Note: Descriptions are shown in the official language in which they were submitted.
CA 02913992 2015-12-03
ACTIVIN-ACTRIIA ANTAGONISTS AND
USES FOR PROMOTING BONE GROWTH IN CANCER PATIENTS
BACKGROUND OF THE INVENTION
Disorders of the bone, ranging from osteoporosis to fractures, represent a set
of
pathological states for which there are few effective pharmaceutical agents.
Treatment
instead focuses on physical and behavioral interventions, including
immobilization, exercise
and changes in diet. It would be beneficial to have therapeutic agents that
promote bone
growth and increase bone density for the purpose of treating a variety of bone
disorders.
Bone growth and mineralization are dependent on the activities of two cell
types,
osteoclasts and osteoblasts, although chondrocytes and cells of the
vasculature also
participate in critical aspects of these processes. Developmentally, bone
formation occurs
through two mechanisms, endochondral ossification and intramembranous
ossification, with
the former responsible for longitudinal bone formation and the later
responsible for the
formation of topologically flat bones, such as the bones of the skull.
Endochondral
ossification requires the sequential formation and degradation of
cartilaginous structures in
the growth plates that serve as templates for the formation of osteoblasts,
osteoclasts, the
vasculature and subsequent mineralization. During intramembranous
ossification, bone is
formed directly in the connective tissues. Both processes require the
infiltration of osteoblasts
and subsequent matrix deposition.
Fractures and other structural disruptions of bone are healed through a
process that, at
least superficially, resembles the sequence of developmental events of
osteogenesis,
including the formation of cartilaginous tissue and subsequent mineralization.
The process of
fracture healing can occur in two ways. Direct or primary bone healing occurs
without callus
- 1 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
formation. Indirect or secondary bone healing occurs with a callus precursor
stage. Primary
healing of fractures involves the reformation of mechanical continuity across
a closely-set
disruption. Under suitable conditions, bone-resorbing cells surrounding the
disruption show
a tunnelling resorptive response and establish pathways for the penetration of
blood vessels
and subsequent healing. Secondary healing of bones follows a process of
inflammation, soft
callus formation, callus mineralisation and callus remodelling. In the
inflammation stage,
haematoma and haemorrhage formation results from the disruption of periosteal
and
endosteal blood vessels at the site of injury. Inflammatory cells invade the
area. In soft
callus formation stage, the cells produce new vessels, fibroblasts,
intracellular material and
supporting cells, forming granulation tissue in the space between the fracture
fragments.
Clinical union across the disruption is established by fibrous or
cartilaginous tissue (soft
callus). Osteoblasts are formed and mediate the mineralization of soft callus,
which is then
replaced by lamellar bone and subjected to the normal remodeling processes.
In addition to fractures and other physical disruptions of bone structure,
loss of bone
mineral content and bone mass can be caused by a wide variety of conditions
and may result
in significant medical problems. Changes to bone mass occur in a relatively
predictable way
over the life of an individual. Up to about age 30, bones of both men and
women grow to
maximal mass through linear growth of the endochondral growth plates and
radial growth.
After about age 30 (for trabecular bone, e.g., flat bones such as the
vertebrae and pelvis) and
age 40 (for cortical bone, e.g., long bones found in the limbs), slow bone
loss occurs in both
men and women. In women, a final phase of substantial bone loss also occurs,
probably due
to postmenopausal estrogen deficiencies. During this phase, women may lose an
additional
10% of bone mass from the cortical bone and 25% from the trabecular
compartment.
Whether progressive bone loss results in a pathological condition such as
osteoporosis
depends largely on the initial bone mass of the individual and whether there
are exacerbating
conditions.
Bone loss is sometimes characterized as an imbalance in the normal bone
remodeling
process. Healthy bone is constantly subject to remodeling. Remodeling begins
with
resorption of bone by osteoclasts. The resorbed bone is then replaced by new
bone tissue,
which is characterized by collagen formation by osteoblasts, and subsequent
calcification. In
healthy individuals the rates of resorption and formation are balanced.
Osteoporosis is a
- 2 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
chronic, progressive condition, marked by a shift towards resorption,
resulting in an overall
decrease in bone mass and bone mineralization. Osteoporosis in humans is
preceded by
clinical osteopenia (bone mineral density that is greater than one standard
deviation but less
than 2.5 standard deviations below the mean value for young adult bone).
Worldwide,
approximately 75 million people are at risk for osteoporosis.
Thus, methods for controlling the balance between osteoclast and osteoblast
activity
can be useful for promoting the healing of fractures and other damage to bone
as well as the
treatment of disorders, such as osteoporosis, associated with loss of bone
mass and bone
mineralization.
With respect to osteoporosis, estrogen, calcitonin, osteocalcin with vitamin
K, or high
doses of dietary calcium are all used as therapeutic interventions. Other
therapeutic
approaches to osteoporosis include bisphosphonates, parathyroid hormone,
calcimimetics,
statins, anabolic steroids, lanthanum and strontium salts, and sodium
fluoride. Such
therapeutics, however, are often associated with undesirable side effects.
Thus, it is an object of the present disclosure to provide compositions and
methods for
promoting bone growth and mineralization.
SUMMARY OF THE INVENTION
In part, the disclosure demonstrates that molecules having activin or ActRIIa
antagonist activity ("activin antagonists" and "ActRIla antagonists",
collectively "activin-
ActRIla antagonists") can be used to increase bone density, promote bone
growth, and/or
increase bone strength. In particular, the disclosure demonstrates that a
soluble form of
ActRIIa acts as an inhibitor of activin-ActRlIa signaling and promotes
increased bone
density, bone growth, and bone strength in vivo. While most pharmaceutical
agents that
promote bone growth or inhibit bone loss act as either anti-catabolic agents
(also commonly
referred to as "catabolic agents") (e.g., bisphosphonates) or anabolic agents
(e.g., parathyroid
hormone, PTH, when appropriately dosed), the soluble ActRIla protein exhibits
dual activity,
having both anti-catabolic and anabolic effects. Thus, the disclosure
establishes that
antagonists of the activin-ActRlIa signaling pathway may be used to increase
bone density
and promote bone growth. While soluble ActRIla may affect bone through a
mechanism
- 3 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
other than activin antagonism, the disclosure nonetheless demonstrates that
desirable
therapeutic agents may be selected on the basis of an activin-ActRIla
antagonist activity.
Therefore, in certain embodiments, the disclosure provides methods for using
activin-ActRIla
antagonists, including, for example, activin-binding ActRIla polypeptides,
anti-activin
antibodies, anti-ActRlIa antibodies, activin- or ActRIla-targeted small
molecules and
aptamers, and nucleic acids that decrease expression of activin and ActRIla,
to treat disorders
associated with low bone density or low bone strength, such as osteoporosis,
or to promote
bone growth in patients in need thereof, such as in patients having a bone
fracture. The
disclosure further demonstrates that activin-ActRIla antagonists are effective
in preventing
and/or repairing bone damage caused by multiple myeloma tumors and breast
tumors, and,
additionally, that activin-ActRIla antagonists diminish the tumor load in
multiple myeloma.
Soluble ActRIla polypeptide promotes bone growth without causing a
consistently
measurable increase in muscle mass.
In certain aspects, the disclosure provides polypeptides comprising a soluble,
activin-
binding ActRIla polypeptide that binds to activin. ActRIla polypeptides may be
formulated
as a pharmaceutical preparation comprising the activin-binding ActRIla
polypeptide and a
pharmaceutically acceptable carrier. Preferably, the activin-binding ActRIla
polypeptide
binds to activin with a KD less than 1 micromolar or less than 100, 10 or 1
nanomolar.
Optionally, the activin-binding ActRIla polypeptide selectively binds activin
versus GDF11
and/or GDF8, and preferably with a KD that is at least 10-fold, 20-fold or 50-
fold lower with
respect to activin than with respect to GDF11 and/or GDF8. While not wishing
to be bound
to a particular mechanism of action, it is expected that this degree of
selectivity for activin
inhibition over GDF I 1/GDF8 inhibition accounts for the selective effect on
bone without a
consistently measurable effect on muscle. In many embodiments, an ActRIla
polypeptide
will be selected for causing less than 15%, less than 10% or less than 5%
increase in muscle
at doses that achieve desirable effects on bone. Preferably the composition is
at least 95%
pure, with respect to other polypeptide components, as assessed by size
exclusion
chromatography, and more preferably, the composition is at least 98% pure. An
activin-
binding ActRIla polypeptide for use in such a preparation may be any of those
disclosed
herein, such as a polypeptide having an amino acid sequence selected from SEQ
ID NOs: 2,
3, 7 or 12, or having an amino acid sequence that is at least 80%, 85%, 90%,
95%, 97% or
99% identical to an amino acid sequence selected from SEQ ID NOs: 2, 3, 7, 12
or 13. An
- 4 -
CA 02913992 2015-12-03
activin-binding ActRIla polypeptide may include a functional fragment of a
natural ActRIIa
polypeptide, such as one comprising at least 10, 20 or 30 amino acids of a
sequence selected
from SEQ ID NOs: 1-3 or a sequence of SEQ ID NO: 2, lacking the C-terminal 10
to 15
amino acids (the "tail").
A soluble, activin-binding ActRIIa polypeptide may include one or more
alterations in
the amino acid sequence (e.g., in the ligand-binding domain) relative to a
naturally occurring
ActRIIa polypeptide. Examples of altered ActRIIa polypeptides are provided in
WO
2006/012627, pp. 59-60. The alteration in the amino acid
sequence may, for example, alter glycosylation of the polypeptide when
produced in a
mammalian, insect or other eukaryotic cell or alter proteolytic cleavage of
the polypeptide
relative to the naturally occurring ActRIla polypeptide.
An activin-binding ActRIIa polypeptide may be a fusion protein that has, as
one
domain, an ActRIIa polypeptide (e.g., a ligand-binding portion of an ActRIIa)
and one or
more additional domains that provide a desirable property, such as improved
pharmacokinetics, easier purification, targeting to particular tissues, etc.
For example, a
domain of a fusion protein may enhance one or more of in vivo stability, in
vivo half life,
uptake/administration, tissue localization or distribution, formation of
protein complexes,
multimerization of the fusion protein, and/or purification. Dimerization or
multimerization
may provide increased ligand-binding affinity. An activin-binding ActRIIa
fusion protein
may include an immunoglobulin Fc domain (wild-type or mutant) or a serum
albumin or
other polypeptide portion that provides desirable properties such as improved
pharmacokinetics, improved solubility or improved stability. Typically, an
ActRIla-Fc
fusion protein will be produced as a homodimeric complex. Optionally, an
ActRIIa-Fc
fusion comprises a relatively unstructured linker positioned between the Fc
domain and the
extracellular ActRlIa domain. This unstructured linker may correspond to the
roughly 15
amino acid unstructured region at the C-terminal end of the extracellular
domain of ActRIIa
(the "tail"), or it may be an artificial sequence of 1, 2, 3, 4 or 5 amino
acids or a length of
between 5 and 15, 20, 30, 50 or more amino acids that are relatively free of
secondary
structure, or a mixture of both. A linker may be rich in glycine and proline
residues and may,
for example, contain a single sequence of threonine/serine and glycines or
repeating
sequences of threonine/serine and glycines (e.g., Tai or Sal singlets or
repeats). A fusion
- 5 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
protein may include a purification subsequence, such as an epitope tag, a FLAG
tag, a
polyhistidine sequence, and a GST fusion. Optionally, a soluble ActRIla
polypeptide
includes one or more modified amino acid residues selected from: a
glycosylated amino acid,
a PEGylated amino acid, a famesylated amino acid, an acetylated amino acid, a
biotinylated
amino acid, an amino acid conjugated to a lipid moiety, and an amino acid
conjugated to an
organic derivatizing agent. A pharmaceutical preparation may also include one
or more
additional compounds such as a compound that is used to treat a bone disorder.
Preferably, a
pharmaceutical preparation is substantially pyrogen free. In general, it is
preferable that an
ActRIla protein be expressed in a mammalian cell line that mediates suitably
natural
glycosylation of the ActRlIa protein so as to diminish the likelihood of an
unfavorable
immune response in a patient. Human and CHO cell lines have been used
successfully, and it
is expected that other common mammalian expression systems will be useful.
As described herein, ActRIla proteins designated ActRIIa-Fc have desirable
properties, including selective binding to activin versus GDF8 and/or GDF11,
high affinity
ligand binding and serum half life greater than two weeks in animal models. In
certain
embodiments the invention provides ActRIIa-Fc polypeptides and pharmaceutical
preparations comprising such polypeptides and a pharmaceutically acceptable
excipient.
In certain aspects, the disclosure provides nucleic acids encoding a soluble
activin-
binding ActRIla polypeptide. An isolated polynucleotide may comprise a coding
sequence
for a soluble, activin-binding ActRIla polypeptide, such as described above.
For example, an
isolated nucleic acid may include a sequence coding for an extracellular
domain (e.g., ligand-
binding domain) of an ActRIla and a sequence that would code for part or all
of the
transmembrane domain and/or the cytoplasmic domain of an ActRIla, but for a
stop codon
positioned within the transmembrane domain or the cytoplasmic domain, or
positioned
between the extracellular domain and the transmembrane domain or cytoplasmic
domain.
For example, an isolated polynucleotide may comprise a full-length ActRIla
polynucleotide
sequence such as SEQ ID NO: 4 or 5, or a partially truncated version, said
isolated
polynucleotide further comprising a transcription termination codon at least
six hundred
nucleotides before the 3'-terminus or otherwise positioned such that
translation of the
polynucleotide gives rise to an extracellular domain optionally fused to a
truncated portion of
a full-length ActRIla. A preferred nucleic acid sequence is SEQ ID NO:14,
Nucleic acids
- 6 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
disclosed herein may be operably linked to a promoter for expression, and the
disclosure
provides cells transformed with such recombinant polynucleotides. Preferably
the cell is a
mammalian cell such as a CHO cell.
In certain aspects, the disclosure provides methods for making a soluble,
activin-
binding ActRIla polypeptide. Such a method may include expressing any of the
nucleic acids
(e.g., SEQ ID NO: 4, 5 or 14) disclosed herein in a suitable cell, such as a
Chinese hamster
ovary (CHO) cell. Such a method may comprise: a) culturing a cell under
conditions suitable
for expression of the soluble ActRIIa polypeptide, wherein said cell is
transformed with a
soluble ActRIla expression construct; and b) recovering the soluble ActRlIa
polypeptide so
expressed. Soluble ActRlIa polypeptides may be recovered as crude, partially
purified or
highly purified fractions. Purification may be achieved by a series of
purification steps,
including, for example, one, two or three or more of the following, in any
order: protein A
chromatography, anion exchange chromatography (e.g., Q sepharose), hydrophobic
interaction chromatography (e.g., phenylsepharose), size exclusion
chromatography, and
cation exchange chromatography.
In certain aspects, an activin-ActRIla antagonist disclosed herein, such as a
soluble,
activin-binding ActRIIa polypeptide, may be used in a method for promoting
bone growth or
increasing bone density in a subject. In certain embodiments, the disclosure
provides
methods for treating a disorder associated with low bone density, or to
promote bone growth,
in patients in need thereof. A method may comprise administering to a subject
in need
thereof an effective amount of activin-ActRIla antagonist. In certain aspects,
the disclosure
provides uses of activin-ActRIIa antagonist for making a medicament for the
treatment of a
disorder or condition as described herein.
In certain aspects, the disclosure provides a method for identifying an agent
that
stimulates growth of, or increased mineralization of, bone. The method
comprises: a)
identifying a test agent that binds to activin or a ligand-binding domain of
an ActRIIa
polypeptide; and b) evaluating the effect of the agent on growth of, or
mineralization of,
bone.
- 7 -
CA 02913992 2015-12-03
WO 2008/100384
PCT/US2008/001354
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 shows the purification of ActRlIa-hFc expressed in Cl-JO cells. The
protein
purifies as a single, well-defined peak.
Figure 2 shows the binding of ActRIla-hFc to activin and GDF-1 1, as measured
by
BiaCoreTm assay.
Figure 3 shows a schematic for the A-204 Reporter Gene Assay. The figure shows
the Reporter vector: pGL3(CAGA)12 (described in Dennler et al, 1998, EMBO 17:
3091-
3100.) The CAGA12 motif is present in TGF-Beta responsive genes (PAI-1 gene),
so this
vector is of general use for factors signaling through Smad 2 and 3.
Figure 4 shows the effects of ActRI1a-hFc (diamonds) and ActRIIa-mFc (squares)
on
GDF-8 signaling in the A-204 Reporter Gene Assay. Both proteins exhibited
substantial
inhibition of GDF-8 mediated signaling at picomolar concentrations.
Figure 5 shows the effects of three different preparations of ActRIIa-hFc on
GDF-11
signaling in the A-204 Reporter Gene Assay.
Figure 6 shows examples of DEXA images of control- and ActRIIa-mFc-treated
BALB/c mice, before (top panels) and after (bottom panels) the 12-week
treatment period.
Paler shading indicates increased bone density.
Figure 7 shows a quantification of the effects of ActRlIa-mFe on bone mineral
density in BALB/c mice over the 12-week period. Treatments were control
(diamonds), 2
mg/kg dosing of ActRIIa-mFc (squares), 6 mg/kg dosing of ActRIIa-mFc
(triangles) and 10
mg/kg dosing of ActRIIa-mFc (circles).
Figure 8 shows a quantification of the effects of ActRIIa-mFc on bone mineral
content in BALB/c mice over the 12-week period. Treatments were control
(diamonds), 2
mg/kg dosing of ActRIIa-mFc (squares), 6 mg/kg dosing of ActRlIa-mFc
(triangles) and 10
mg/kg dosing of ActRIla-mFc (circles).
Figure 9 shows a quantification of the effects of ActRIIa-mFc on bone mineral
density of the trabecular bone in ovariectomized (OVX) or sham operated (SHAM)
C57BL6
mice over after a 6-week period. Treatments were control (PBS) or 10 mg/kg
dosing of
ActRIla-mFc (ActRIla).
- 8 -
CA 02913992 2015-12-03
WO 2008/100384
PCT/US2008/001354
Figure 10 shows a quantification of the effects of ActRlIa-mFc on the
trabecular bone
in ovariectomized (OVX) C57BL6 mice over a 12-week period. Treatments were
control
(PBS; pale bars) or 10 mg/kg dosing of ActRIla-mFc (ActRIla; dark bars).
Figure 11 shows a quantification of the effects of ActRIla-mFc on the
trabecular bone
in sham operated C57BL6 mice after 6 or 12 weeks of treatment period.
Treatments were
control (PBS; pale bars) or 10 mg/kg dosing of ActRIla-mFc (ActRIIa; dark
bars).
Figure 12 shows the results of pQCT analysis of bone density in ovariectomized
mice
over 12 weeks of treatment. Treatments were control (PBS; pale bars) or
ActRlIa-mFc (dark
bars). y-axis: mg/ccm
Figure 13 depicts the results of pQCT analysis of bone density in sham
operated mice
over 12 weeks of treatment. Treatments were control (PBS; pale bars) or
ActRIIa-mFc (dark
bars). y-axis; mg/ccm
Figures 14A and 14B show whole body DEXA analysis after 12 weeks of treatment
(A) and ex vivo analysis of femurs (B). Light areas depict areas of high bone
density.
Figure 15 shows ex vivo pQCT analysis of the femoral midshaft after twelve
weeks of
treatment. Treatments were vehicle control (PBS, dark bars) and ActRIla-mFc
(pale bars).
The four bars to the left show total bone density while the four bars to the
right show cortical
bone density. The first pair of bars in each set of four bars represent data
from
ovariectomized mice while the second pair of bars represent data from sham
operated mice.
Figure 16 shows ex vivo pQCT analysis and diaphyseal bone content of the
femoral
midshaft after twelve weeks of treatment. Treatments were vehicle control
(PBS, dark bars)
or ActRIIa-mFc (pale bars). The four bars to the left show total bone content
while the four
bars to the right show cortical bone content. The first pair of bars in each
set of four bars
represent data from ovariectomized mice while the second pair of bars
represent data from
sham operated mice.
Figure 17 shows ex vivo pQCT analysis of the femoral midshaft and femoral
cortical
thickness. Treatments were control (PBS, dark bars) and ActRlIa-mFc (pale
bars). The four
bars to the left show endosteal circumference while the four bars to the right
show periosteal
circumference. The first pair of bars in each set of four bars represent data
from
ovariectomized mice while the second pair of bars represent data from sham
operated mice.
- 9 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
Figure 18 depicts the results of mechanical testing of femurs after twelve
weeks of
treatment. Treatments were control (PBS, dark bars) and ActRIla-mFc (pale
bars). The two
bars to the left represent data from ovariectomized mice while the last two
bars represent data
from sham operated mice.
Figure 19 shows the effects of ActrIla-mFc on trabecular bone volume.
Figure 20 shows the effects of Actrlla-mFc on trabecular architecture in the
distal
femur.
Figure 21 shows the effects of ActrIla-mFc on cortical bone.
Figure 22 shows the effects of ActrIla-mFc on the mechanical strength of bone.
Figure 23 shows the effects of different doses of ActRIIa-mFc on bone
characteristics
at three different dosages.
Figure 24 shows bone histomorphometry indicating that ActRIIa-mFc has dual
anabolic and anti-resorptive activity.
Figure 25 shows additional histomorphometric data.
Figure 26 shows images of mouse femurs from naïve and tumor-carrying mice, and
the effects of ActRIIa-mFc treatment on bone morphology in the multiple
myeloma model.
Mice carrying multiple myeloma tumors (5T2) show marked pitting and
degradation in the
bone relative to normal mice (naïve). Treatment with ActRIIa-mFc eliminates
this effect.
Figure 27 shows results from the human clinical trial described in Example 5,
where
the area-under-curve (AUC) and administered dose of ActRIIa-hFc have a linear
correlation,
regardless of whether ActRIIa-hFc was administered intravenously (IV) or
subcutaneously
(SC).
Figure 28 shows a comparison of serum levels of ActRIIa-hFc in patients
administered IV or SC.
Figure 29 shows bone alkaline phosphatase (BAP) levels in response to
different dose
levels of ActRIIa-hFc. BAP is a marker for anabolic bone growth.
Figure 30 shows the cooperative effects of ActRIIa-mFc (RAP-011) and a
bisphosphonate agent (zoledronate) in mice.
-10-
CA 02913992 2015-12-03
WO 2008/100384 PCT/11S2008/001354
DETAILED DESCRIPTION OF THE INVENTION
1. Overview
The transforming growth factor-beta (TGF-beta) superfamily contains a variety
of
growth factors that share common sequence elements and structural motifs.
These proteins
are known to exert biological effects on a large variety of cell types in both
vertebrates and
invertebrates. Members of the superfamily perform important functions during
embryonic
development in pattern formation and tissue specification and can influence a
variety of
differentiation processes, including adipogenesis, myogenesis, chondrogenesis,
cardiogenesis, hematopoiesis, neurogenesis, and epithelial cell
differentiation. The family is
divided into two general branches: the BMP/GDF and the TGF-beta/Activin/BMP10
branches, whose members have diverse, often complementary effects. By
manipulating the
activity of a member of the TGF-beta family, it is often possible to cause
significant
physiological changes in an organism. For example, the Piedmontese and Belgian
Blue cattle
breeds carry a loss-of-function mutation in the GDF8 (also called myostatin)
gene that causes
a marked increase in muscle mass. Grobet et al., Nat Genet. 1997, 17(1):71-4.
Furthermore,
in humans, inactive alleles of GDF8 are associated with increased muscle mass
and,
reportedly, exceptional strength. Schuelke et al., N Engl J Med 2004, 350:2682-
8.
Activins are dimeric polypeptide growth factors that belong to the TGF-beta
superfamily. There are three principle activin forms (A, B, and AB) that are
homo/heterodimers of two closely related 13 subunits (PAPA, POD, and f3Af3B).
The human
genome also encodes an activin C and an activin E, which are primarily
expressed in the
liver. In the TGF-beta superfamily, activins are unique and multifunctional
factors that can
stimulate hormone production in ovarian and placental cells, support neuronal
cell survival,
influence cell-cycle progress positively or negatively depending on cell type,
and induce
mesodermal differentiation at least in amphibian embryos (DePaolo et al.,
1991, Proc Soc Ep
Biol Med. 198:500-512; Dyson et al., 1997, Curr Biol. 7:81-84; Woodruff, 1998,
Biochem
Pharmacol. 55:953-963). Moreover, erythroid differentiation factor (EDF)
isolated from the
stimulated human monocytic leukemic cells was found to be identical to activin
A (Murata et
al., 1988, PNAS, 85:2434). It has been suggested that activin A acts as a
natural, positive
regulator of erythropoiesis in the bone marrow. In several tissues, activin
signaling is
antagonized by its related heterodimer, inhibin. For example, during the
release of follicle-
- 11 -
CA 02913992 2015-12-03
WO 2008/100384
PCT/US2008/001354
stimulating hormone (FSH) from the pituitary, activin promotes FSH secretion
and synthesis,
while inhibin prevents FSH secretion and synthesis. Other proteins that may
regulate activin
bioactivity and/or bind to activin include follistatin (FS), follistatin-
related protein (FSRP),
and a2-macroglobulin.
TGF-13 signals are mediated by heteromeric complexes of type I and type II
serine/
threonine kinase receptors, which phosphorylate and activate downstream Smad
proteins
upon ligand stimulation (Massague, 2000, Nat. Rev. Mol. Cell Biol. 1:169-178).
These type I
and type II receptors are transmembrane proteins, composed of a ligand-binding
extracellular
domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic
domain with
predicted serine/threonine specificity. Type I receptors are essential for
signaling; and type 11
receptors are required for binding ligands and for expression of type I
receptors. Type I and
II activin receptors form a stable complex after ligand binding, resulting in
phosphorylation
of type I receptors by type II receptors.
Two related type II receptors, ActRIla and ActRIIb, have been identified as
the type II
receptors for activins (Mathews and Vale, 1991, Cell 65:973-982; Attisano et
al., 1992, Cell
68: 97-108). Besides activins, ActRIla and ActRIlb can biochemically interact
with several
other TGF-13 family proteins, including BMP7, Nodal, GDF8, and GDF1 I
(Yamashita et al.,
1995, J. Cell Biol. 130:217-226; Lee and McPherron, 2001, Proc. Natl. Acad.
Sci. 98:9306-
9311; Yeo and Whitman, 2001, Mol. Cell 7: 949-957; Oh et al., 2002, Genes Dev.
16:2749-
54). ALK4 is the primary type I receptor for activins, particularly for
activin A, and ALK-7
may serve as a receptor for activins as well, particularly for activin B.
As demonstrated herein, a soluble ActRIIa polypeptide (sActRIIa), which shows
substantial preference in binding to activin A as opposed to other TGF-beta
family members,
such as GDF8 or GDFI I, is effective to promote bone growth and increase bone
density in
vivo. While not wishing to be bound to any particular mechanism, it is
expected that the
effect of sActRIla is caused primarily by an activin antagonist effect, given
the very strong
activin binding (picomolar dissociation constant) exhibited by the particular
sActRlIa
construct used in these studies. Regardless of mechanism, it is apparent from
the data
presented herein that ActRlIa-activin antagonists do increase bone density in
normal mice, in
mouse models for osteoporosis and in a mouse model of multiple myeloma. It
should be
noted that bone is a dynamic tissue, with growth or shrinkage and increased or
decreased
- 12-
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
density depending on a balance of factors that produce bone and stimulate
mineralization
(primarily osteoblasts) and factors that destroy and demineralize bone
(primarily osteoclasts).
Bone growth and mineralization may be increased by increasing the productive
factors, by
decreasing the destructive factors, or both. The terms "promote bone growth"
and "increase
bone mineralization" refer to the observable physical changes in bone and are
intended to be
neutral as to the mechanism by which changes in bone occur.
The mouse models for osteoporosis and bone growth/density that were used in
the
studies described herein are considered to be highly predictive of efficacy in
humans, and
therefore, this disclosure provides methods for using ActRIIa polypeptides and
other activin-
ActRIla antagonists to promote bone growth and increase bone density in
humans. Activin-
ActRIIa antagonists include, for example, activin-binding soluble ActRIla
polypeptides,
antibodies that bind to activin (particularly the activin A or B subunits,
also referred to as PA
or 13B) and disrupt ActRITa binding, antibodies that bind to ActRlIa and
disrupt activin
binding, non-antibody proteins selected for activin or ActRIIa binding (see
e.g.,
WO/2002/088171, WO/2006/055689, and WO/2002/032925 for examples of such
proteins
and methods for design and selection of such non-antibody affinity binding
reagents), and
randomized peptides selected for activin or ActRlIa binding, often affixed to
an Fc domain.
Two different proteins (or other moieties) with activin or ActRIIa binding
activity, especially
activin binders that block the type I (e.g., a soluble type I activin
receptor) and type II (e.g., a
soluble type II activin receptor) binding sites, respectively, may be linked
together to create a
bifunctional binding molecule. Nucleic acid aptamers, small molecules and
other agents that
inhibit the activin-ActRIIa signaling axis. Various proteins have activin-
ActRlIa antagonist
activity, including inhibin (i.e., inhibin alpha subunit), although inhibin
does not universally
antagonize activin in all tissues, follistatin (e.g., follistatin-288 and
follistatin-315), FSRP,
activin C, alpha(2)-macroglobulin, and an M108A (methionine to alanine change
at position
108) mutant activin A. Generally, alternative forms of activin, particularly
those with
alterations in the type I receptor binding domain can bind to type II
receptors and fail to form
an active ternary complex, thus acting as antagonists. Additionally, nucleic
acids, such as
antisense molecules, siRNAs or ribozymes that inhibit activin A, B, C or E,
or, particularly,
ActRI la expression, can be used as activin-ActRIla antagonists. Preferably,
the activin-
ActRI la antagonist to be used will exhibit selectivity for inhibiting activin-
mediated signaling
versus other members of the TGF-beta family, and particularly with respect to
GDF8 and
- 13-
CA 02913992 2015-12-03
GDF11. Soluble ActRIlb proteins do bind to activin, however, the wild type
protein does not
exhibit significant selectivity in binding to activin versus GDF8/11, and
preliminary
experiments suggest that this protein does not provide the desired effects on
bone, while also
causing substantial muscle growth. However, altered forms of ActRIlb with
different binding
properties have been identified (see, e.g., WO 2006/012627, pp. 55-59,
and these proteins may achieve the desired effects on bone. Native or altered
ActRIlb may be given added specificity for activin by coupling with a second,
activin-
selective binding agent.
The terms used in this specification generally have their ordinary meanings in
the
art, within the context of this invention and in the specific context where
each term is used.
Certain terms are discussed below or elsewhere in the specification, to
provide additional
guidance to the practitioner in describing the compositions and methods of the
invention and
how to make and use them. The scope or meaning of any use of a term will be
apparent from
the specific context in which the term is used.
"About" and "approximately" shall generally mean an acceptable degree of error
for
the quantity measured given the nature or precision of the measurements.
Typically,
exemplary degrees of error are within 20 percent (%), preferably within 10%,
and more
preferably within 5% of a given value or range of values.
Alternatively, and particularly in biological systems, the terms "about" and
"approximately" may mean values that are within an order of magnitude,
preferably within 5-
fold and more preferably within 2-fold of a given value. Numerical quantities
given herein
are approximate unless stated otherwise, meaning that the term "about" or
"approximately"
can be inferred when not expressly stated.
The methods of the invention may include steps of comparing sequences to each
other, including wild-type sequence to one or more mutants (sequence
variants). Such
comparisons typically comprise alignments of polymer sequences, e.g., using
sequence
alignment programs and/or algorithms that are well known in the art (for
example, BLAST,
FASTA and MEGAL1GN, to name a few). The skilled artisan can readily appreciate
that, in
such alignments, where a mutation contains a residue insertion or deletion,
the sequence
alignment will introduce a "gap" (typically represented by a dash, or "A") in
the polymer
sequence not containing the inserted or deleted residue.
- 14 -
CA 02913992 2015-12-03
WO 2008/100384
PCT/1JS2008/001354
"Homologous," in all its grammatical forms and spelling variations, refers to
the
relationship between two proteins that possess a "common evolutionary origin,"
including
proteins from superfamilies in the same species of organism, as well as
homologous proteins
from different species of organism. Such proteins (and their encoding nucleic
acids) have
sequence homology, as reflected by their sequence similarity, whether in terms
of percent
identity or by the presence of specific residues or motifs and conserved
positions.
The term "sequence similarity," in all its grammatical forms, refers to the
degree of
identity or correspondence between nucleic acid or amino acid sequences that
may or may
not share a common evolutionary origin.
However, in common usage and in the instant application, the term
"homologous,"
when modified with an adverb such as "highly," may refer to sequence
similarity and may or
may not relate to a common evolutionary origin.
2. ActRIIa Polypeptides
In certain aspects, the present invention relates to ActRIla polypeptides. As
used
herein, the term "ActRIIa" refers to a family of activin receptor type ha
(ActRIIa) proteins
from any species and variants derived from such ActRIla proteins by
mutagenesis or other
modification. Reference to ActRIla herein is understood to be a reference to
any one of the
currently identified forms. Members of the ActRlIa family are generally
transmembrane
proteins, composed of a ligand-binding extracellular domain with a cysteine-
rich region, a
transmembrane domain, and a cytoplasmic domain with predicted serine/threonine
kinase
activity.
The term "ActRIIa polypeptide" includes polypeptides comprising any naturally
occurring polypeptide of an ActRIIa family member as well as any variants
thereof
(including mutants, fragments, fusions, and peptidomimetic forms) that retain
a useful
activity. For example, ActRIIa polypeptides include polypeptides derived from
the sequence
of any known ActRI la having a sequence at least about 80% identical to the
sequence of an
ActRI la polypeptide, and preferably at least 85%, 90%, 95%, 97%, 99% or
greater identity.
For example, an ActRIla polypeptide of the invention may bind to and inhibit
the function of
an ActRIla protein and/or activin. Preferably, an ActRIla polypeptide promotes
bone growth
- 15-
CA 02913992 2015-12-03
WO 2008/100384
PCT/US2008/001354
and bone mineralization. Examples of ActRIla polypeptides include human
ActRIla
precursor polypeptide (SEQ ID NO: 1) and soluble human ActRIla polypeptides
(e.g., SEQ
ID NOs: 2, 3, 7 and 12).
The human ActRIla precursor protein sequence is as follows:
MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEP
CYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTD67EKKDSP
EVYFCCCEGNMCNEKFiYFPEMEVTQPTSNPVTPKPPYYNILLYSLVPL
MLIAGIVICAFWVYRHHKMAY PPVLVPTQDPGP PP PS PLLGLKPLQLLE
VKARGRFGCVWKAQLLNEYVAVKI FP IQDKQSWQNEYEVYSL PGMKHEN
ILQFIGAEKRGTSVDVDLWL I TAFHEKGSLSDFLKANVVSWNELCHIAE
TMARGLAYLHEDI PGLKDGHKPAI SHRDIKSKNVLLKNNLTACIADFGL
ALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRI DMYAMGL
VLWELASRCTAADGPVDEYML PFEEEIGQHPSLEDMQEVVVHKKKRPVL
RDYWQKHAGMAMLCET I EECW DH DAEARLSAGCVGERI TQMQRLTN I IT
TEDIVTVVTMVTNVDFPPKESSL (SEQ ID NO: 1)
The signal peptide is single underlined; the extracellular domain is in bold
and the
potential N-linked glycosylation sites are double underlined.
The human ActRIla soluble (extracellular), processed polypeptide sequence is
as
follows:
ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNI SG
SIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKESYFP
EMEVTQPTSN PVT PKP P (SEQ ID NO: 2)
The C-terminal "tail" of the extracellular domain is underlined. The sequence
with
the "tail" deleted (a Al5 sequence) is as follows:
ILGRSETQECL FFNANWEKDRTNQTGVEPCYGDKDKRRHC FATWKNI SG
SIE IVKQGCWLDDINCYDRTDCVEKKDS PEVYFCCCEGNMCNEKFSYFP
EM (SEQ ID NO:3)
The nucleic acid sequence encoding human ActRIla precursor protein is as
follows(nucleotides 164-1705 of Genbank entry NM_001616):
ATGGGAGCTGCTGCAAAGTTGGCGTTTGCCGTCTTTCTTATCTCCTGTTCTTCAGGTGC
TATACTTGGTAGATCAGAAACTCAGGAGTGTCTTTTCTTTAATGCTAATTGGGAAAAAG
ACAGAACCAATCAAACTGGTGTTGAACCGTGTTATGGTGACAAAGATAAACGGCGGCAT
TGTTTTGCTACCTGGAAGAATATTTCTGGTTCCATTGAAATAGTGAAACAAGGTTGTTG
-16-
CA 02913992 2015-12-03
W02008/100384
PCT/US2008/001354
GCTGGATGATATCAACTGCTATGACAGGACTGATTGTGTAGAAAAAAAAGACAGCCCTG
AAGTATATTTTTGTTGCTGTGAGGGCAATATGTGTAATGAAAAGTTTTCTTATTTTCCA
GAGATGGAAGTCACACAGCCCACTTCAAATCCAGTTACACCTAAGCCACCCTATTACAA
CATCCTGCTCTATTCCTTGGTGCCACTTATGTTAATTGCGGGGATTGTCATTTGTGCAT
TTTGGGTGTACAGGCATCACAAGATGGCCTACCCTCCTGTACTTGTTCCAACTCAAGAC
CCAGGACCACCCCCACOTTCTCCATTACTAGGGTTGAAACCACTGCAGTTATTAGAAGT
GAAAGCAAGGGGAAGATTTGGTTGTGTCTGGAAAGCCCAGTTGCTTAACGAATATGTGG
CTGTCAAAATATTTCCAATACAGGACAAACAGTCATGGCAAAATGAATACGAAGTCTAC
AGTTTGCCTGGAATGAAGCATGAGAACATATTACAGTTCATTGGTGCAGAAAAACGAGG
CACCAGTGTTGATGTGGATCTTTGGCTGATCACAGCATTTCATGAAAAGGGTTCACTAT
CAGACTTTCTTAAGGCTAATGTGGTCTCTTGGAATGAACTGTGTCATATTGCAGAAACC
ATGGCTAGAGGATTGGCATATTTACATGAGGATATACCTGGCCTAAAAGATGGCCACAA
ACCTGCCATATCTCACAGGGACATCAAAAGTAAAAATGTGCTGTTGAAAAACAACCTGA
CAGCTTGCATTGCTGACTTTGGGTTGGCCTTAAAATTTGAGGCTGGCAAGTCTGCAGGC
GATACCCATGGACAGGTTGGTACCCGGAGGTACATGGCTCCAGAGGTATTAGAGGGTGC
TATAAACTTCCAAAGGGATGCATTTTTGAGGATAGATATGTATGCCATGGGATTAGTCC
TATGGGAACTGGCTTCTCGCTGTACTGCTGCAGATGGACCTGTAGATGAATACATGTTG
CCATTTGAGGAGGAAATTGGCCAGCATCCATCTCTTGAAGACATGCAGGAAGTTGTTGT
GCATAAAAAAAAGAGGCCTGTTTTAAGAGATTATTGGCAGAAACATGCTGGAATGGCAA
TGCTCTGTGAAACCATTGAAGAATGTTGGGATCACGACGCAGAAGCCAGGTTATCAGCT
GGATGTGTAGGTGAAAGAATTACCCAGATGCAGAGACTAACAAATATTATTACCACAGA
GGACATTGTAACAGTGGTCACAATGGTGACAAATGTTGACTTTCCTCCCAAAGAATCTA
GTCTATGA (SEQICINO:4)
The nucleic acid sequence encoding a human ActRIla soluble (extracellular)
polypeptide is as follows:
ATACTTGGTAGATCAGAAACTCAGGAGTGTCTTTTCTTTAATGCTAATTGGGAAAAAGA
CAGAACCAATCAAACTGGTGTTGAACCGTGTTATGGTGACAAAGATAAACGGCGGCATT
GTTTTGCTACCTGGAAGAATATTTCTGGTTCCATTGAAATAGTGAAACAAGGTTGTTGG
CTGGATGATATCAACTGCTATGACAGGACTGATTGTGTAGAAAAAAAAGACAGCCCTGA
AGTATATTTTTGTTGCTGTGAGGGCAATATGTGTAATGAAAAGTTTTCTTATTTTCCAG
AGATGGAAGTCACACAGCCCACTTCAAATCCAGTTACACCTAAGCCACCC (SEQED
NO: 5)
In a specific embodiment, the invention relates to soluble ActRIla
polypeptides. As
described herein, the term "soluble ActRIla polypeptide" generally refers to
polypeptides
comprising an extracellular domain of an ActRIla protein. The term "soluble
ActRIla
polypeptide," as used herein, includes any naturally occurring extracellular
domain of an
-17-
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
ActRIla protein as well as any variants thereof (including mutants, fragments
and
peptidomimetic forms). An activin-binding ActRlIa polypeptide is one that
retains the ability
to bind to activin, particularly activin AA, AB or BB. Preferably, an activin-
binding ActRlIa
polypeptide will bind to activin AA with a dissociation constant of 1 nM or
less. Amino acid
sequences of human ActRIla precursor protein is provided below. The
extracellular domain
of an ActRIla protein binds to activin and is generally soluble, and thus can
be termed a
soluble, activin-binding ActRIIa polypeptide. Examples of soluble, activin-
binding ActRIIa
polypeptides include the soluble polypeptide illustrated in SEQ ID NOs: 2, 3,
7, 12 and 13.
SEQ ID NO:7 is referred to as ActRIla-hFc, and is described further in the
Examples. Other
examples of soluble, activin-binding ActRIIa polypeptides comprise a signal
sequence in
addition to the extracellular domain of an ActRIla protein, for example, the
honey bee
mellitin leader sequence (SEQ ID NO: 8), the tissue plaminogen activator (TPA)
leader (SEQ
ID NO: 9) or the native ActRIIa leader (SEQ ID NO: 10). The ActRIla-hFc
polypeptide
illustrated in SEQ ID NO:13 uses a TPA leader.
Functionally active fragments of ActRIIa polypeptides can be obtained by
screening
polypeptides recombinantly produced from the corresponding fragment of the
nucleic acid
encoding an ActR1Ia polypeptide. In addition, fragments can be chemically
synthesized
using techniques known in the art such as conventional Merrifield solid phase
f-Moe or t-Boc
chemistry. The fragments can be produced (recombinantly or by chemical
synthesis) and
tested to identify those peptidyl fragments that can function as antagonists
(inhibitors) of
ActRIIa protein or signaling mediated by activin.
Functionally active variants of ActRITa polypeptides can be obtained by
screening
libraries of modified polypeptides recombinantly produced from the
corresponding
mutagenized nucleic acids encoding an ActRIla polypeptide. The variants can be
produced
and tested to identify those that can function as antagonists (inhibitors) of
ActRI1a protein or
signaling mediated by activin. In certain embodiments, a functional variant of
the ActRIIa
polypeptides comprises an amino acid sequence that is at least 75% identical
to an amino acid
sequence selected from SEQ ID NOs: 2 or 3. In certain cases, the functional
variant has an
amino acid sequence at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100%
identical to an
amino acid sequence selected from SEQ ID NOs: 2 or 3.
-18-
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
Functional variants may be generated by modifying the structure of an ActRIla
polypeptide for such purposes as enhancing therapeutic efficacy, or stability
(e.g., ex vivo
shelf life and resistance to proteolytic degradation in vivo). Such modified
ActRIla
polypeptides when selected to retain activin binding, are considered
functional equivalents of
the naturally-occurring ActRIla polypeptides. Modified ActRlIa polypeptides
can also be
produced, for instance, by amino acid substitution, deletion, or addition. For
instance, it is
reasonable to expect that an isolated replacement of a leucine with an
isoleucine or valine, an
aspartate with a glutamate, a threonine with a serine, or a similar
replacement of an amino
acid with a structurally related amino acid (e.g., conservative mutations)
will not have a
major effect on the biological activity of the resulting molecule.
Conservative replacements
are those that take place within a family of amino acids that are related in
their side chains.
Whether a change in the amino acid sequence of an ActRIla polypeptide results
in a
functional homolog can be readily determined by assessing the ability of the
variant ActRIla
polypeptide to produce a response in cells in a fashion similar to the wild-
type ActRlIa
polypeptide.
In certain embodiments, the present invention contemplates specific mutations
of the
ActRIla polypeptides so as to alter the glycosylation of the polypeptide. Such
mutations may
be selected so as to introduce or eliminate one or more glycosylation sites,
such as 0-linked
or N-linked glycosylation sites. Asparagine-linked glycosylation recognition
sites generally
comprise a tripeptide sequence, asparagine-X-threonine (or asparagines-X-
serine) (where
"X" is any amino acid) which is specifically recognized by appropriate
cellular glycosylation
enzymes. The alteration may also be made by the addition of, or substitution
by, one or more
serine or threonine residues to the sequence of the wild-type ActRIla
polypeptide (for 0-
linked glycosylation sites). A variety of amino acid substitutions or
deletions at one or both
of the first or third amino acid positions of a glycosylation recognition site
(and/or amino acid
deletion at the second position) results in non-glycosylation at the modified
tripeptide
sequence. Another means of increasing the number of carbohydrate moieties on
an ActRIla
polypeptide is by chemical or enzymatic coupling of glycosides to the ActRIla
polypeptide.
Depending on the coupling mode used, the sugar(s) may be attached to (a)
arginine and
histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those
of cysteine; (d)
free hydroxyl groups such as those of serine, threonine, or hydroxyproline;
(e) aromatic
residues such as those of phenylalanine, tyrosine, or tryptophan; or (0 the
amide group of
- 19-
CA 02913992 2015-12-03
glutamine. These methods are described in WO 87/05330 published Sep. 11, 1987,
and in
Aplin and Wriston (1981) CRC Crit. Rev. Biochem., pp. 259-306,
Removal of one or more carbohydrate moieties present on an ActRIla polypeptide
may be accomplished chemically and/or enzymatically. Chemical deglycosylation
may
involve, for example, exposure of the ActRIla polypeptide to the compound
trifluoromethanesulfonic acid, or an equivalent compound. This treatment
results in the
cleavage of most or all sugars except the linking sugar (N-acetylglucosamine
or N-
acetylgalactosamine), while leaving the amino acid sequence intact. Chemical
deglycosylation is further described by Hakimuddin et al. (1987) Arch.
Biochem. Biophys.
259:52 and by Edge et al. (1981) Anal. Biochem. 118:131. Enzymatic cleavage of
carbohydrate moieties on ActRIla polypeptides can be achieved by the use of a
variety of
endo- and exo-glycosidases as described by Thotakura et al. (1987) Meth.
Enzyrnol. 138:350.
The sequence of an ActRIla polypeptide may be adjusted, as appropriate,
depending on the
type of expression system used, as mammalian, yeast, insect and plant cells
may all introduce
differing glycosylation patterns that can be affected by the amino acid
sequence of the
peptide. In general, ActRIla proteins for use in humans will be expressed in a
mammalian
cell line that provides proper glycosylation, such as HEK293 or CHO cell
lines, although
other mammalian expression cell lines, yeast cell lines with engineered
glycosylation
enzymes and insect cells are expected to be useful as well.
This disclosure further contemplates a method of generating mutants,
particularly sets
of combinatorial mutants of an ActRIla polypeptide, as well as truncation
mutants; pools of
combinatorial mutants are especially useful for identifying functional variant
sequences. The
purpose of screening such combinatorial libraries may be to generate, for
example, ActRlIa
polypeptide variants which can act as either agonists or antagonist, or
alternatively, which
possess novel activities all together. A variety of screening assays are
provided below, and
such assays may be used to evaluate variants. For example, an ActRIla
polypeptide variant
may be screened for ability to bind to an ActRlIa ligand, to prevent binding
of an ActRlIa
ligand to an ActRIla polypeptide or to interfere with signaling caused by an
ActRIla ligand.
The activity of an ActRIla polypeptide or its variants may also be tested in a
cell-
based or in vivo assay. For example, the effect of an ActRIla polypeptide
variant on the
expression of genes involved in bone production or bone destruction may be
assessed. This
- 20 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
may, as needed, be performed in the presence of one or more recombinant
ActRIla ligand
proteins (e.g., activin), and cells may be transfected so as to produce an
ActRlIa polypeptide
and/or variants thereof, and optionally, an ActRIIa ligand. Likewise, an
ActRlIa polypeptide
may be administered to a mouse or other animal, and one or more bone
properties, such as
density or volume may be assessed. The healing rate for bone fractures may
also be
evaluated. Dual-energy x-ray absorptiometry (DEXA) is a well-established, non-
invasive,
quantitative technique for assessing bone density in an animal. In humans
central DEXA
systems may be used to evaluate bone density in the spine and pelvis. These
are the best
predictors of overall bone density. Peripheral DEXA systems may be used to
evaluate bone
density in peripheral bones, including, for example, the bones of the hand,
wrist, ankle and
foot. Traditional x-ray imaging systems, including CAT scans, may be used to
evaluate bone
growth and fracture healing. The mechanical strength of bone may also be
evaluated.
Combinatorially-derived variants can be generated which have a selective or
generally
increased potency relative to a naturally occurring ActRIIa polypeptide.
Likewise,
mutagenesis can give rise to variants which have intracellular half-lives
dramatically different
than the corresponding a wild-type ActRIIa polypeptide. For example, the
altered protein can
be rendered either more stable or less stable to proteolytic degradation or
other cellular
processes which result in destruction of, or otherwise inactivation of a
native ActRIIa
polypeptide. Such variants, and the genes which encode them, can be utilized
to alter
ActRIIa polypeptide levels by modulating the half-life of the ActRIIa
polypeptides. For
instance, a short half-life can give rise to more transient biological effects
and can allow
tighter control of recombinant ActRIIa polypeptide levels within the patient.
In an Fc fusion
protein, mutations may be made in the linker (if any) and/or the Fc portion to
alter the half-
life of the protein.
A combinatorial library may be produced by way of a degenerate library of
genes
encoding a library of polypeptides which each include at least a portion of
potential ActRIla
polypeptide sequences. For instance, a mixture of synthetic oligonucleotides
can be
enzymatically ligated into gene sequences such that the degenerate set of
potential ActRIla
polypeptide nucleotide sequences are expressible as individual polypeptides,
or alternatively,
as a set of larger fusion proteins (e.g., for phage display).
-21 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
There are many ways by which the library of potential homologs can be
generated
from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate
gene
sequence can be carried out in an automatic DNA synthesizer, and the synthetic
genes then be
ligated into an appropriate vector for expression. The synthesis of degenerate
oligonucleotides is well known in the art (see for example, Narang, SA (1983)
Tetrahedron
39:3; Itakura et al., (1981) Recombinant DNA, Proc. 3rd Cleveland Sympos.
Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp273-289; Itakura et al.,
(1984)
Annu. Rev. Biochem. 53:323; Itakura et al., (1984) Science 198:1056; Ike et
al., (1983)
Nucleic Acid Res. 11:477). Such techniques have been employed in the directed
evolution of
other proteins (see, for example, Scott et al., (1990) Science 249:386-390;
Roberts et al.,
(1992) PNAS USA 89:2429-2433; Devlin et al., (1990) Science 249: 404-406;
Cwirla et al.,
(1990) PNAS USA 87: 6378-6382; as well as U.S. Patent Nos: 5,223,409,
5,198,346, and
5,096,815).
Alternatively, other forms of mutagenesis can be utilized to generate a
combinatorial
library. For example, ActRIla polypeptide variants can be generated and
isolated from a
library by screening using, for example, alanine scanning mutagenesis and the
like (Ruf et al.,
(1994) Biochemistry 33:1565-1572; Wang et al., (1994) J. Biol. Chem. 269:3095-
3099;
Balint et al., (1993) Gene 137:109-118; Grodberg et al., (1993) Eur. J.
Biochem. 218:597-
601; Nagashima et al., (1993) J. Biol. Chem. 268:2888-2892; Lowman et al.,
(1991)
Biochemistry 30:10832-10838; and Cunningham et al., (1989) Science 244:1081-
1085), by
linker scanning mutagenesis (Gustin et al., (1993) Virology 193:653-660; Brown
et al.,
(1992) Mol. Cell Biol. 12:2644-2652; McKnight et al., (1982) Science 232:316);
by
saturation mutagenesis (Meyers et al., (1986) Science 232:613); by PCR
mutagenesis (Leung
et al., (1989) Method Cell Mol Biol 1:11-19); or by random mutagenesis,
including chemical
mutagenesis, etc. (Miller et al., (1992) A Short Course in Bacterial Genetics,
CSHL Press,
Cold Spring Harbor, NY; and Greener et al., (1994) Strategies in Mol Biol 7:32-
34). Linker
scanning mutagenesis, particularly in a combinatorial setting, is an
attractive method for
identifying truncated (bioactive) forms of ActRIla polypeptides.
A wide range of techniques are known in the art for screening gene products of
combinatorial libraries made by point mutations and truncations, and, for that
matter, for
screening cDNA libraries for gene products having a certain property. Such
techniques will
- 22 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
be generally adaptable for rapid screening of the gene libraries generated by
the
combinatorial mutagenesis of ActRIIa polypeptides. The most widely used
techniques for
screening large gene libraries typically comprises cloning the gene library
into replicable
expression vectors, transforming appropriate cells with the resulting library
of vectors, and
expressing the combinatorial genes under conditions in which detection of a
desired activity
facilitates relatively easy isolation of the vector encoding the gene whose
product was
detected. Preferred assays include activin binding assays and activin-mediated
cell signaling
assays.
In certain embodiments, the ActRIIa polypeptides of the invention may further
comprise post-translational modifications in addition to any that are
naturally present in the
ActRIla polypeptides. Such modifications include, but are not limited to,
acetylation,
carboxylation, glycosylation, phosphorylation, lipidation, and acylation. As a
result, the
modified ActRIla polypeptides may contain non-amino acid elements, such as
polyethylene
glycols, lipids, poly- or mono-saccharide, and phosphates. Effects of such non-
amino acid
elements on the functionality of a ActRIIa polypeptide may be tested as
described herein for
other ActRIIa polypeptide variants. When an ActRIIa polypeptide is produced in
cells by
cleaving a nascent form of the ActRIIa polypeptide, post-translational
processing may also be
important for correct folding and/or function of the protein. Different cells
(such as CHO,
HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293) have specific cellular machinery and
characteristic mechanisms for such post-translational activities and may be
chosen to ensure
the correct modification and processing of the ActRlIa polypeptides.
In certain aspects, functional variants or modified forms of the ActRIIa
polypeptides
include fusion proteins having at least a portion of the ActRIla polypeptides
and one or more
fusion domains. Well known examples of such fusion domains include, but are
not limited
to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin,
protein A, protein G,
an immunoglobulin heavy chain constant region (Fe), maltose binding protein
(MBP), or
human serum albumin. A fusion domain may be selected so as to confer a desired
property.
For example, some fusion domains are particularly useful for isolation of the
fusion proteins
by affinity chromatography. For the purpose of affinity purification, relevant
matrices for
affinity chromatography, such as glutathione-, amylase-, and nickel- or cobalt-
conjugated
resins are used. Many of such matrices are available in "kit" form, such as
the Pharmacia
-23-
CA 02913992 2015-12-03
WO 2008/100384
PCT/US2008/001354
GST purification system and the QIAexpressTm system (Qiagen) useful with
(HIS6) fusion
partners. As another example, a fusion domain may be selected so as to
facilitate detection of
the ActRIIa polypeptides. Examples of such detection domains include the
various
fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually
short peptide
sequences for which a specific antibody is available. Well known epitope tags
for which
specific monoclonal antibodies are readily available include FLAG, influenza
virus
haemagglutinin (HA), and c-myc tags. In some cases, the fusion domains have a
protease
cleavage site, such as for Factor Xa or Thrombin, which allows the relevant
protease to
partially digest the fusion proteins and thereby liberate the recombinant
proteins therefrom.
The liberated proteins can then be isolated from the fusion domain by
subsequent
chromatographic separation. In certain preferred embodiments, an ActRIla
polypeptide is
fused with a domain that stabilizes the ActRIla polypeptide in vivo (a
"stabilizer" domain).
By "stabilizing" is meant anything that increases serum half life, regardless
of whether this is
because of decreased destruction, decreased clearance by the kidney, or other
pharmacokinetic effect. Fusions with the Fc portion of an immunoglobulin are
known to
confer desirable pharmacokinetic properties on a wide range of proteins.
Likewise, fusions to
human serum albumin can confer desirable properties. Other types of fusion
domains that
may be selected include multimerizing (e.g., dimerizing, tetramerizing)
domains and
functional domains (that confer an additional biological function, such as
further stimulation
of bone growth or muscle growth, as desired).
As a specific example, the present invention provides a fusion protein
comprising a
soluble extracellular domain of ActRIla fused to an Fc domain (e.g., SEQ ID
NO: 6).
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD (A) VSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK (A) VSNKALPVPIEKTISKAK
GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
PFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN (A) HYTQKSLSLSPGK*
Optionally, the Fc domain has one or more mutations at residues such as Asp-
265,
lysine 322, and Asn-434. In certain cases, the mutant Fc domain having one or
more of these
mutations (e.g., Asp-265 mutation) has reduced ability of binding to the Fey
receptor relative
to a wildtype Fc domain. In other cases, the mutant Fc domain having one or
more of these
- 24 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
mutations (e.g., Asn-434 mutation) has increased ability of binding to the MHC
class I-
related Fe-receptor (FcRN) relative to a wildtype Fe domain.
It is understood that different elements of the fusion proteins may be
arranged in any
manner that is consistent with the desired functionality. For example, an
ActRIla polypeptide
may be placed C-terminal to a heterologous domain, or, alternatively, a
heterologous domain
may be placed C-terminal to an ActRIla polypeptide. The ActRIla polypeptide
domain and
the heterologous domain need not be adjacent in a fusion protein, and
additional domains or
amino acid sequences may be included C- or N-terminal to either domain or
between the
domains.
In certain embodiments, the ActRIla polypeptides of the present invention
contain one
or more modifications that are capable of stabilizing the ActRIla
polypeptides. For example,
such modifications enhance the in vitro half life of the ActRIla polypeptides,
enhance
circulatory half life of the ActRIla polypeptides or reduce proteolytic
degradation of the
ActRIIa polypeptides. Such stabilizing modifications include, but are not
limited to, fusion
proteins (including, for example, fusion proteins comprising an ActRIla
polypeptide and a
stabilizer domain), modifications of a glycosylation site (including, for
example, addition of a
glycosylation site to an ActRIIa polypeptide), and modifications of
carbohydrate moiety
(including, for example, removal of carbohydrate moieties from an ActRIla
polypeptide). In
the case of fusion proteins, an ActRfla polypeptide is fused to a stabilizer
domain such as an
IgG molecule (e.g., an Fe domain). As used herein, the term "stabilizer
domain" not only
refers to a fusion domain (e.g., Fe) as in the case of fusion proteins, but
also includes
nonproteinaceous modifications such as a carbohydrate moiety, or
nonproteinaceous
polymer, such as polyethylene glycol.
In certain embodiments, the present invention makes available isolated and/or
purified
forms of the ActRlIa polypeptides, which are isolated from, or otherwise
substantially free of,
other proteins. ActRIla polypeptides will generally be produced by expression
from
recombinant nucleic acids.
- 25 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
3. Nucleic Acids Encoding ActRlIa Polypeptides
In certain aspects, the invention provides isolated and/or recombinant nucleic
acids
encoding any of the ActRIIa polypeptides (e.g., soluble ActRIIa polypeptides),
including
fragments, functional variants and fusion proteins disclosed herein. For
example, SEQ ID
NO: 4 encodes the naturally occurring human ActRIla precursor polypeptide,
while SEQ ID
NO: 5 encodes the processed extracellular domain of ActRIIa. The subject
nucleic acids may
be single-stranded or double stranded. Such nucleic acids may be DNA or RNA
molecules.
These nucleic acids may be used, for example, in methods for making ActRIla
polypeptides
or as direct therapeutic agents (e.g., in a gene therapy approach).
In certain aspects, the subject nucleic acids encoding ActRIIa polypeptides
are further
understood to include nucleic acids that are variants of SEQ ID NO: 4 or 5.
Variant
nucleotide sequences include sequences that differ by one or more nucleotide
substitutions,
additions or deletions, such as allelic variants.
In certain embodiments, the invention provides isolated or recombinant nucleic
acid
sequences that are at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100%
identical to SEQ
ID NO: 4 or 5. One of ordinary skill in the art will appreciate that nucleic
acid sequences
complementary to SEQ ID NO: 4 or 5, and variants of SEQ ID NO: 4 or 5 are also
within the
scope of this invention. In further embodiments, the nucleic acid sequences of
the invention
can be isolated, recombinant, and/or fused with a heterologous nucleotide
sequence, or in a
DNA library.
In other embodiments, nucleic acids of the invention also include nucleotide
sequences that hybridize under highly stringent conditions to the nucleotide
sequence
designated in SEQ ID NO: 4 or 5, complement sequence of SEQ ID NO: 4 or 5, or
fragments
thereof. As discussed above, one of ordinary skill in the art will understand
readily that
appropriate stringency conditions which promote DNA hybridization can be
varied. One of
ordinary skill in the art will understand readily that appropriate stringency
conditions which
promote DNA hybridization can be varied. For example, one could perform the
hybridization at 6.0 x sodium chloride/sodium citrate (SSC) at about 45 C,
followed by a
wash of 2.0 x SSC at 50 C. For example, the salt concentration in the wash
step can be
selected from a low stringency of about 2.0 x SSC at 50 C to a high
stringency of about 0.2 x
SSC at 50 C. In addition, the temperature in the wash step can be increased
from low
- 26 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
stringency conditions at room temperature, about 22 C, to high stringency
conditions at
about 65 C. Both temperature and salt may be varied, or temperature or salt
concentration
may be held constant while the other variable is changed. In one embodiment,
the invention
provides nucleic acids which hybridize under low stringency conditions of 6 x
SSC at room
temperature followed by a wash at 2 x SSC at room temperature.
Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ
ID NOs:
4 or 5 due to degeneracy in the genetic code are also within the scope of the
invention. For
example, a number of amino acids are designated by more than one triplet.
Codons that
specify the same amino acid, or synonyms (for example, CAU and CAC are
synonyms for
histidine) may result in "silent" mutations which do not affect the amino acid
sequence of the
protein. However, it is expected that DNA sequence polymorphisms that do lead
to changes
in the amino acid sequences of the subject proteins will exist among mammalian
cells. One
skilled in the art will appreciate that these variations in one or more
nucleotides (up to about
3-5% of the nucleotides) of the nucleic acids encoding a particular protein
may exist among
individuals of a given species due to natural allelic variation. Any and all
such nucleotide
variations and resulting amino acid polymorphisms are within the scope of this
invention.
In certain embodiments, the recombinant nucleic acids of the invention may be
operably linked to one or more regulatory nucleotide sequences in an
expression construct.
Regulatory nucleotide sequences will generally be appropriate to the host cell
used for
expression. Numerous types of appropriate expression vectors and suitable
regulatory
sequences are known in the art for a variety of host cells. Typically, said
one or more
regulatory nucleotide sequences may include, but are not limited to, promoter
sequences,
leader or signal sequences, ribosomal binding sites, transcriptional start and
termination
sequences, translational start and termination sequences, and enhancer or
activator sequences.
Constitutive or inducible promoters as known in the art are contemplated by
the invention.
The promoters may be either naturally occurring promoters, or hybrid promoters
that
combine elements of more than one promoter. An expression construct may be
present in a
cell on an episome, such as a plasmid, or the expression construct may be
inserted in a
chromosome. In a preferred embodiment, the expression vector contains a
selectable marker
gene to allow the selection of transformed host cells. Selectable marker genes
are well
known in the art and will vary with the host cell used.
- 27 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
In certain aspects of the invention, the subject nucleic acid is provided in
an
expression vector comprising a nucleotide sequence encoding an ActRlIa
polypeptide and
operably linked to at least one regulatory sequence. Regulatory sequences are
art-recognized
and are selected to direct expression of the ActRIla polypeptide. Accordingly,
the term
regulatory sequence includes promoters, enhancers, and other expression
control elements.
Exemplary regulatory sequences are described in Goeddel; Gene Expression
Technology:
Methods in Enzymology, Academic Press, San Diego, CA (1990). For instance, any
of a wide
variety of expression control sequences that control the expression of a DNA
sequence when
operatively linked to it may be used in these vectors to express DNA sequences
encoding an
ActRIIa polypeptide. Such useful expression control sequences, include, for
example, the
early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus
immediate
early promoter, RSV promoters, the lac system, the trp system, the TAG or TRC
system, T7
promoter whose expression is directed by T7 RNA polymerase, the major operator
and
promoter regions of phage lambda , the control regions for fd coat protein,
the promoter for
3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid
phosphatase,
e.g., Pho5, the promoters of the yeast a-mating factors, the polyhedron
promoter of the
baculovirus system and other sequences known to control the expression of
genes of
prokaryotic or eukaryotic cells or their viruses, and various combinations
thereof. It should
be understood that the design of the expression vector may depend on such
factors as the
choice of the host cell to be transformed and/or the type of protein desired
to be expressed.
Moreover, the vector's copy number, the ability to control that copy number
and the
expression of any other protein encoded by the vector, such as antibiotic
markers, should also
be considered.
A recombinant nucleic acid of the invention can be produced by ligating the
cloned
gene, or a portion thereof, into a vector suitable for expression in either
prokaryotic cells,
eukaryotic cells (yeast, avian, insect or mammalian), or both. Expression
vehicles for
production of a recombinant ActRIla polypeptide include plasmids and other
vectors. For
instance, suitable vectors include plasmids of the types: pBR322-derived
plasmids, pEMBL-
derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived
plasmids
for expression in prokaryotic cells, such as E. co/i.
- 28 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
Some mammalian expression vectors contain both prokaryotic sequences to
facilitate
the propagation of the vector in bacteria, and one or more eukaryotic
transcription units that
are expressed in eukaryotic cells. The pcDNAI/amp, pcDNAI/neo, pRc/CMV,
pSV2gpt,
pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived
vectors
are examples of mammalian expression vectors suitable for transfection of
eukaryotic cells.
Some of these vectors are modified with sequences from bacterial plasmids,
such as pBR322,
to facilitate replication and drug resistance selection in both prokaryotic
and eukaryotic cells.
Alternatively, derivatives of viruses such as the bovine papilloma virus (BPV-
1), or Epstein-
Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression
of proteins
in eukaryotic cells. Examples of other viral (including retroviral) expression
systems can be
found below in the description of gene therapy delivery systems. The various
methods
employed in the preparation of the plasmids and in transformation of host
organisms are well
known in the art. For other suitable expression systems for both prokaryotic
and eukaryotic
cells, as well as general recombinant procedures, see Molecular Cloning A
Laboratory Manual, 3rd Ed., ed. by Sambrook, Fritsch and Maniatis (Cold Spring
Harbor
Laboratory Press, 2001). In some instances, it may be desirable to express the
recombinant
polypeptides by the use of a baculovirus expression system. Examples of such
baculovinis
expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and
pVL941),
pAcUW-derived vectors (such as pAcUW1), and pBlueBac-derived vectors (such as
the B-gal
containing pBlueBac III).
In a preferred embodiment, a vector will be designed for production of the
subject
ActRIIa polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene,
La Jolla,
Calif.), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pC1-neo vectors
(Promega,
Madison, Wisc.). As will be apparent, the subject gene constructs can be used
to cause
expression of the subject ActRIla polypeptides in cells propagated in culture,
e.g., to produce
proteins, including fusion proteins or variant proteins, for purification.
This disclosure also pertains to a host cell transfected with a recombinant
gene
including a coding sequence (e.g., SEQ ID NO: 4 or 5) for one or more of the
subject ActRIla
polypeptides. The host cell may be any prokaryotic or eukaryotic cell. For
example, an
ActRI la polypeptide of the invention may be expressed in bacterial cells such
as E. coli,
- 29 -
CA 02913992 2015-12-03
WO 2008/100384
PCT/US2008/001354
insect cells (e.g., using a baculovirus expression system), yeast, or
mammalian cells. Other
suitable host cells are known to those skilled in the art.
Accordingly, the present invention further pertains to methods of producing
the
subject ActRIla polypeptides. For example, a host cell transfected with an
expression vector
encoding an ActRIla polypeptide can be cultured under appropriate conditions
to allow
expression of the ActRIla polypeptide to occur. The ActRIla polypeptide may be
secreted
and isolated from a mixture of cells and medium containing the ActRIIa
polypeptide.
Alternatively, the ActRIla polypeptide may be retained cytoplasmically or in a
membrane
fraction and the cells harvested, lysed and the protein isolated. A cell
culture includes host
cells, media and other byproducts. Suitable media for cell culture are well
known in the art.
The subject ActRIla polypeptides can be isolated from cell culture medium,
host cells, or
both, using techniques known in the art for purifying proteins, including ion-
exchange
chromatography, gel filtration chromatography, ultrafiltration,
electrophoresis,
immunoaffinity purification with antibodies specific for particular epitopes
of the ActRIla
polypeptides and affinity purification with an agent that binds to a domain
fused to the
ActRlIa polypeptide (e.g., a protein A column may be used to purify an ActRIIa-
Fc fusion).
In a preferred embodiment, the ActRIla polypeptide is a fusion protein
containing a domain
which facilitates its purification. In a preferred embodiment, purification is
achieved by a
series of column chromatography steps, including, for example, three or more
of the
following, in any order: protein A chromatography, Q sepharose chromatography,
phenylsepharose chromatography, size exclusion chromatography, and cation
exchange
chromatography. The purification could be completed with viral filtration and
buffer
exchange. As demonstrated herein, ActRIIa-hFc protein was purified to a purity
of >98% as
. determined by size exclusion chromatography and >95% as determined by SDS
PAGE. This
level of purity was sufficient to achieve desirable effects on bone in mice
and an acceptable
safety profile in mice, rats and non-human primates.
In another embodiment, a fusion gene coding for a purification leader
sequence, such
as a poly-(1-lis)/enterokinase cleavage site sequence at the N-terminus of the
desired portion
of the recombinant ActRIla polypeptide, can allow purification of the
expressed fusion
protein by affinity chromatography using a Ni2+ metal resin. The purification
leader
sequence can then be subsequently removed by treatment with enterokinase to
provide the
-30-
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
purified ActRIla polypeptide (e.g., see Hochuli et al., (1987)J.
Chromatography 41 1 :1 77;
and Janknecht et al., PNAS USA 88:8972).
Techniques for making fusion genes are well known. Essentially, the joining of
various DNA fragments coding for different polypeptide sequences is performed
in
accordance with conventional techniques, employing blunt-ended or stagger-
ended termini
for ligation, restriction enzyme digestion to provide for appropriate termini,
filling-in of
cohesive ends as appropriate, alkaline phosphatase treatment to avoid
undesirable joining,
and enzymatic ligation. In another embodiment, the fusion gene can be
synthesized by
conventional techniques including automated DNA synthesizers. Alternatively,
PCR
amplification of gene fragments can be carried out using anchor primers which
give rise to
complementary overhangs between two consecutive gene fragments which can
subsequently
be annealed to generate a chimeric gene sequence (see, for example, Current
Protocols in
Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992).
4. Alternative Activin and ActRIla Antagonists
The data presented herein demonstrates that antagonists of activin-ActRIla
signaling
can be used to promote bone growth and bone mineralization. Although soluble
ActRIla
polypeptides, and particularly Actffla-Fc, are preferred antagonists, and
although such
antagonists may affect bone through a mechanism other than activin antagonism
(e.g., activin
inhibition may be an indicator of the tendency of an agent to inhibit the
activities of a
spectrum of molecules, including, perhaps, other members of the TGF-beta
superfamily, and
such collective inhibition may lead to the desired effect on bone), other
types of activin-
ActRIla antagonists are expected to be useful, including anti-activin (e.g.,
A, B, C or E)
antibodies, anti-ActRIla antibodies, antisense, RNAi or ribozyme nucleic acids
that inhibit
the production of ActRIla and other inhibitors of activin or ActRIla,
particularly those that
disrupt activin-ActRIla binding.
An antibody that is specifically reactive with an ActRIla polypeptide (e.g., a
soluble
ActRIla polypeptide) and which either binds competitively to ligand with the
ActRIla
polypeptide or otherwise inhibits ActRIla-mediated signaling may be used as an
antagonist of
ActR I la polypeptide activities. Likewise, an antibody that is specifically
reactive with an
activin A polypeptide and which disrupts ActRIla binding may be used as an
antagonist.
-3! -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
By using immunogens derived from an ActRlIa polypeptide or an activin
polypeptide,
anti-protein/anti-peptide antisera or monoclonal antibodies can be made by
standard protocols
(see, for example, Antibodies: A Laboratory Manual ed. by Harlow and Lane
(Cold Spring
Harbor Press: 1988)). A mammal, such as a mouse, a hamster or rabbit can be
immunized
with an immunogenic form of the ActRIla polypeptide, an antigenic fragment
which is
capable of eliciting an antibody response, or a fusion protein. Techniques for
conferring
immunogenicity on a protein or peptide include conjugation to carriers or
other techniques
well known in the art. An immunogenic portion of an ActRIIa or activin
polypeptide can be
administered in the presence of adjuvant. The progress of immunization can be
monitored by
detection of antibody titers in plasma or serum. Standard ELISA or other
immunoassays can
be used with the immunogen as antigen to assess the levels of antibodies.
Following immunization of an animal with an antigenic preparation of an
ActRIla
polypeptide, antisera can be obtained and, if desired, polyclonal antibodies
can be isolated
from the serum. To produce monoclonal antibodies, antibody-producing cells
(lymphocytes)
can be harvested from an immunized animal and fused by standard somatic cell
fusion
procedures with immortalizing cells such as myeloma cells to yield hybridoma
cells. Such
techniques are well known in the art, and include, for example, the hybridoma
technique
(originally developed by Kohler and Milstein, (1975) Nature, 256: 495-497),
the human B
cell hybridoma technique (Kozbar et al., (1983) Immunology Today, 4: 72), and
the EBV-
hybridoma technique to produce human monoclonal antibodies (Cole et al.,
(1985)
Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc. pp. 77-96).
Hybridoma cells
can be screened immunochemically for production of antibodies specifically
reactive with an
ActRIIa polypeptide and monoclonal antibodies isolated from a culture
comprising such
hybridoma cells.
The term "antibody" as used herein is intended to include fragments thereof
which are
also specifically reactive with a subject polypeptide. Antibodies can be
fragmented using
conventional techniques and the fragments screened for utility in the same
manner as
described above for whole antibodies. For example, F(ab)2 fragments can be
generated by
treating antibody with pepsin. The resulting F(ab)2 fragment can be treated to
reduce
disulfide bridges to produce Fab fragments. The antibody of the present
invention is further
intended to include bispecific, single-chain, chimeric, humanized and fully
human molecules
- 32 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
having affinity for an ActRIla or activin polypeptide conferred by at least
one CDR region of
the antibody. An antibody may further comprise a label attached thereto and
able to be
detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme
or enzyme co-
factor).
In certain embodiments, the antibody is a recombinant antibody, which term
encompasses any antibody generated in part by techniques of molecular biology,
including
CDR-grafted or chimeric antibodies, human or other antibodies assembled from
library-
selected antibody domains, single chain antibodies and single domain
antibodies (e.g., human
VH proteins or camelid VHH proteins). In certain embodiments, an antibody of
the invention
is a monoclonal antibody, and in certain embodiments, the invention makes
available
methods for generating novel antibodies. For example, a method for generating
a
monoclonal antibody that binds specifically to an ActRIla polypeptide or
activin polypeptide
may comprise administering to a mouse an amount of an immunogenic composition
comprising the antigen polypeptide effective to stimulate a detectable immune
response,
obtaining antibody-producing cells (e.g., cells from the spleen) from the
mouse and fusing the
antibody-producing cells with myeloma cells to obtain antibody-producing
hybridomas, and
testing the antibody-producing hybridomas to identify a hybridoma that
produces a
monocolonal antibody that binds specifically to the antigen. Once obtained, a
hybridoma can
be propagated in a cell culture, optionally in culture conditions where the
hybridoma-derived
cells produce the monoclonal antibody that binds specifically to the antigen.
The monoclonal
antibody may be purified from the cell culture.
The adjective "specifically reactive with" as used in reference to an antibody
is
intended to mean, as is generally understood in the art, that the antibody is
sufficiently
selective between the antigen of interest (e.g., an ActRIla polypeptide) and
other antigens that
are not of interest that the antibody is useful for, at minimum, detecting the
presence of the
antigen of interest in a particular type of biological sample. In certain
methods employing the
antibody, such as therapeutic applications, a higher degree of specificity in
binding may be
desirable. Monoclonal antibodies generally have a greater tendency (as
compared to
polyclonal antibodies) to discriminate effectively between the desired
antigens and cross-
reacting polypeptides. One characteristic that influences the specificity of
an
antibody:antigen interaction is the affinity of the antibody for the antigen.
Although the
- 33 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
desired specificity may be reached with a range of different affinities,
generally preferred
antibodies will have an affinity (a dissociation constant) of about 10-6, 10-
7, le, I e or less.
Given the extraordinarily tight binding between activin and ActRIla, it is
expected that a
neutralizing anti-activin or anti-ActRIla antibody would generally have a
dissociation
constant of 10-1 or less.
In addition, the techniques used to screen antibodies in order to identify a
desirable
antibody may influence the properties of the antibody obtained. For example,
if an antibody
is to be used for binding an antigen in solution, it may be desirable to test
solution binding. A
variety of different techniques are available for testing interaction between
antibodies and
antigens to identify particularly desirable antibodies. Such techniques
include ELISAs,
surface plasmon resonance binding assays (e.g., the BiacoreTm binding assay,
Biacore AB,
Uppsala, Sweden), sandwich assays (e.g., the paramagnetic bead system of IGEN
International, Inc., Gaithersburg, Maryland), western blots,
immunoprecipitation assays, and
immunohistochemistry.
Examples of categories of nucleic acid compounds that are activin or ActRIIa
antagonists include antisense nucleic acids, RNAi constructs and catalytic
nucleic acid
constructs. A nucleic acid compound may be single or double stranded. A double
stranded
compound may also include regions of overhang or non-complementarity, where
one or the
other of the strands is single stranded. A single stranded compound may
include regions of
self-complementarity, meaning that the compound forms a so-called "hairpin" or
"stem-loop"
structure, with a region of double helical structure. A nucleic acid compound
may comprise a
nucleotide sequence that is complementary to a region consisting of no more
than 1000, no
more than 500, no more than 250, no more than 100 or no more than 50, 35, 30,
25, 22, 20 or
18 nucleotides of the full-length ActRlIa nucleic acid sequence or activin I3A
or activin r3B
nucleic acid sequence. The region of complementarity will preferably be at
least 8
nucleotides, and optionally at least 10 or at least 15 nucleotides, and
optionally between 15
and 25 nucleotides. A region of complementarity may fall within an intron, a
coding
sequence or a noncoding sequence of the target transcript, such as the coding
sequence
portion. Generally, a nucleic acid compound will have a length of about 8 to
about 500
nucleotides or base pairs in length, and optionally the length will be about
14 to about 50
nucleotides. A nucleic acid may be a DNA (particularly for use as an
antisense), RNA or
- 34 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
RNA:DNA hybrid. Any one strand may include a mixture of DNA and RNA, as well
as
modified forms that cannot readily be classified as either DNA or RNA.
Likewise, a double
stranded compound may be DNA:DNA, DNA:RNA or RNA:RNA, and any one strand may
also include a mixture of DNA and RNA, as well as modified forms that cannot
readily be
classified as either DNA or RNA. A nucleic acid compound may include any of a
variety of
modifications, including one or modifications to the backbone (the sugar-
phosphate portion
in a natural nucleic acid, including intemucleotide linkages) or the base
portion (the purine or
pyrimidine portion of a natural nucleic acid). An antisense nucleic acid
compound will
preferably have a length of about 15 to about 30 nucleotides and will often
contain one or
more modifications to improve characteristics such as stability in the serum,
in a cell or in a
place where the compound is likely to be delivered, such as the stomach in the
case of orally
delivered compounds and the lung for inhaled compounds. In the case of an RNAi
construct,
the strand complementary to the target transcript will generally be RNA or
modifications
thereof. The other strand may be RNA, DNA or any other variation. The duplex
portion of
double stranded or single stranded "hairpin" RNAi construct will preferably
have a length of
18 to 40 nucleotides in length and optionally about 21 to 23 nucleotides in
length, so long as
it serves as a Dicer substrate. Catalytic or enzymatic nucleic acids may be
ribozymes or
DNA enzymes and may also contain modified forms. Nucleic acid compounds may
inhibit
expression of the target by about 50%, 75%, 90% or more when contacted with
cells under
physiological conditions and at a concentration where a nonsense or sense
control has little or
no effect. Preferred concentrations for testing the effect of nucleic acid
compounds are 1, 5
and 10 micromolar. Nucleic acid compounds may also be tested for effects on,
for example,
bone growth and mineralization.
5. Screening Assays
In certain aspects, the present invention relates to the use of ActRIla
polypeptides
(e.g., soluble ActRIla polypeptides) and activin polypeptides to identify
compounds (agents)
which are agonist or antagonists of the activin-ActRlia signaling pathway.
Compounds
identified through this screening can be tested to assess their ability to
modulate bone growth
or mineralization in vitro. Optionally, these compounds can further be tested
in animal
models to assess their ability to modulate tissue growth in vivo.
- 35 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
There are numerous approaches to screening for therapeutic agents for
modulating
tissue growth by targeting activin and ActRIla polypeptides. In certain
embodiments, high-
throughput screening of compounds can be carried out to identify agents that
perturb activin
or ActRIla-mediated effects on bone. In certain embodiments, the assay is
carried out to
screen and identify compounds that specifically inhibit or reduce binding of
an ActRIla
polypeptide to activin. Alternatively, the assay can be used to identify
compounds that
enhance binding of an ActRIla polypeptide to activin. In a further embodiment,
the
compounds can be identified by their ability to interact with an activin or
ActRIla
polypeptide.
A variety of assay formats will suffice and, in light of the present
disclosure, those not
expressly described herein will nevertheless be comprehended by one of
ordinary skill in the
art. As described herein, the test compounds (agents) of the invention may be
created by any
combinatorial chemical method. Alternatively, the subject compounds may be
naturally
occurring biomolecules synthesized in vivo or in vitro. Compounds (agents) to
be tested for
their ability to act as modulators of tissue growth can be produced, for
example, by bacteria,
yeast, plants or other organisms (e.g., natural products), produced chemically
(e.g., small
molecules, including peptidomimetics), or produced recombinantly. Test
compounds
contemplated by the present invention include non-peptidyl organic molecules,
peptides,
polypeptides, peptidomimetics, sugars, hormones, and nucleic acid molecules.
In a specific
embodiment, the test agent is a small organic molecule having a molecular
weight of less
than about 2,000 daltons.
The test compounds of the invention can be provided as single, discrete
entities, or
provided in libraries of greater complexity, such as made by combinatorial
chemistry. These
libraries can comprise, for example, alcohols, alkyl halides, amines, amides,
esters,
aldehydes, ethers and other classes of organic compounds. Presentation of test
compounds to
the test system can be in either an isolated form or as mixtures of compounds,
especially in
initial screening steps. Optionally, the compounds may be optionally
derivatized with other
compounds and have derivatizing groups that facilitate isolation of the
compounds. Non-
limiting examples of derivatizing groups include biotin, fluorescein,
digoxygenin, green
fluorescent protein, isotopes, polyhistidine, magnetic beads, glutathione S
transferase (GST),
photoactivatible crosslinkers or any combinations thereof.
-36-
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
In many drug screening programs which test libraries of compounds and natural
extracts, high throughput assays are desirable in order to maximize the number
of compounds
surveyed in a given period of time. Assays which are performed in cell-free
systems, such as
may be derived with purified or semi-purified proteins, are often preferred as
"primary"
screens in that they can be generated to permit rapid development and
relatively easy
detection of an alteration in a molecular target which is mediated by a test
compound.
Moreover, the effects of cellular toxicity or bioavailability of the test
compound can be
generally ignored in the in vitro system, the assay instead being focused
primarily on the
effect of the drug on the molecular target as may be manifest in an alteration
of binding
affinity between an ActRIIa polypeptide and activin.
Merely to illustrate, in an exemplary screening assay of the present
invention, the
compound of interest is contacted with an isolated and purified ActRIIa
polypeptide which is
ordinarily capable of binding to activin. To the mixture of the compound and
ActRIIa
polypeptide is then added a composition containing an ActRIIa ligand.
Detection and
quantification of ActRIla/activin complexes provides a means for determining
the
compound's efficacy at inhibiting (or potentiating) complex formation between
the ActRIIa
polypeptide and activin. The efficacy of the compound can be assessed by
generating dose
response curves from data obtained using various concentrations of the test
compound.
Moreover, a control assay can also be performed to provide a baseline for
comparison. For
example, in a control assay, isolated and purified activin is added to a
composition containing
the ActRIla polypeptide, and the formation of ActRIIa/activin complex is
quantitated in the
absence of the test compound. It will be understood that, in general, the
order in which the
reactants may be admixed can be varied, and can be admixed simultaneously.
Moreover, in
place of purified proteins, cellular extracts and lysates may be used to
render a suitable cell-
free assay system.
Complex formation between the ActRIla polypeptide and activin may be detected
by
a variety of techniques. For instance, modulation of the formation of
complexes can be
quantitated using, for example, detectably labeled proteins such as
radiolabeled (e.g., 32P, 35S,
14C or 3H), fluorescently labeled (e.g., FITC), or enzymatically labeled
ActRIla polypeptide
or activin, by immunoassay, or by chromatographic detection.
- 37 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
In certain embodiments, the present invention contemplates the use of
fluorescence
polarization assays and fluorescence resonance energy transfer (FRET) assays
in measuring,
either directly or indirectly, the degree of interaction between an ActRlIa
polypeptide and its
binding protein. Further, other modes of detection, such as those based on
optical
waveguides (PCT Publication WO 96/26432 and U.S. Pat. No. 5,677,196), surface
plasmon
resonance (SPR), surface charge sensors, and surface force sensors, are
compatible with
many embodiments of the invention.
Moreover, the present invention contemplates the use of an interaction trap
assay, also
known as the "two hybrid assay," for identifying agents that disrupt or
potentiate interaction
between an ActRIla polypeptide and its binding protein. See for example, U.S.
Pat. No.
5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J Biol
Chem
268:12046-12054; Bartel et al. (1993) Biotechniques 14:920-924; and Iwabuchi
et al. (1993)
Oncogene 8:1693-1696). In a specific embodiment, the present invention
contemplates the
use of reverse two hybrid systems to identify compounds (e.g., small molecules
or peptides)
that dissociate interactions between an ActRITa polypeptide and its binding
protein. See for
example, Vidal and Legrain, (1999) Nucleic Acids Res 27:919-29; Vidal and
Legrain, (1999)
Trends Biotechnol 17:374-81; and U.S. Pat. Nos. 5,525,490; 5,955,280; and
5,965,368.
In certain embodiments, the subject compounds are identified by their ability
to
interact with an ActRIla or activin polypeptide of the invention. The
interaction between the
compound and the ActRIIa or activin polypeptide may be covalent or non-
covalent. For
example, such interaction can be identified at the protein level using in
vitro biochemical
methods, including photo-crosslinking, radiolabeled ligand binding, and
affinity
chromatography (Jakoby WB et al., 1974, Methods in Enzymology 46: 1), In
certain cases,
the compounds may be screened in a mechanism based assay, such as an assay to
detect
compounds which bind to an activin or ActRIIa polypeptide. This may include a
solid phase
or fluid phase binding event. Alternatively, the gene encoding an activin or
ActRIla
polypeptide can be transfected with a reporter system (e.g., [3-galactosidase,
luciferase, or
green fluorescent protein) into a cell and screened against the library
preferably by a high
throughput screening or with individual members of the library. Other
mechanism based
binding assays may be used, for example, binding assays which detect changes
in free
energy. Binding assays can be performed with the target fixed to a well, bead
or chip or
- 38 -
CA 02913992 2015-12-03
WO 2008/100384
PCT/US2008/001354
captured by an immobilized antibody or resolved by capillary electrophoresis.
The bound
compounds may be detected usually using colorimetric or fluorescence or
surface plasmon
resonance.
In certain aspects, the present invention provides methods and agents for
modulating
(stimulating or inhibiting) bone formation and increasing bone mass.
Therefore, any
compound identified can be tested in whole cells or tissues, in vitro or in
vivo, to confirm
their ability to modulate bone growth or mineralization. Various methods known
in the art
can be utilized for this purpose.
For example, the effect of the ActRIla or activin polypeptides or test
compounds on
bone or cartilage growth can be determined by measuring induction of Msx2 or
differentiation of osteoprogenitor cells into osteoblasts in cell based assays
(see, e.g., Daluiski
et al., Nat Genet. 2001, 27(1):84-8; Hino etal., Front Biosci. 2004, 9:1520-
9). Another
example of cell-based assays includes analyzing the osteogenic activity of the
subject
ActRIla or activin polypeptides and test compounds in mesenchymal progenitor
and
osteoblastic cells. To illustrate, recombinant adenoviruses expressing an
activin or ActRlIa
polypeptide can be constructed to infect pluripotent mesenchymal progenitor
C3H10T1/2
cells, preosteoblastic C2C12 cells, and osteoblastic TE-85 cells. Osteogenic
activity is then
determined by measuring the induction of alkaline phosphatase, osteocalcin,
and matrix
mineralization (see, e.g., Cheng et al., J bone Joint Surg Am. 2003, 85-
A(8):1544-52).
The present invention also contemplates in vivo assays to measure bone or
cartilage
growth. For example, Namkung-Matthai et al., Bone, 28:80-86 (2001) discloses a
rat
osteoporotic model in which bone repair during the early period after fracture
is studied.
Kubo et al., Steroid Biochemistry & Molecular Biology, 68:197-202 (1999) also
discloses a
rat osteoporotic model in which bone repair during the late period after
fracture is studied.
Andersson et al., J. Endocrinol. 170:529-537 describe a mouse osteoporosis
model in which
mice are ovariectomized, which causes the mice to lose substantial bone
mineral content and
bone mineral density, with the trabecular bone losing roughly 50% of bone
mineral density.
Bone density could be increased in the ovariectomized mice by administration
of factors such
as parathyroid hormone. In certain aspects, the present invention makes use of
fracture
healing assays that are known in the art. These assays include fracture
technique, histological
analysis, and biomechanical analysis, which are described in, for example,
U.S. Pat. No.
- 39 -
CA 02913992 2015-12-03
6,521,750.
6. Exemplary Therapeutic Uses
In certain embodiments, activin-ActRIIa antagonists (e.g., ActRIIa
polypeptides) of
the present invention can be used for treating or preventing a disease or
condition that is
associated with bone damage, whether, e.g., through breakage, loss or
demineralization. As
demonstrated herein, activin-ActRlIa antagonists, and particularly ActRlIa-Fc
constructs, are
effective in treating or preventing cancer-related bone loss. In certain
embodiments, the
present invention provides methods of treating or preventing bone damage in an
individual in
need thereof through administering to the individual a therapeutically
effective amount of an
activin-ActRIIa antagonist, particularly an ActRIIa polypeptide. In certain
embodiments, the
present invention provides methods of promoting bone growth or mineralization
in an
individual in need thereof through administering to the individual a
therapeutically effective
amount of an activin-ActRIla antagonist, particularly an ActRIla polypeptide.
These
methods are preferably aimed at therapeutic and prophylactic treatments of
animals, and
more preferably, humans. In certain embodiments, the disclosure provides for
the use of
activin-ActRIIa antagonists (particularly soluble ActRlIa polypeptides and
neutralizing
antibodies targeted to activin or ActRIla) for the treatment of disorders
associated with low
bone density or decreased bone strength.
As used herein, a therapeutic that "prevents" a disorder or condition refers
to a
compound that, in a statistical sample, reduces the occurrence of the disorder
or condition in
the treated sample relative to an untreated control sample, or delays the
onset or reduces the
severity of one or more symptoms of the disorder or condition relative to the
untreated
control sample. The ten-n "treating" as used herein includes prophylaxis of
the named
condition or amelioration or elimination of the condition once it has been
established. In
either case, prevention or treatment may be discerned in the diagnosis
provided by a
physician and the intended result of administration of the therapeutic agent.
The disclosure provides methods of inducing bone and/or cartilage formation,
preventing bone loss, increasing bone mineralization or preventing the
demineralization of
bone. For example, the subject activin-ActRI la antagonists have application
in treating
- 40 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
osteoporosis and the healing of bone fractures and cartilage defects in humans
and other
animals. ActRIla or activin polypeptides may be useful in patients that are
diagnosed with
subclinical low bone density, as a protective measure against the development
of
osteoporosis.
In one specific embodiment, methods and compositions of the present invention
may
find medical utility in the healing of bone fractures and cartilage defects in
humans and other
animals. The subject methods and compositions may also have prophylactic use
in closed as
well as open fracture reduction and also in the improved fixation of
artificial joints. De novo
bone formation induced by an osteogenic agent contributes to the repair of
congenital,
trauma-induced, or oncologic resection induced craniofacial defects, and also
is useful in
cosmetic plastic surgery. In certain cases, the subject activin-ActRIla
antagonists may
provide an environment to attract bone-forming cells, stimulate growth of bone-
forming cells
or induce differentiation of progenitors of bone-forming cells. Activin-
ActRIla antagonists
of the invention may also be useful in the treatment of osteoporosis.
Methods and compositions of the invention can be applied to conditions
characterized
by or causing bone loss, such as osteoporosis (including secondary
osteoporosis),
hyperparathyroidism, Cushing's disease, Paget's disease, thyrotoxicosis,
chronic diarrheal
state or malabsorption, renal tubular acidosis, or anorexia nervosa.
Osteoporosis may be caused by, or associated with, various factors. Being
female,
particularly a post-menopausal female, having a low body weight, and leading a
sedentary
lifestyle are all risk factors for osteoporosis (loss of bone mineral density,
leading to fracture
risk). Persons having any of the following profiles may be candidates for
treatment with an
ActRI Ia antagonist: a post-menopausal woman and not taking estrogen or other
hormone
replacement therapy; a person with a personal or maternal history of hip
fracture or smoking;
a post-menopausal woman who is tall (over 5 feet 7 inches) or thin (less than
125 pounds); a
man with clinical conditions associated with bone loss; a person using
medications that are
known to cause bone loss, including corticosteroids such as PrednisoneTM,
various anti-
seizure medications such as DilantinTm and certain barbiturates, or high-dose
thyroid
replacement drugs; a person having type I diabetes, liver disease, kidney
disease or a family
history of osteoporosis; a person having high bone turnover (e.g., excessive
collagen in urine
samples); a person with a thyroid condition, such as hyperthyroidism; a person
who has
-41 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
experienced a fracture after only mild trauma; a person who has had x-ray
evidence of
vertebral fracture or other signs of osteoporosis.
As noted above, osteoporosis can also result as a condition associated with
another
disorder or from the use of certain medications. Osteoporosis resulting from
drugs or another
medical condition is known as secondary osteoporosis. In a condition known as
Cushing's
disease, the excess amount of cortisol produced by the body results in
osteoporosis and
fractures. The most common medications associated with secondary osteoporosis
are the
corticosteroids, a class of drugs that act like cortisol, a hormone produced
naturally by the
adrenal glands. Although adequate levels of thyroid hormones (which are
produced by the
thyroid gland) are needed for the development of the skeleton, excess thyroid
hormone can
decrease bone mass over time. Antacids that contain aluminum can lead to bone
loss when
taken in high doses by people with kidney problems, particularly those
undergoing dialysis.
Other medications that can cause secondary osteoporosis include phenytoin
(Dilantin) and
barbiturates that are used to prevent seizures; methotrexate (Rheumatrex,
Immunex, Folex
PFS), a drug for some forms of arthritis, cancer, and immune disorders;
cyclosporine
(Sandimmune, Neoral), a drug used to treat some autoimmune diseases and to
suppress the
immune system in organ transplant patients; luteinizing hormone-releasing
hormone agonists
(Lupron, Zoladex), used to treat prostate cancer and endometriosis; heparin
(Calciparine,
Liquaemin), an anticlotting medication; and cholestyramine (Questran) and
colestipol
(Colestid), used to treat high cholesterol. Bone loss resulting from cancer
therapy is widely
recognized and termed cancer therapy induced bone loss (CTIBL). Bone
metastases can
create cavities in the bone that may be corrected by treatment with activin-
ActRIla
antagonists.
In a preferred embodiment, activin-ActRIla antagonists, particularly a soluble
ActRIla, disclosed herein may be used in cancer patients. Patients having
certain tumors (e.g.
prostate, breast, multiple myeloma or any tumor causing hyperparathyroidism)
are at high
risk for bone loss due to tumor-induced bone loss as well as bone metastases
and therapeutic
agents. Such patients may be treated with activin-ActRIla antagonists even in
the absence of
evidence of bone loss or bone metastases. Patients may also be monitored for
evidence of
bone loss or bone metastases, and may be treated with activin-ActRIla
antagonists in the
event that indicators suggest an increased risk. Generally, DEXA scans are
employed to
- 42 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
assess changes in bone density, while indicators of bone remodeling may be
used to assess
the likelihood of bone metastases. Serum markers may be monitored. Bone
specific alkaline
phosphatase (BSAP) is an enzyme that is present in osteoblasts. Blood levels
of BSAP are
increased in patients with bone metastasis and other conditions that result in
increased bone
remodeling. Osteocalcin and procollagen peptides are also associated with bone
formation
and bone metastases. Increases in BSAP have been detected in patients with
bone metastasis
caused by prostate cancer, and to a lesser degree, in bone metastases from
breast cancer.
Bone Morphogenetic Protein-7 (BMP-7) levels are high in prostate cancer that
has
metastasized to bone, but not in bone metastases due to bladder, skin, liver,
or lung cancer.
Type I Carboxy-terminal telopeptide (ICTP) is a crosslink found in collagen
that is formed
during to the resorption of bone. Since bone is constantly being broken down
and reformed,
ICTP will be found throughout the body. However, at the site of bone
metastasis, the level
will be significantly higher than in an area of normal bone. ICTP has been
found in high
levels in bone metastasis due to prostate, lung, and breast cancer. Another
collagen crosslink,
Type I N-terminal telopeptide (NTx), is produced along with ICTP during bone
turnover. The
amount of NTx is increased in bone metastasis caused by many different types
of cancer
including lung, prostate, and breast cancer. Also, the levels of NTx increase
with the
progression of the bone metastasis. Therefore, this marker can be used to both
detect
metastasis as well as measure the extent of the disease. Other markers of
resorption include
pyridinoline and deoxypyridinoline. Any increase in resorption markers or
markers of bone
metastases indicate the need for activin-ActRIIa antagonist therapy in a
patient.
Activin-ActRIIa antagonists may be conjointly administered with other
pharmaceutical agents. Conjoint administration may be accomplished by
administration of a
single co-formulation, by simultaneous administration or by administration at
separate times.
Activin-ActRIIa antagonists may be particularly advantageous if administered
with other
bone-active agents. A patient may benefit from conjointly receiving activin-
ActRlIa
antagonist and taking calcium supplements, vitamin D, appropriate exercise
and/or, in some
cases, other medication. Examples of other medications incude, bisphosphonates
(alendronate, ibandronate and risedronate), calcitonin, estrogens, parathyroid
hormone and
raloxifene. The bisphosphonates (alendronate, ibandronate and risedronate),
calcitonin,
estrogens and raloxifene affect the bone remodeling cycle and are classified
as anti-resorptive
medications. Bone remodeling consists of two distinct stages: bone resorption
and bone
- 43 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
formation. Anti-resorptive medications slow or stop the bone-resorbing portion
of the bone-
remodeling cycle but do not slow the bone-forming portion of the cycle. As a
result, new
formation continues at a greater rate than bone resorption, and bone density
may increase
over time. Teriparatide, a form of parathyroid hormone, increases the rate of
bone formation
in the bone remodeling cycle. Alendronate is approved for both the prevention
(5 mg per day
or 35 mg once a week) and treatment (10 mg per day or 70 mg once a week) of
postmenopausal osteoporosis. Alendronate reduces bone loss, increases bone
density and
reduces the risk of spine, wrist and hip fractures. Alendronate also is
approved for treatment
of glucocorticoid-induced osteoporosis in men and women as a result of long-
term use of
these medications (i.e., prednisone and cortisone) and for the treatment of
osteoporosis in
men. Alendronate plus vitamin D is approved for the treatment of osteoporosis
in
postmenopausal women (70 mg once a week plus vitamin D), and for treatment to
improve
bone mass in men with osteoporosis. lbandronate is approved for the prevention
and
treatment of postmenopausal osteoporosis. Taken as a once-a-month pill (150
mg), =
ibandronate should be taken on the same day each month. lbandronate reduces
bone loss,
increases bone density and reduces the risk of spine fractures. Risedronate is
approved for
the prevention and treatment of postmenopausal osteoporosis.. Taken daily (5
mg dose) or
weekly (35 mg dose or 35 mg dose with calcium), risedronate slows bone loss,
increases
bone density and reduces the risk of spine and non-spine fractures.
Risedronate also is
approved for use by men and women to prevent and/or treat glucocorticoid-
induced
osteoporosis that results from long-term use of these medications (i.e.,
prednisone or
cortisone). Calcitonin is a naturally occurring hormone involved in calcium
regulation and
bone metabolism. In women who are more than 5 years beyond menopause,
calcitonin slows
bone loss, increases spinal bone density, and may relieve the pain associated
with bone
fractures. Calcitonin reduces the risk of spinal fractures. Calcitonin is
available as an
injection (50-100 IU daily) or nasal spray (200 111 daily). Estrogen therapy
(ET)/Hon-none
therapy (HT) is approved for the prevention of osteoporosis. ET has been shown
to reduce
bone loss, increase bone density in both the spine and hip, and reduce the
risk of hip and
spinal fractures in postmenopausal women. ET is administered most commonly in
the form of
a pill or skin patch that delivers a low dose of approximately 0.3 mg daily or
a standard dose
of approximately 0.625 mg daily and is effective even when started after age
70. When
estrogen is taken alone, it can increase a woman's risk of developing cancer
of the uterine
- 44 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
lining (endometrial cancer). To eliminate this risk, healthcare providers
prescribe the
hormone progestin in combination with estrogen (hormone replacement therapy or
HT) for
those women who have an intact uterus. ET/HT relieves menopause symptoms and
has been
shown to have a beneficial effect on bone health. Side effects may include
vaginal bleeding,
breast tenderness, mood disturbances and gallbladder disease. Raloxifene, 60
mg a day, is
approved for the prevention and treatment of postmenopausal osteoporosis. It
is from a class
of drugs called Selective Estrogen Receptor Modulators (SERMs) that have been
developed
to provide the beneficial effects of estrogens without their potential
disadvantages.
Raloxifene increases bone mass and reduces the risk of spine fractures. Data
are not yet
available to demonstrate that raloxifene can reduce the risk of hip and other
non-spine
fractures. Teriparatide, a form of parathyroid hormone, is approved for the
treatment of
osteoporosis in postmenopausal women and men who are at high risk for a
fracture. This
medication stimulates new bone formation and significantly increases bone
mineral density.
In postmenopausal women, fracture reduction was noted in the spine, hip, foot,
ribs and wrist.
In men, fracture reduction was noted in the spine, but there were insufficient
data to evaluate
fracture reduction at other sites. Teriparatide is self-administered as a
daily injection for up to
24 months.
7. Pharmaceutical Compositions
In certain embodiments, activin-ActRlIa antagonists (e.g., ActRIIa
polypeptides) of
the present invention are formulated with a pharmaceutically acceptable
carrier. For
example, an ActRIla polypeptide can be administered alone or as a component of
a
pharmaceutical formulation (therapeutic composition). The subject compounds
may be
formulated for administration in any convenient way for use in human or
veterinary
medicine.
In certain embodiments, the therapeutic method of the invention includes
administering the composition systemically, or locally as an implant or
device. When
administered, the therapeutic composition for use in this invention is in a
pyrogen-free,
physiologically acceptable form. Therapeutically useful agents other than the
ActRIla
antagonists which may also optionally be included in the composition as
described above,
- 45 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
may be administered simultaneously or sequentially with the subject compounds
(e.g.,
ActRIIa polypeptides) in the methods of the invention.
Typically, ActRIla antagonists will be administered parentally, and
particularly
intravenously or subcutaneously. Pharmaceutical compositions suitable for
parenteral
administration may comprise one or more ActRlIa polypeptides in combination
with one or
more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous
solutions,
dispersions, suspensions or emulsions, or sterile powders which may be
reconstituted into
sterile injectable solutions or dispersions just prior to use, which may
contain antioxidants,
buffers, bacteriostats, solutes which render the formulation isotonic with the
blood of the
intended recipient or suspending or thickening agents. Examples of suitable
aqueous and
nonaqueous carriers which may be employed in the pharmaceutical compositions
of the
invention include water, ethanol, polyols (such as glycerol, propylene glycol,
polyethylene
glycol, and the like), and suitable mixtures thereof, vegetable oils, such as
olive oil, and
injectable organic esters, such as ethyl oleate. Proper fluidity can be
maintained, for
example, by the use of coating materials, such as lecithin, by the maintenance
of the required
particle size in the case of dispersions, and by the use of surfactants.
Further, the composition may be encapsulated or injected in a form for
delivery to a
target tissue site (e.g., bone). In certain embodiments, compositions of the
present invention
may include a matrix capable of delivering one or more therapeutic compounds
(e.g., ActRIIa
polypeptides) to a target tissue site (e.g., bone), providing a structure for
the developing tissue
and optimally capable of being resorbed into the body. For example, the matrix
may provide
slow release of the ActRIla polypeptides. Such matrices may be formed of
materials
presently in use for other implanted medical applications.
The choice of matrix material is based on biocompatibility, biodegradability,
mechanical properties, cosmetic appearance and interface properties. The
particular
application of the subject compositions will define the appropriate
formulation. Potential
matrices for the compositions may be biodegradable and chemically defined
calcium sulfate,
tricalciumphosphate, hydroxyapatite, polylactic acid and polyanhydrides. Other
potential
materials are biodegradable and biologically well defined, such as bone or
dermal collagen.
Further matrices are comprised of pure proteins or extracellular matrix
components. Other
potential matrices are non-biodegradable and chemically defined, such as
sintered
- 46 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
hydroxyapatite, bioglass, aluminates, or other ceramics. Matrices may be
comprised of
combinations of any of the above mentioned types of material, such as
polylactic acid and
hydroxyapatite or collagen and tricalciumphosphate. The bioceramics may be
altered in
composition, such as in calcium-aluminate-phosphate and processing to alter
pore size,
particle size, particle shape, and biodegradability.
In certain embodiments, methods of the invention can be administered for
orally, e.g.,
in the form of capsules, cachets, pills, tablets, lozenges (using a flavored
basis, usually
sucrose and acacia or tragacanth), powders, granules, or as a solution or a
suspension in an
aqueous or non-aqueous liquid, or as an oil-in-water or water-in-oil liquid
emulsion, or as an
elixir or syrup, or as pastilles (using an inert base, such as gelatin and
glycerin, or sucrose and
acacia) and/or as mouth washes and the like, each containing a predetermined
amount of an
agent as an active ingredient. An agent may also be administered as a bolus,
electuary or
paste.
In solid dosage forms for oral administration (capsules, tablets, pills,
dragees,
powders, granules, and the like), one or more therapeutic compounds of the
present invention
may be mixed with one or more pharmaceutically acceptable carriers, such as
sodium citrate
or dicalcium phosphate, and/or any of the following: (1) fillers or extenders,
such as starches,
lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such
as, for example,
carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose,
and/or acacia; (3)
humectants, such as glycerol; (4) disintegrating agents, such as agar-agar,
calcium carbonate,
potato or tapioca starch, alginic acid, certain silicates, and sodium
carbonate; (5) solution
retarding agents, such as paraffin; (6) absorption accelerators, such as
quaternary ammonium
compounds; (7) wetting agents, such as, for example, cetyl alcohol and
glycerol
monostearate; (8) absorbents, such as kaolin and bentonite clay; (9)
lubricants, such a talc,
calcium stearate, magnesium stearate, solid polyethylene glycols, sodium
lauryl sulfate, and
mixtures thereof; and (10) coloring agents. In the case of capsules, tablets
and pills, the
pharmaceutical compositions may also comprise buffering agents. Solid
compositions of a
similar type may also be employed as fillers in soft and hard-filled gelatin
capsules using
such excipients as lactose or milk sugars, as well as high molecular weight
polyethylene
glycols and the like.
- 47 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
Liquid dosage forms for oral administration include pharmaceutically
acceptable
emulsions, microemulsions, solutions, suspensions, syrups, and elixirs. In
addition to the
active ingredient, the liquid dosage forms may contain inert diluents commonly
used in the
art, such as water or other solvents, solubilizing agents and emulsifiers,
such as ethyl alcohol,
isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl
benzoate, propylene
glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn,
germ, olive,
castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene
glycols and fatty acid
esters of sorbitan, and mixtures thereof. Besides inert diluents, the oral
compositions can also
include adjuvants such as wetting agents, emulsifying and suspending agents,
sweetening,
flavoring, coloring, perfuming, and preservative agents.
Suspensions, in addition to the active compounds, may contain suspending
agents
such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and
sorbitan esters,
microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and
tragacanth,
and mixtures thereof.
The compositions of the invention may also contain adjuvants, such as
preservatives,
wetting agents, emulsifying agents and dispersing agents. Prevention of the
action of
microorganisms may be ensured by the inclusion of various antibacterial and
antifimgal
agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like.
It may also be
desirable to include isotonic agents, such as sugars, sodium chloride, and the
like into the
compositions. In addition, prolonged absorption of the injectable
pharmaceutical form may
be brought about by the inclusion of agents which delay absorption, such as
aluminum
monostearate and gelatin.
It is understood that the dosage regimen will be determined by the attending
physician
considering various factors which modify the action of the subject compounds
of the
invention (e.g., ActRIIa polypeptides). The various factors include, but are
not limited to,
amount of bone weight desired to be formed, the degree of bone density loss,
the site of bone
damage, the condition of the damaged bone, the patient's age, sex, and diet,
the severity of
any disease that may be contributing to bone loss, time of administration, and
other clinical
factors. Optionally, the dosage may vary with the type of matrix used in the
reconstitution
and the types of compounds in the composition. The addition of other known
growth factors
to the final composition, may also affect the dosage. Progress can be
monitored by periodic
-48-
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
assessment of bone growth and/or repair, for example, X-rays (including DEXA),
histomorphometric determinations, and tetracycline labeling.
Experiments with primates and humans have demonstrated that effects of ActRIIa-
Fc
on bone are detectable when the compound is dosed at intervals and amounts
sufficient to
achieve serum concentrations of about 200 ng/ml, with half-maximal effects on
anabolic
bone biomarkers occurring at a dosage of 0.3 mg/kg or the equivalent in terms
of area-under-
curve. In humans, serum levels of 200 ng/ml may be achieved with a single dose
of 0.1
mg/kg or greater and serum levels of 1000 ng/ml may be achieved with a single
dose of 0.3
mg/kg or greater. The observed serum half-life of the molecule is between
about 25 and 35
days, substantially longer than most Fc fusion proteins, and thus a sustained
effective serum
level may be achieved, for example, by dosing with about 0.05 to 0.5 mg/kg on
a weekly or
biweekly basis, or higher doses may be used with longer intervals between
dosings. For
example, doses of 0.1, 0.3, 0.5, 0.7, 1,2 or 3 mg/kg, or values in between,
might be used on a
monthly or bimonthly basis, and the effect on bone may be sufficiently durable
that dosing is
necessary only once every 3, 4, 5, 6, 9, 12 or more months. Longer intervals
between doses
are further supported by the duration of the pharmacodynamic effect, which is
longer than the
duration of drug in the serum. PD effects are observed for at least 120 days
in human
patients.
In certain embodiments, the present invention also provides gene therapy for
the in
vivo production of ActRIla polypeptides. Such therapy would achieve its
therapeutic effect
by introduction of the ActRlIa polynucleotide sequences into cells or tissues
having the
disorders as listed above. Delivery of ActRIIa polynucleotide sequences can be
achieved
using a recombinant expression vector such as a chimeric virus or a colloidal
dispersion
system. Preferred for therapeutic delivery of ActRIIa polynucleotide sequences
is the use of
targeted liposomes.
Various viral vectors which can be utilized for gene therapy as taught herein
include
adenovirus, herpes virus, vaccinia, or, preferably, an RNA virus such as a
retrovirus.
Preferably, the retroviral vector is a derivative of a murine or avian
retrovirus. Examples of
retroviral vectors in which a single foreign gene can be inserted include, but
are not limited
to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus
(HaMuSV),
murine mammary tumor virus (MuMTV), and Rous Sarcoma Virus (RSV). A number of
- 49 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
additional retroviral vectors can incorporate multiple genes. All of these
vectors can transfer
or incorporate a gene for a selectable marker so that transduced cells can be
identified and
generated. Retroviral vectors can be made target-specific by attaching, for
example, a sugar,
a glycolipid, or a protein. Preferred targeting is accomplished by using an
antibody. Those
of skill in the art will recognize that specific polynucleotide sequences can
be inserted into
the retroviral genome or attached to a viral envelope to allow target specific
delivery of the
retroviral vector containing the ActRlIa polynucleotide. In a preferred
embodiment, the
vector is targeted to bone or cartilage.
Alternatively, tissue culture cells can be directly transfected with plasmids
encoding
the retroviral structural genes gag, pol and env, by conventional calcium
phosphate
transfection. These cells are then transfected with the vector plasmid
containing the genes of
interest. The resulting cells release the retroviral vector into the culture
medium.
Another targeted delivery system for ActRIla polynucleotides is a colloidal
dispersion
system. Colloidal dispersion systems include macromolecule complexes,
nanocapsules,
microspheres, beads, and lipid-based systems including oil-in-water emulsions,
micelles,
mixed micelles, and liposomes. The preferred colloidal system of this
invention is a
liposome. Liposomes are artificial membrane vesicles which are useful as
delivery vehicles
in vitro and in vivo. RNA, DNA and intact virions can be encapsulated within
the aqueous
interior and be delivered to cells in a biologically active form (see e.g.,
Fraley, et al., Trends
Biochem. Sci., 6:77, 1981). Methods for efficient gene transfer using a
liposome vehicle, are
known in the art, see e.g., Mannino, et al., Biotechniques, 6:682, 1988. The
composition of
the liposome is usually a combination of phospholipids, usually in combination
with steroids,
especially cholesterol. Other phospholipids or other lipids may also be used.
The physical
characteristics of liposomes depend on pH, ionic strength, and the presence of
divalent
cations.
Examples of lipids useful in liposome production include phosphatidyl
compounds,
such as phosphatidyl glycerol, phosphatidylcholine, phosphatidylserine,
phosphatidylethanolamine, sphingolipids, cerebrosides, and gangliosides.
Illustrative
phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine,
and
distearoylphosphatidylcholine. The targeting of liposomes is also possible
based on, for
example, organ-specificity, cell-specificity, and organelle-specificity and is
known in the art.
- 50 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
EXEMPLIFICATION
The invention now being generally described, it will be more readily
understood by
reference to the following examples, which are included merely for purposes of
illustration of
certain embodiments and embodiments of the present invention, and are not
intended to limit
the invention.
Example 1: ActRIla-Fc Fusion Proteins
Applicants constructed a soluble ActRIla fusion protein that has the
extracellular
domain of human ActRlIa fused to a human or mouse Fc domain with a minimal
linker in
between. The constructs are referred to as ActRIIa-hFc and ActRlIa-mFc,
respectively.
ActRIIa-hFc is shown below as purified from CHO cell lines (SEQ ID NO: 7):
ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQG
CWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPK
PPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNICALP
VPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP
ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
The ActRIla-hFc and ActRIIa-mFc proteins were expressed in CHO cell lines.
Three
different leader sequences were considered:
(i) Honey bee mellitin (HBML): MKFLVNVALVFMVVYISYIYA (SEQ ID NO: 8)
(ii) Tissue Plasminogen Activator (TPA): MDAMKRGLCCVLLLCGAVFVSP (SEQ ID
NO: 9)
(iii) Native: MGAAAKLAFAVFLISCSSGA (SEQ ID NO: 10).
The selected form employs the TPA leader and has the following unprocessed
amino
acid sequence:
MDAMKRGLCCVLLLCGAVFVSPGAAILGRSETQECLFFNANWEKDRTNQTGVEPCY
GDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEG
NMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPK
-51 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS
VLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKN .
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFELYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO:13)
This polypeptide is encoded by the following nucleic acid sequence:
ATGGATGCAATGAAGAGAGGGCTCTGCTGTGTGCTGCTGCTGTGTGGAGCAGICT
TCG 1T1 ___ CGCCCGGCGCCGCTATACTTGGTAGATCAGAAACTCAGGAGTGTCYTTT
Fl! __ AATGCTAATTGGGAAAAAGACAGAACCAATCAAACTGGTGTTGAACCGTGTT
ATGGTGACAAAGATAAACGGCGGCA'TTGT ___________ In GCTACCTGGAAGAATA FYI CTGG
TTCCATTGAATAGTGAAACAAGGTTGTIGGCTGGATGATATCAACTGCTATGACA
GGACTGATTGTGTAGAAAAAAAAGACAGCCCTGAAGTATATTTCTUTTGCTGTGA
GGGCAATATGTGTAATGAAAAGTTTTCTTATTTTCCGGAGATGGAAGTCACACAG
CCCACTTCAAATCCAGTTACACCTAAGCCACCCACCGGTGGTGGAACTCACACAT
GCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCC
CCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTG
GTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGAC
GGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAG
CACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGC
AAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGTCCCCATCGAGAAA
ACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCC
CCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAA
GGCTTCTATcCCAGCGACATC.GCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAG
AACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTT'CCTCT
ATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCAT
GCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCT
GTCTCCGGGTAAATGAGAATTC (SEQ ID NO:14)
Both ActRIIa-hFc and ActRIla-mFc were remarkably amenable to recombinant
expression. As shown in figure 1, the protein was purified as a single, well-
defined peak of
protein. N-terminal sequencing revealed a single sequence of -ILGRSETQE (SEQ
ID NO:
11). Purification could be achieved by a series of column chromatography
steps, including,
for example, three or more of the following, in any order: protein A
chromatography, Q
- 52 -
CA 02913992 2015-12-03
sepharoseTM chromatography, phenylsepharose chromatography, size exclusion
chromatography, and cation exchange chromatography. The purification could be
completed
with viral filtration and buffer exchange. The ActRIla-hFc protein was
purified to a purity of
>98% as determined by size exclusion chromatography and >95% as determined by
SDS
PAGE.
ActRIIa-hFc and ActRIIa-mFc showed a high affinity for ligands, particularly
activin
A. GDF-11 or Activin A ("ActA") were immobilized on a BiacoreTM CM5 chip using
standard
amine coupling procedure. ActRIla-hFc and ActRIIa-mFc proteins were loaded
onto the
system, and binding was measured. ActRIIa-hFc bound to activin with a
dissociation
constant (KO of 5x10-12, and the protein bound to GDF 11 with a KD of 9.96x10-
9. See figure
2. ActRIla-mFc behaved similarly.
An A-204 Reporter Gene Assay was used to evaluate the effects of ActRIIa-hFc
proteins on signaling by GDF-11 and Activin A. Cell line: Human
Rhabdomyosarcoma
(derived from muscle). Reporter vector: pGL3(CAGA)12 (Described in Dennler et
al, 1998,
EMBO 17: 3091-3100.) See Figure 3. The CAGA12 motif is present in TGF-Beta
responsive genes ( PAI-1 gene) , so this vector is of general use for factors
signaling through
Smad2 and 3.
Day 1: Split A-204 cells into 48-well plate.
Day 2: A-204 cells transfected with 10 tig pGL3(CAGA)12 or pGL3(CAGA)12 (10
1.1g)+ pRLCMV (1 ug) and Fugene.
Day 3: Add factors (diluted into medium+ 0.1 % BSA). Inhibitors need to be
preincubated with Factors for 1 hr before adding to cells. 6 hrs later, cells
rinsed with PBS,
and lyse cells.
This is followed by a Luciferase assay. Typically in this assay, in the
absence of any
inhibitors, Activin A shows roughly 10 fold stimulation of reporter gene
expression and an
ED50 ¨ 2 ng/ml. GDF-11: 16 fold stimulation, ED50: ¨ 1.5 ng/ml. GDF-8 shows an
effect
similar to GDF-11.
As shown in figure 4, ActRIla-hFc and ActRIla-mFc inhibit GDF-8 mediated
signaling at picomolar concentrations. As shown in figure 5, three different
preparations of
ActRIla-hFc inhibited GDF-11 signaling with an IC50 of approximately 200 pM.
- 53 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
The ActRlIa-hFc was very stable in pharmacokinetic studies. Rats were dosed
with 1
mg/kg, 3 mg/kg or 10 mg/kg of ActRIla-hFc protein and plasma levels of the
protein were
measured at 24, 48, 72, 144 and 168 hours. In a separate study, rats were
dosed at 1 mg/kg,
mg/kg or 30 mg/kg. In rats, ActRlIa-hFc had an 11-14 day serum half life and
circulating
5 levels of the drug were quite high after two weeks (11 pg/ml, 110 g/ml
or 304 jig/m1 for
initial administrations of 1 mg/kg, 10 mg/kg or 30 mg/kg, respectively.) In
cynomolgus
monkeys, the plasma half life was substantially greater than 14 days and
circulating levels of
the drug were 25 jig/ml, 304 jig/m1 or 1440 jig/ml for initial administrations
of 1 mg/kg, 10
mg/kg or 30 mg/kg, respectively. Preliminary results in humans suggests that
the serum half
10 life is between about 20 and 30 days.
Example 2: ActRIla-mFc Promotes Bone Growth In Vivo
Normal female mice (BALB/c) were dosed with ActRIIa-mFc at a level of 1
mg/kg/dose, 3 mg/kg/dose or 10 mg/kg/dose, with doses given twice weekly. Bone
mineral
density and bone mineral content were determined by DEXA, see figure 6.
In BALB/c female mice, DEXA scans showed a significant increase (>20%) in bone
mineral density and content as a result of ActRIIa-mFc treatment. See figures
7 and 8.
Thus, antagonism of ActRIIa caused increased bone density and content in
normal
female mice. As a next step, the effect of ActRIIa-mFc on bone in a mouse
model for
osteoporosis was tested.
Andersson et al. (2001), established that ovariectomized mice suffered
substantial
bone loss (rougly 50% loss of trabecular bone six weeks post-operation), and
that bone loss in
these mice could be corrected with candidate therapeutic agents, such as
parathyroid
hormone.
Applicants used C57BL6 female mice that were ovariectomized (OVX) or sham
operated at 4-5 weeks of age. Eight weeks after surgery, treatment with
ActRIla-mFc (10
mg/kg, twice weekly) or control (PBS) was initiated. Bone density was measured
by CT
scanner.
As shown in figure 9, untreated, ovariectomized mice showed substantial loss
of
trabecular bone density relative to the sham controls after six weeks. ActRIIa-
mFc treatment
- 54 -
CA 02913992 2015-12-03
WO 2008/100384
PCT/US2008/001354
restored bone density to the level of the sham operated mice. At 6 and 12
weeks of the
treatment, ActRIla-mFc caused substantial increase in trabecular bone of OVX
mice. See
figure 10. After 6 weeks of treatment, bone density increased by 24% relative
to PBS
controls. After 12 weeks, the increase was 27%.
In the sham operated mice, ActRIIa-mFc also caused a substantial increase in
trabecular bone. See figure 11. After 6 and 12 weeks, the treatment produced a
35% increase
relative to controls.
In an additional set of experiments, ovariectomized (OVX) or sham operated
mice as
described above were treated with ActRIla-mFc (10 mg/kg, twice weekly) or
control (PBS)
over twelve weeks. Similar to the results described above for ActRlIa-mFc, OVX
mice
receiving ActRIla-mFc exhibited an increase in trabecular bone density of 15%
by as early as
four weeks and 25% after 12 weeks of treatment (Figure 12). Sham operated mice
receiving
ActRIla-mFc similarly showed an increase in trabecular bone density of 22% by
as early as
four weeks and of 32% after 12 weeks of treatment (Figure 13).
After twelve weeks of treatment with ActRIla-mFc, whole body and ex vivo femur
DEXA analysis showed that treatment induces an increase in bone density in
both
ovariectomized and sham operated mice (Figures 14A and 14B, respectively).
These results
are also supported by ex vivo pQCT analysis of the femoral midshaft which
demonstrated a
significant increase in both total and cortical bone density after twelve
weeks of treatment
with ActRIIa-mFc. Vehicle-treated control ovariectomized mice exhibited bone
densities
that were comparable to vehicle-treated control sham operated mice (Figure
15). In addition
to bone density, bone content increased following ActRIIa-mFC treatment. Ex
vivo pQCT
analysis of the femoral midshaft demonstrated a significant increase in both
total and cortical
bone content after twelve weeks of treatment with ActRIla-mFe while both
ovariectomized
and sham operated vehicle control-treated mice exhibited comparable bone
content (Figure
16). Ex vivo pQCT analysis of the femoral midshaft also showed that ActRIla-
mFc treated
mice did not show a change in periosteal circumference; however ActRIla-mFc
treatment
resulted in a decrease in endosteal circumference indicating an increase in
cortical thickness
due to growth on the inner surface of the femur (Figure 17).
Mechanical testing of femurs determined that ActRIla-mFc was able to increase
the
extrinsic characteristics of the bone (maximal load, stiffness and energy to
break) which
- 55 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
contributed to a significant increase in the intrinsic properties (ultimate
strength) of the bones.
Ovariectomized mice treated with ActRIIa-mFc exhibited increased bone strength
to levels
beyond sham operated, vehicle treated controls, indicating a complete reversal
of the
osteoporotic phenotype (Figure 18).
These data demonstrate that an activin-ActRIIa antagonist can increase bone
density
in normal female mice and, furthermore, correct defects in bone density, bone
content, and
ultimately bone strength, in a mouse model of osteoporosis.
In a further set of experiments, mice were ovariectomized or sham operated at
4
weeks, and beginning at 12 weeks received either placebo or ActRIIa-mFc (2
times/week,
10mg/kg) (also referred to as RAP-11 in Figures 19-24), for a further period
of 12 weeks. A
variety of bone parameters were evaluated. As shown in Figure 19, ActRIIa-mFc
increased
vertebral trabecular bone volume to total volume ratios (BV/TV) in both the
OVX and
SHAM operated mice. ActRIla-mFc also improved the trabecular architecture
(Figure 20),
increased cortical thickness (Figure 21) and improved bone strength (Figure
22). As shown
in Figure 23, ActRIIa-mFc produced desirable effects at a range of doses from
lmg/kg to 10
mg/kg.
Bone histomorphometry was conducted at a 2 week time point in sham operated
mice.
These data, presented in Figure 24, demonstrate that ActRIIa-mFc has a dual
effect, both
inhibiting bone resorption and promoting bone growth. Thus ActRIIa-mFc
stimulates bone
growth (anabolic effect) and inhibits bone resorption (anti-catabolic effect).
BV = Bone
volume; TV = total tissue volume. BV/TV is a measure of the percentage of bone
volume
that is mineralized. ES = Eroded surface; BS = Bone surface. ES/BS is a
measure of bone
erosion, and the decrease caused by RAP-011 demonstrates an anti-resorptive or
anti-
catabolic effect. Ms/Bs is the mineralizing surface/bone surface ratio, which
is an indicator
of bone growth, or anabolic effect. Similarly, mineral apposition rate (MAR)
and bone
formation rate per bone surface per day (BFR/BSd) indicate bone growth.
Measures of
osteoblasts (Nob/BPm) and osteoclasts (Noc/BPm) are taken in order to probe
the mechanism
of action.
A second bone histomorphometry experiment was conducted in female C578L/6
mice, beginning at an age of twelve weeks. Mice were dosed intraperitoneally
twice per
week with 10 mg/kg ActRIla-mFc for two weeks, four weeks, eight weeks or
twelve weeks.
- 56 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
Each group was sacrificed five days after the last dose and bones taken for
analysis. Mice
were calcein labeled nine days and two days prior to euthanasia. As shown in
Figure 25, the
metrics show that ActRIla-mFc promotes bone growth and mineralization and has
both
anabolic and anti-catabolic effects. See for example the BV/TV ratio, the
ES/BS ratio and
the MS/BS ratio. The anabolic effects appear to persist throughout the dosing
regimen, while
the anti-resorptive effects appear to be shorter lived in the mice.
Example 3: ActRlIa-mFc ameliorates or prevents bone damage in a murine model
of multiple
myeloma
Multiple myeloma patients exhibit a bone loss disorder characterized by
increased
osteoclast activity and decreased bone formation by osteoblasts. The 5T2MM
model of
myeloma in mice is based on the use of tumor cells (5T2MM cells) from a type
of
spontaneous tumor that develops in aged mice and causes effects in mice that
are similar to
those seen in human multiple myeloma patients. See, e.g., Vanderkerken et al.,
Methods Mol
Med. 2005;113:191-205. ActRIla-mFc was tested for effects in this model.
5T2MM cells injected into C57B1/KaLwRij mice promoted an increase in
osteoclast
surface, the formation of osteolytic lesions and caused a decrease in bone
area. Bone disease
was associated with a decrease in osteoblast number, osteoblast surface and a
reduction in
mineralization.
Mice bearing 5T2MM cells were treated with ActRIIa-mFc (RAP-011) (10mg/kg,
i.p.
twice weekly), or a vehicle, from the time of 5T2MM injection, for a total of
12 weeks.
MicroCT analysis of the proximal tibia and lumbar vertebrae demonstrated a 39%
and 21%
reduction in cancellous bone volume (p<0.001 and p<0.01) and a 37% and 15%
reduction in
trabecular number (p<0.01 and p<0.05) in 5T2MM-bearing mice compared to naïve
mice.
RAP-011 completely prevented 5T2MM-induced decreases in trabecular volume and
number
in both tibia (p<0.001 and p<0.05) and vertebrae (p<0.01 and p<0.05) when
compared to
vehicle treated mice. Bone volume was 19% higher in the tibia (p=168) and 12%
higher in
vertebrae (p<0.05) of RAP-011 treated mice when compared to naïve mice. RAP-
011
prevented the development of osteolytic bone lesions (p<0.05). This effect is
illustrated in
Figure 26. While a preliminary assessment of the data failed to identify
significant effects on
serum paraprotein (a biomarker of multiple myeloma tumor cells) or myeloma
burden in this
- 57 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
study, a further analysis indicated that serum paraprotein was substantially
decreased in all
but one of the treated animals, and further that the volume of healthy bone
marrow was
substantially increased, indicating a decrease in the myeloma tumor cell
burden.
Therefore, ActRlIa-mFc may be used to decrease the effects of bone disease
resulting
from multiple myeloma and to treat the tumor cells themselves.
Example 4: Characterization of an ActRIIa-hFc Protein
ActRIla-hFc fusion protein was expressed in stably transfected CHO-DUKX B11
cells from a pAID4 vector (SV40 on/enhancer, CMV promoter), using a tissue
plasminogen
leader sequence of SEQ ID NO:9. The protein, purified as described above in
Example 1,
had a sequence of SEQ ID NO:?. The Fe portion is a human IgG1 Fc sequence, as
shown in
SEQ ID NO:?. Sialic acid analysis showed that the protein contained, on
average, between
about 1.5 and 2.5 moles of sialic acid per molecule of ActRIla-hFc fusion
protein.
This purified protein showed a remarkably long serum half-life in all animals
tested,
including a half-life of 25-32 days in human patients (see Example 5, below).
Additionally,
the CHO cell expressed material has a higher affinity for activin B ligand
than that reported
for an ActRIla-hFc fusion protein expressed in human 293 cells (del Re et al.,
J Biol Chem.
2004 Dec 17;279(51):53126-35.) Additionally, the use of the tPa leader
sequence provided
greater production than other leader sequences and, unlike ActRlIa-Fc
expressed with a
native leader, provided a highly pure N-terminal sequence. Use of the native
leader sequence
resulted in two major species of ActRIIa-Fc, each having a different N-
terminal sequence.
Example 5: Human Clinical Trial
The protein described in Example 4 was administered to human patients in a
randomized, double-blind, placebo-controlled study that was conducted to
evaluate,
primarily, the safety of the protein in healthy, postmenopausal women. Forty-
eight subjects
were randomized in cohorts of 6 to receive either a single dose of ActRIla-hFc
or placebo (5
active:1 placebo). Dose levels ranged from 0.01 to 3.0 mg/kg intravenously
(IV) and 0.03 to
0.1 mg/kg subcutaneously (SC). All subjects were followed for 120 days.
Subjects were
excluded from study participation if they took medications affecting bone
metabolism within
- 58 -
CA 02913992 2015-12-03
WO 2008/100384
PCT/US2008/001354
6 months of study entry. Safety evaluations were conducted following each
cohort to
determine dose escalation. In addition to pharmacokinetic (PK) analyses, the
biologic
activity of ActRIla-hFc was also assessed by measurement of biochemical
markers of bone
formation and resorption, and FSH levels.
No serious adverse events were reported in this study. Adverse events (AEs)
were
generally mild and transient. Preliminary analysis of AEs included headache,
elevated
laboratory values, cold symptoms, emesis or vomiting, intravenous
infiltration, and
hematoma at injection site.
PK analysis of ActRIla-hFc displayed a linear profile with dose, and a mean
half-life
of approximately 25-32 days. The area-under-curve (AUC) for ActRIla-hFc was
linearly
related to dose, and the absorption after SC dosing was essentially complete
(see Figures 27
and 28). These data indicate that SC is a desirable approach to dosing because
it provides
equivalent bioavailability and serum-half life for the drug while avoiding the
spike in serum
concentrations of drug associated with the first few days of IV dosing (see
Figure 28).
ActRIla-hFc caused a rapid, sustained dose-dependent increase in serum levels
of bone-
specific alkaline phosphatase (BAP), which is a marker for anabolic bone
growth, and a dose-
dependent decrease in C-terminal type 1 collagen te1opeptide and tartrate-
resistant acid
phosphatase 5b levels, which are markers for bone resorption. Other markers,
such as P1NP
showed inconclusive results. BAP levels showed near saturating effects at the
highest dosage
of drug, indicating that half-maximal effects on this anabolic bone biomarker
could be
achieved at a dosage of 0.3 mg/kg, with increases ranging up to 3 mg/kg.
Calculated as a
relationship of pharmacodynamic effect to AUG for drug, the EC50 is 51,465
(day*ng/m1).
See Figure 29. These bone biomarker changes were sustained for approximately
120 days at
the highest dose levels tested. There was also a dose-dependent decrease in
serum FSH
levels consistent with inhibition of activin.
A single dose of ActRIIa-hFc given to healthy postmenopausal women was safe
and
well-tolerated for the range of dose levels tested. The prolonged PK and
pharmacodynamic
effects suggest that intermittent dosing would be appropriate for future
studies. For example,
dosing on the basis of serum half-life could be performed on a monthly basis,
or on the order
of once every two, three, four, five or six weeks. Additionally, because the
pharmacodynamic effect extends far beyond the serum residence of the drug,
dosing could be
- 59 -
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
performed on the basis of the pharmacodynamic effect, meaning that dosing
every three
months or every two, three, four, five, six or even twelve months may be
effective to produce
the desired effect in patients. This clinical trial demonstrates that, in
humans, ActRIIa-hFc is
an osteoanabolic agent with biological evidence of both an increase in bone
formation and a
decrease in bone resorption.
Example 6: Co-administration of ActRIIa-mFc and a Bisphosphonate
Bisphosphonates are a class of drugs that are widely used to treat disorders
associated
with low bone mineral density, including osteoporosis and cancer-related bone
loss.
Bisphosphonates have a potent anti-resorptive activity, inhibiting
osteoclasts. Perhaps
because osteoclasts are required both for bone breakdown and bone growth,
bisphosphonates
appear to diminish the effects of parathyroid hormone (PTH), one of the only
known anabolic
bone growth agents (Black et al., N Engl J Med. 2003 Sep 25;349(13):1207-15;
Samadfam et
al., Endocrinology. 2007 Jun;148(6):2778-87.)
To test the utility of ActRIla-Fc treatment in patients that had previously or
were
concomitantly receiving bisphosphonate or other anti-resorptive therapy, mice
were tested
with combined ActRIIa-mFc and zoledronate, a bisphosphonate compound. 12 week
old
C57BL/6N mice were treated as follows:
Group 1 PBS
Group 2 ActRIIa-mFc (RAP-011) (10 mg/kg) twice per week (with Group 3 and
4)
Group 3 Zoledronic Acid (ZOL) singe dose (20 mg/kg)
Group 4 ZOL (1 dose), 3 days later ActRIIa-mFc (RAP-011) (1 mg/kg)
twice per week
Group 5 ZOL (1 dose), 3 days later ActRIIa-mFc (RAP-011) (10 mg/kg)
twice per
week
Total BMD was determined by DEXA scan (PIXI) prior to dosing and at 3 and 8
weeks of
treatment.
As shown in Figure 30, total BMD increased markedly in all treatment groups,
with
the combination of ZOL and ActRIla-mFc producing the greatest effects. These
results
-60-
CA 02913992 2015-12-03
WO 2008/100384 PCT/US2008/001354
indicate that ActRIla-Fc proteins can be used to increase bone density, even
in patients that
have received bisphosphonate therapy.
Example 7: ActRIla-Fc Ameliorates or Prevents Bone Loss Caused by Breast
Cancer
Metastases
It is estimated that 65 to 75 percent of breast cancers metastasize to the
bone, causing
substantial damage to the bone structure, increasing fracture risk and causing
pain and other
side effects. We tested the effects of ActRIla-Fc in a mouse model of breast
cancer that has
metastasized to the bone.
A subline of the human breast cancer cell line MDA-MB-231 (clone 2287) was
cultured in vitro and cells harvested at a density of 5 x 106 cells/ml. MDA-MB-
231 is a cell
line that is highly competent for seeding into bone and causing bone damage
similar to that
caused by bone metastases. 10 ml of cells were injected into the tibia of 6
week old female
athymic nude mice on study day 0. On study day 10 mice received ActRIla-mFc
(10 mg/kg/
twice weekly/ subcutaneous) (n=8) or PBS vehicle (n=7). Disease progression
was assessed
by dual energy x-ray absorptiometry (PIXIMus) at weekly intervals. Mice were
treated with
ActRlIa-rnFc for 4 weeks and then sacrificed and tibae (both tumor injected
and untumored)
were collected from each animal. Tibiae were then processed and prepared for
microCT and
histololgical analysis.
Intratibial injection of MDA-MB-231 cells into athymic nude mice promoted the
development of osteolytic bone lesions in the injected tibia compared to the
contralateral leg.
MicroCT analysis of the proximal tibia, demonstrated a 62%, reduction in
cancellous bone
volume in the MDA-MB-231 bearing tibiae compared to the untumored tibia in PBS
vehicle
treated mice. ActRlIa-mFc treatment led to an increase of 70% or 147% in the
naïve or
tumor bearing tibia respectively compared to vehicle (P<0.01 for both). The
tumor bearing
tibiae of ActRI la-mFc treated mice had a similar cancellous bone density as
the naive tibiae
of the VEH treated mice (p=0.39).
Thus, ActRI la-mFc is able to eliminate the bone damage associated with the
presence
of breast tumor cells in the bone.
- 61 -
CA 02913992 2015-12-03
Example 8: Alternative ActRIIa-Fc Proteins
An alternative construct may have a deletion of the C-terminal tail (the final
15 amino
acids of the extracellular domain of ActRIIa. The sequence for such a
construct is presented
below (Fc portion underlined)(SEQ ID NO: 12):
ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQG
CWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMTGGGTHTCPPCPA
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK
TKPREEQYNSTYRVVSVLTVLHODWLNGKEYKCKVSNKALPVPIEKTISKAKGQPRE
PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSKLTVDKSRWQOGNVFSCSVMHEALHNHYTQKSLSLSPGK
While specific embodiments of the subject matter have been discussed, the
above
specification is illustrative and not restrictive. Many variations will become
apparent to those
skilled in the art upon review of this specification and the claims below. The
full scope of the
invention should be determined by reference to the claims, along with their
full scope of
equivalents, and the specification, along with such variations.
- 62 -
