows saturation kinetics.
In view of the above described discovery,
desulfurization of DBT can be enhanced by the addition of an
oxidoreductase. Suitable oxidoreductases include
monooxygenase reductases, or alcohol oxidoreductases, such
as N,N'-dimethyl-4-nitrosoaniline (NDMA)-dependent alcohol
oxidoreductases (MNO). Group III alcohol dehydrogenases, or
oxidoreductases, have been reported to oxidize a primary
alcohol and reduce an electron acceptor, such as the non-
physiological compound NDMA. They generally contain a
tightly but non-covalently bound molecule o~ NAD , which
mediates electron transfer between an alcohol and the
electron acceptor (e.g., NDMA). The term oxidoreductase is
defined herein to include endogenous or wild-type enzymes,
recombinantly produced enzymes, fusion proteins, active
frag~ents, mutants or combinations thereo~ which possess the
ability to enhance and/or activate the activity of DszA
and/or DszC. Mutants include allelic variants, amino acid
or site-directed mutations or derivatives (such as those
prepared employing recombinant DNA technology).
Alternatively mutants can be made employing other chemical
or physical mutagenesis techniques with the host
microorganism. The enzyme is preferably isolated from
Rhodococcus or of rhodoccocal origin, such as IGTS8 or
Rhodococcus sp. N186/21. Other preferred embodiments
include recombinant oxidoreductases having an amino acid
CA 02230823 1998-03-20
- WO 97/11185 PCTAJS95tl5864
-14-
sequence highly homologous (such as, atleast about 90~) to
the amino acid sequence of these enzymes. Alternatively
homologous oxidoreductases, such as those which can be
isolated from Amycolatopsis methanolics and Mycobacterium
gastri can be employed.
As set forth above, oxidoreductases which can be
employed herein include those generally known in the art and
can be used directly as found in nature (e.g., a microbial
fraction which contains the protein or enzyme), obtained
commercially or can be made recombinantly. For example, the
DNA and amino acid sequences of DszD is set forth in Nagy et
al., Arch Microbiology (1995) 163:439-446 (and illustrated
in Figure 6) and can be used to transform a suitable host
microorganism as is well known in the art and discussed in
U.S. Patent No. 5,356,801, for example. The DNA sequence
can be isolated from a suitable Rhodococcus employing well
known techniques, such as PCR.
In another embodiment, the oxidoreductase can be
overexpressed by the desulfurization microorganism (such as
IGTS8). This can be accomplished, for example, by
mutagenesis. Suitable mutagens include radiation, e.g.,
ultraviolet radiation, and chemical mutagens, such as N-
methyl-N'-nitrosoguanidine, hydroxylamine,
ethylmethanesulfonate and nitrous acid. The mutagenesis and
subsequent screening for mutants harboring increased
enzymatic activity can be conducted according to methods
generally known in the art.
Where the oxidoreductase is recombinant, the protein
can be made and, preferably, overexpressed in situ, such as
by the addition of a recombinant microorganism which
contains one or more copies of a DNA sequence which encodes
the oxidoreductase. In a particularly preferred embodiment,
the recombinant microorganism encoding the oxidoreductase
also possesses one or more enzymes capable of catalyzing one
or more reactions in the biodesulfurization of a fossil
CA 02230823 1998-03-20
- W O 97111185 PCT~US9511~864
fuel, particularly DszA and/or DszC. For example, the DNA
encoding oxidoreductase, under control of a suitable
~ promoter, can be transformed into IGTS8 or another
microorganism capable of desulfuriziny a fossil fuel. In
another example, the DNA encoding the oxidoreductase is
simultaneously (e.g., presented in a single plasmid or
vector) or independently transformed into a common host cell
with the DNA encoding the desul~urization biocatalyst(s) or
enzymes. The DNA encoding the oxidoreductase can be, for
example, under the control of the same or different promoter
as the DNA encoding the biocatalyst capable o~ desulfurizing
the fossil fuel. In one embodiment, t:he oxidoreductase DNA
is incorporated or ligated into the desulfurization gene
cluster or operon of IGTS8.
The oxidoreductase is added to the reaction mixture in
a rate-enhancing amount. "Rate-enhancing amount," as
defined herein, is an amount which wi]l significantly
increase the rate of reaction of the biocatalyst, as
originally obtained, including activating the biocatalyst.
For example, where the biocatalyst is IGTS8, a cell-free
fraction or purified enzyme preparation thereof, a "rate-
enhancing amount" of oxidoreductase is an amount of
oxidoreductase that, in addition to that inherently present
in the biocatalyst as obtained, will significantly increase
the rate of desulfurization. The rate of desulfurization
can be increased, for example, by at ]east 25~, 50~ or 100
in comparison to the rate employing the biocatalyst per se.
In one embodiment, the oxidoreductase is added to the
reaction medium in an amount which achieves or approximates
saturation kinetics.
The microorganism harboring the DNA sequence which
encodes DszD can be grown under conditions which maximize
~ the expression of the gene. Rhodococcus species which
contain the gene can be grown in the presence of an
alcohol (such as ethanol, ethanolamine, glycerol or
CA 02230823 1998-03-20
- W O 97/11185 PCT~US95/15864
-16-
propanol), aldehydes (such as, propionaldehyde),
thiocarbamates or atrazine, for example. These compounds
may induce or increase the expression of the gene in the
mlcroorganlsm .
As summarized above, the invention described herein
relates in one aspect to a DNA molecule or fragment thereof
containing a gene or genes which encode an oxidoreductase
and/or a biocatalyst capable of desulfurizing a fossil fuel
that contains organosulfur compounds. The DNA molecule or
fragment thereof can be purified and isolated DNA obtained
from, e.g., a natural source, or can be recombinant
(heterologous or foreign) DNA that is, e.g., present in a
non-human host organism. The DNA can be isolated by well
knwon techniques, such as PCR, designing oligonucleotide
primers from the nucleotide sequence set forth in Figure 6.
The recombinant DNA molecules of the present invention
include DNA resulting from the insertion into its chain, by
chemical or biological means, of one or more genes encoding
a biocatalyst capable o~ selectively cleaving carbon-sulfur
bonds and an oxidoreductase, said gene not originally
present in that chain. Recombinant DNA includes any DNA
synthesized by procedures using restriction nucleases,
nucleic acid hybridization, DNA cloning, DNA synthesis or
any combination of the preceding. Methods of construction
can be found in Maniatis et al., and in other methods known
by those skilled in the art.
Procedures for the construction of the DNA plasmids or
vectors of the present invention include those described in
Maniatis et al. and other methods known by those skilled in
the art. The terms "DNA plasmid" and ~vector~' are intended
to encompass any replication competent plasmid or vector
capable of having foreign or exogenous DNA inserted into it
by chemical or biological means and subsequently, when
transformed into an appropriate non-human host organism, of
expressing the product of the foreign or exogenous DNA
CA 02230823 1998-03-20
~ WO97J11185 PC~S95/15864
insert (e.g., of expressing the biocatalyst and
oxidoreductase of the present invention). In addition, the
- plasmid or vector must be receptive to the insertion of a
DNA molecule or fragment thereof containing the gene or
genes of the present invention, said c3ene or genes encoding
a biocatalyst, as defined above. Proc~edures for the
construction of DNA plasmid vectors include those described
in Maniatis et al. and others known by those skilled in the
art.
The plasmids of the present invention include any DNA
fragment containing a gene or genes encoding an
oxidoreductase and/or a biocatalyst. The term "plasmid" is
intended to encompass any DNA fragment. The DNA fragment
should be transmittable, for example, to a host
microorganism by transformation or conjugation. Procedures
for the construction or extraction of DNA plasmids include
those described in Maniatis et al. and others known by those
skilled in the art.
The transformed non-human host oryanisms of the present
invention can be created by various methods by those skilled
in the art. For example, electroporal_ion as explained by
Maniatis et al. can be used. By the term "non-human host
organism~ is intended any non-human organism capable of the
uptake and expression of foreign, exogenous or recombinant
DNA. Preferably, the host organism is a bacterium, more
preferably a pseudonomad.
In the biocatalytic desulfurization stage, the
carbonaceous material or fossil fuel containing sulfur-
bearing heterocycles is combined with the biocatalyst and
oxidoreducase. The relative amounts of biocatalyst and
oxidoreducase and carbonaceous material, such as a fossil
fuel, can be adjusted to suit particular conditions, or to
produce a particular level of residual sulfur in the
treated, desulfurized material. The amount of biocatalyst
- 35 preparation to be combined with a given quantity of
CA 02230823 1998-03-20
- W O 97/11185 PCTrUS95/15864
substrate will reflect the nature, concentration and
specific activity of the particular biocatalyst(s) and
oxidoreductase used, as well as the nature and relative
abundance of inorganic and organic sulfur compounds present
in the substrate and the degree of desulfurization sought or
considered acceptable.
The method of desulfurizing a fossil fuel of the
present invention involves two aspects. First, a host
organism or biocatalytic preparation obtained therefrom and
oxidoreductase is contacted with a fossil fuel to be
desulfurized. This can be done in any appropriate
container, optionally fitted with an agitation or mixing
device. The mixture is combined thoroughly and allowed to
incubate for a sufficient time to allow for cleavage of a
significant number of carbon-sulfur bonds in organosulfur
compounds, thereby producing a desulfurized fossil fuel. In
one embodiment, an aqueous emulsion or microemulsion is
produced with an aqueous culture of the organism or enzyme
fraction and the fossil fuel, allowing the organism to
propagate in the emulsion while the expressed biocatalyst
cleaves carbon-sulfur bonds.
Variables such as temperature, mixing rate and rate of
desulfurization will vary according to the organism
biocatalyst and/or oxidoreductase, used. The parameters can
be determined through no more than routine experimentation.
Several suitable techniques for monitoring the rate and
extent of desulfurization are well-known and readily
available to those skilled in the art. Baseline and time
course samples can be collected from the incubation mixture,
and prepared for a determination of the residual organic
sulfur in the fossil fuel. The disappearance of sulfur from
organosulfur compounds, such as DBT, in the sample being
subjected to biocatalytic treatment can be monitored using,
e.g., X-ray fluorescence (XRF) or atomic
-
CA 02230823 1998-03-20
~ WO 97J11185 PCT~US95/15864
- 19 -
emission spectrometry (flame spectrometry). Preferably, the
molecular components o~ the sample are ~irst separated,
e.g., by gas chromatography.
The process and the biocatalytic compositions
(including the recombinant microorganisms) of the claimed
invention result in a significant and unexpected improvement
over earlier disclosed processes of desulfurization. It has
been shown that in vitro the reactions catalyzed by purified
DszA and DszC proteins are activated by the addition o~ the
oxidoreductase. This is particularly unexpected in view of
recent discussions in the literature suggesting that FAD
binds directly to DszC (Denome et al., J. sacteriol.,
176:6707-6716, 1994) and the suggestion t:hat NADH is the
only cofactor required for the system (Ohshiro et al., FEMS
Micro~iol. Lett. 118:341-344, 1994) Others suggest that
DszABC are the sole enzymes responsible ~or desulfurization
to occur (Piddington, et al , Appl Env. Microbiol , 67:468-
475, 1995).
Without being limited to any particular mechanism or
theory, it is believed that the pathway of the
desulfurization reaction is set forth below:
NADH + Ht+ ~2 NADf + H20 NADH + H + ~2 NAD+ + H20
~ ~J~ ~J>~
DSZC ~ DSZC ~s~
DBT ~ DBTO2
DBTO
e' + NADH + H+ + ~2 ~
~ DSZA
HO so32- NAD+ + H20 ~
_ ~ HO
HBp DSZB
/ s
HBPSi
SUBSTITUTE SHEEI (RllLE 26)
CA 02230823 1998-03-20
W O 97/11185 PCT~US95/15864
-20-
Here, the oxidoreductase i6 believed to be a short
electron transport chain to deliver the reducing e~uivalents
from NADH (or other electron donor) to the enzymes, DszC
and/or DszA (possibly a physiological electron acceptor of
the oxidoreductase). The enzyme DszC is believed to be
responsible for the biocatalysis of the oxidation reaction
of DBT to DBTO2. The enzyme DszA is believed to be
responsible for the oxygenation of DBTO2 to
phenolphenylsul~ite (PPS).
It is particularly preferred to add the cofactor, FMN,
to the reaction medium as well as an electron donor, NADH or
NADPH. Also preferred is the addition of an NADH or NADPH
regeneration system for converting NAD+ to NADH, according
to methods known in the art.
The invention will now be ~urther illustrated by the
way of the following examples.
EXEMPLIFICATION
Growth o~ Rhodococcus s~. IGTS8:
A sample of frozen stock of Rhodococcus sp. IGTS8
strain CPE-648 containing plasmid pENOK3 (genotype of DszA-
B-C+) as described by Piddington et al. (Appl. Environ.
Microbiol . 61:468-475 (1995)) was grown in 500 ml of rich
medium in a 2000 ml shake flask for 48 hours at 30~C. This
culture was used to inoculate (4% inoculum) a 15 Liter NBS
fermentater in the same medium. This culture was grown for
48 hours at 30~C while controlling pH (between 6.8 and 7.3),
agitation and dissolved oxygen (>50~ saturated). Finally a
5~ inoculum was transferred to a production-scale
fermentater (300 Liter Chemap) containing basal salts
medium, 0.5 g/L Ivanhoe antifoam, 8 g/l ethanol and 1.5 mM
dimethyl sulfoxide. The culture was grown for 45 hours,
achieving an optical density of 11, with a doubling time of
-
CA 02230823 1998-03-20
~WO97S~185 PCT~S95/15864
4.3 hours during the first 24 hours of the run. The cell
suspension was concentrated through a Westfalia centrifuge
- resulting in the production of about 2.5 kg. of wet cell
paste. The paste was stored at -70~C until used for
puri~ication.
Purification of DszD
150 g (wet cell paste) of the Rhodococcus as grown
above were resuspended in 25 mM NaPi, pH 7.5 ~buffer A)
containing 100 mM NaCl, 0.5 mM DTT, 1' mM PMSF and DNAse.
The cell suspension was passed two times through a French
pressure cell (at 20,000 psi) and then centrifuged at 30,000
x g for 45 minutes (5~C) to remove unbroken cells and cell
debris. All subsequent chromatography steps were performed
at 4~C using a Pharmacia FPLC system. The supernatant was
loaded into a Q-sepharose column (2.6 cm x 20 cm)
equilibrated with buffer A containing 100 mM NaCl.
Following loading the column was washed extensively with the
same buffer until the OD280 of the eluent was close to zero.
The column was developed with a linear gradient from 100 mM
NaCl to 500 mM NaCl in buffer A for 180 minutes at a flow
rate of 5 mL/minute and 10 mL fractions were collected. The
fractions which displayed DszD activity were pooled and
dialyzed overnight vs. buffer A. The dialysate was loaded
onto a Toyopearl DEAE-650M column (2.6 cm x 10 cm)
equilibrated with buffer A. The column was developed with a
linear gradient from 0 to 200 mM NaCl ~or 90 minutes at a
flow rate of 4 mL/minute and 4 mL fractions were collected.
The ~ractions which contained DszD activity were pooled and
dialyzed overnight vs. buffer A. The dialysate was loaded
onto a Pharmacia MonoQ column equilibrated with buffer A.
The column was developed with a linear gradient from 160 to
300 mM NaCl for 30 minutes at a flow rate of 0.5 mL/minute
and 0.5 mL fractions were collected. The fractions which
displayed DszD activity were pooled and concentrated to 0.2
CA 02230823 1998-03-20
- WO 97/11185 PCT~US95/15864
mL using Amicon microconcentrators (molecular weight cutoff
of 10 kDa). The concentrated sample was then applied to a
Pharmacia Superdex 75 size exclusion column equilibrated
with buffer A containing 100 mM NaCl. The column was eluted
with the same buffer at a flow rate of 0.2 mL/minute and 0.2
mL fractions were collected. The fractions containing DszD
activity were pooled and concentrated using the
microconcentrators and the protein was stored on ice until
used. SDS-PAGE analysis (14~ polyacrylamide) of the final
preparation showed a single band with an approximate monomer
molecular weight of 50,000 Da.
Enzyme assaYS
DszD activity was measured by monitoring DBTO and DBT02
production from DBT as catalyzed by the combination of DszC
and DszD. The DszC was obtained from an E. coli expression
system, previously described. The assay (in 25 mM NaPi pH
7.5, 100 mM NaCl and 0.5 mM DTT) contained DszC (between 6
and 15 ~g), 3 mM NADH, 10 ~M FMN, 100 ~M DBT and the sample
containing DszD. The assay mixture was allowed to incubate
at 30~C with shaking at 300 rpm for some period of time
(typically 15 to 60 minutes). The reaction was stopped by
the addition of acetonitrile (to 50~) and the products
analyzed by reversed phase HPLC. Activation of DszA by DszD
was assayed in the same manner (DszA was also obtained from
an E. coli expression system) except that the substrate was
DBT sultone and the product was 2,2'-dihydroxybiphenyl
(BHBP).
Results:
Purification of DszD
Figure 1 shows the DszD activity profile of the
fractions from the first anion exchange column (Q-
sepharose). As can be seen by these data the activity
starts around fraction 20 and extends to about fraction 60.
CA 02230823 1998-03-20
- WO 97/111~5 PCT~USg511586
-23-
Both DszA and C activation occurs in these reactions,
furthermore the endogenous DszC activity is also present in
these fractions (notably fractions 40 to 50). Fractions 40
to 60 were pooled and further separated on Toyopearl - DEAE.
An activity pattern similar to the Q-sepharose column was
observed after the Toyopearl - DEAE chromatography except
that the activity eluted at a lower salt concentration and
endogenous DszC activity occurred in later fractions (a
small amount of activity in fraction 40). This was further
substantiated by Western analysis which showed that DszC
eluted with a peak between fraction 45 and 50 (data not
shown). Fractions 15 to 35 were pooled and applied to the
MonoQ column. The active fractions from this column were
pooled, concentrated and further sepa3ated by chromatography
over a Superdex 75 FPLC column. The activity profile of
this column is shown in Figure 2. This figure shows that
both DszA and C are activated by protein(s) in the same
fractions. SDS-PAGE analysis (Figure 3) showed that the
final preparation consisted of a single polypeptide of
molecular weight approximately 50,000. HPLC analysis using
a TosoHaas TSK3000SW size exclusion column on a Hewlett
Packard 1050 HPLC system showed a single protein peak eluted
at an approximate mass of 500,000 Da indicating that the
native protein is most likely a decamer.
DszD activation of DszC and DszA
Figure 4 shows that the activation of DszC by DszD
follows saturation kinetics. As the ratio between DszD and
C is increased an increased rate of D~3TO2 formation is
observed. A plot of the initial rate vs. DszD:DszC shows
that saturation is achieved. Figure ', shows the result of
activation of DszA by the same preparation. The same effect
is observed, i.e. as more DszD is added an increase in the
DszA reaction rate occurs.
CA 02230823 1998-03-20
WO 97/11185 PCT~US95/15864
-24-
Amino acid sequence of DszD
DszD was subjected to N-terminal sequence and the
following sequence was obtained (one letter amino acid
abbreviations):
H2N-AIELNQIWDFPIKEFHPFPRALMGVGAHDIIGVEAKNLGFKRTLLM-COOH
(SEQ ID. NO: 3)
A search of the data-bases resulted in a 100~ match
with a Rhodococcus protein designated ThcE (Nagy et al.,
Arch. Microbiol. 163:439-446 (1995)). The DNA sequence and
putative amino acid sequences of the open reading frames are
set forth in Figure 6. This protein has high homology to
the alcohol: N,N'-dimethyl-4-nitrosoaniline (NDMA)
oxidoreductses found in other Gram-positive organisms which
are involved in the oxidation of alcohols and the
concomitant reduction of an electron acceptor. The
physiological electron acceptor in those organisms is
unknown.
EOUIVALENTS
Those skilled in the art will know, or be able to
ascertain, using no more than routine experimentation, many
equivalents to the specific embodiments of the invention
described herein. These and all other equivalents are
intended to be encompassed by the following claims.
