Note: Descriptions are shown in the official language in which they were submitted.
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
MODULATION OF TUMOR IMMUNITY BY PROTEIN-MEDIATED 02 DELIVERY
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional Patent
Application No.
62/134,523, filed March 17, 2015, the disclosure of which is hereby
incorporated by reference in
its entirety for all purposes.
SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILE
[0002] The content of the following submission on ASCII text file is
incorporated herein by
reference in its entirety: a computer readable form (CRF) of the Sequence
Listing (file name:
6270420009405eqList.txt, date recorded: March 17, 2016, size: 41 KB).
TECHNICAL FIELD
[0003] This application pertains to the modulation of tumor immunity by
delivering oxygen to
the tumor by way of a protein 02 carrier polypeptide; for example an H-NOX
protein.
BACKGROUND OF THE INVENTION
[0004] The hypoxic tumor microenvironment suppresses the host's immune anti-
tumor
defenses by modulating multiple signaling pathways including, but not limited
to, hypoxia
inducible factor (HIF-1) signaling (Codo et al., 2014 Oncotarget, 5(17), 7651-
7662; Lee, Mace,
& Repasky, 2010 Int J Hyperthermia, 26(3), 232-246; Wei et al., 2011 PLoS One,
6(1), e16195).
Major hypoxia immunomodulating pathways are summarized in Fig 1. Briefly, HIF-
1 has been
shown to: a) activate adenosinergic A2 and PD-Li pathways that inhibit
recruitment and
activation of helper and killer T-cells and NK cells, key effectors of anti-
tumor responses
(Noman et al., 2014 J Exp Med, 211(5), 781-790; Ohta et al., 2006 Proc Natl
Acad Sci U S A,
103(35), 13132-13137); b) recruit and activate inhibitory regulatory T cells
(Treg), tumor
associated macrophages (TAM) and other myeloid-derived suppressor cells (MDSC)
(Chaturvedi et al., 2014 Proc Natl Acad Sci US A, 111(20), E2120-2129; Corzo
et al., 2010 J
Exp Med, 207(11), 2439-2453; Wei et al., 2011); c) directly inhibit the
ability of tumor cells to
be recognized by immune system (Siemens et al., 2008 Cancer Res, 68(12), 4746-
4753). In
addition, HIF-1-dependent and -independent epigenetic mechanisms contribute to
inhibition of
anti-tumor immune-responses and enhance tumor growth, angiogenesis and
metastasis (Codo et
al., 2014; Mimura et al., 2011 J Pharmacol Sci, 115(4), 453-458).
1
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[0005] In mouse metastatic tumor models, continuous supplemental oxygenation
has been
shown to inhibit tumor growth and prevent tumor's immune escape through
inhibition of A2AR
(A2A adenosine receptor) adenosinergic pathway leading to T and NK cell
activation (Hatfield
et al., 2015 Sci Transl Med, 7(277), 277ra230). Specifically, continuous
treatment with 60%
respiratory oxygen of mice bearing MCA205, B16 or 4T1 pulmonary metastases
resulted in > 2-
fold decrease in number of metastatic foci and enhanced survival. These data
correlated with
decrease in tumor and lymphocyte hypoxia, increased activated CD8 T cell (CD8+
CD69+
CD44+) tumor infiltration, upregulation of immunostimulating cytokines and
chemokines and
were dependent on intact A2AR signaling. At the same time respiratory
hyperoxia was shown to
reduce the number and suppressive the activity of Treg in pulmonary tumor
microenvironment
(TME) due to reduced Foxp3, CD39/CD73 (adenosine generating enzymes upstream
of A2AR)
and CTLA-4 expression. Finally, tumor regression induced by dual CTLA-4/PD-1
blockade of
pulmonary tumors was enhanced by continuous respiratory hyperoxia.
[0006] Despite convincing pre-clinical evidence demonstrating the capacity of
tumor
oxygenation to reverse immunosuppressive TME and inhibit tumor growth, in
human clinical
trials supplemental oxygenation using hyperbaric or normobaric oxygen yielded
limited effects
(Overgaard, 2007 J Clin Oncol, 25(26), 4066-4074). This is likely due to the
inability of soluble
oxygen to effectively diffuse beyond ¨80 um from blood vessels, limiting its
penetration deep
into hypoxic tumor tissue. Therefore, the need exists for oxygen delivery
agents that penetrate
into patients' tumors to transport oxygen beyond the normal diffusion limits,
and thereby
oxygenate hypoxic microenvironments to impede immunosuppressive pathways. This
will result
in maximal stimulation of anti-tumor immune responses, both alone and in
combination with
other immune checkpoint inhibitors and other cancer immunotherapy approaches.
[0007] H-NOX proteins (named for Heme-Nitric oxide and OXygen binding domain)
are
members of a highly-conserved, well-characterized family of hemoproteins
(Iyer, LM et al.
(2003) BMC Genomics 4(1):5; Karow, DS et al. (2004) Biochemistry 43(31):10203-
10211;
Boon, EM et al. (2005) Nature Chem. Biol. 1:53-59; Boon, EM et al. (2005)
Curr. Opin. Chem.
Biol. 9(5):441-446; Boon, EM et al. (2005) J. Inorg. Biochem. 99(4):892-902;
Cary, SP et al.
(2005) Proc Nall Acad Sci USA 102(37):13064-9; Karow DS et al. (2005)
Biochemistry
44(49):16266-74; Cary, SP et al. (2006) Trends Biochem Sci 31(4):231-9; Boon,
EM et al.
(2006) J Biol Chem 281(31):21892-902; Winger, JA et al. (2007) J Biol Chem.
282(2):897-907).
H-NOX proteins are nitric-oxide-neutral, unlike previous hemoglobin-based
oxygen carriers, H-
NOX do not scavenge circulating nitric oxide (NO), and thus are not associated
with
hypertensive or renal side effects. The intrinsic low NO reactivity (and high
NO stability) makes
2
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
wild-type and mutant H-NOX proteins desirable blood substitutes because of the
lower
probability of inactivation of H-NOX proteins by endogenous NO and the lower
probability of
scavenging of endogenous NO by H-NOX proteins. Importantly, the presence of a
distal pocket
tyrosine in some H-NOX proteins (Pellicena, P. et al. (2004) Proc Natl. Acad
Sci USA
101(35):12854-12859) is suggestive of undesirable, high NO reactivity,
contraindicating use as a
blood substitute. For example, by analogy, a Mycobacterium tuberculosis
hemoglobin protein,
with a structurally analogous distal pocket tyrosine, reacts extremely rapidly
with NO, and is
used by the Mycobacterium to effectively scavenge and avoid defensive NO
produced by an
infected host (Ouellet, H. et al. (2002) Proc. Natl. Acad. Sci.0 S A
99(9):5902-5907). However,
it was surprisingly discovered that H-NOX proteins actually have a much lower
NO reactivity
than that of hemoglobin making their use as blood substitutes possible.
[0008] H-NOX proteins for the delivery of 02 and/or NO for therapeutic and
other uses are
described in US Patent Nos 8,404,631 and 8,404,632; WO 2007/139791, WO
2007/139767 and
WO 2014/107171; and US Patent Application Ser. No. 14/530,569, the contents of
each is
incorporated by reference in its entirety.
[0009] All references cited herein, including patent applications and
publications, are
incorporated herein by reference in their entirety.
BRIEF SUMMARY OF THE INVENTION
[0010] The invention provides methods for modulating tumor immunity in an
individual with
a tumor comprising administering to the individual an effective amount of an
02 carrier
polypeptide. In some embodiments, the invention provides methods for enhancing
an immune
response to the tumor. In some embodiments, the invention provides methods for
increasing
lymphocyte infiltration to a tumor in an individual comprising administering
to the individual an
effective amount of an 02 carrier polypeptide. In some embodiments, the
increase in
lymphocyte infiltration to the tumor comprises an increase in infiltration of
one or more of CD4
cells, CD8 cells, or NK cells. In some embodiments, the increase in lymphocyte
infiltration to
the tumor is accompanied by inhibition of one or more of Treg cells, tumor
associated
macrophages or myeloid derived suppressor cells in the tumor. In some
embodiments, the
increase in lymphocyte infiltration to the tumor is accompanied by an increase
in MHC1
expression on the tumor cells. In some embodiments, the modulating of tumor
immunity
comprises increasing antigen processing. In some embodiments, the modulating
of tumor
immunity comprises increasing the presentation capabilities of dendritic cells
(DC).
3
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[0011] In some embodiments, the invention provides methods for decreasing
expression of
hypoxia inducible factor 1a (HIF-1a) and/or hypoxia inducible factor 2a (HIF-
2a) in a tumor in
an individual comprising administering to the individual an effective amount
of an 02 carrier
polypeptide. In some embodiments, the invention provides methods for
decreasing expression
of programmed death ligand-1 (PD-L1) in a tumor in an individual comprising
administering to
the individual an effective amount of an 02 carrier polypeptide. In some
embodiments, the
invention provides methods for decreasing expression of A2A adenosine receptor
(A2AR) in a
tumor in an individual comprising administering to the individual an effective
amount of an 02
carrier polypeptide.
[0012] In some embodiments of the above embodiments, the tumor is a brain
tumor, a
glioblastoma, a bone tumor, a pancreatic tumor, a skin tumor, a tumor of the
head or neck, a
melanoma, a lung tumor, a uterine tumor, an ovarian tumor, a colorectal tumor,
a liver tumor, a
hepatocellular carcinoma, a stomach tumor, a testicular tumor, an endometrial
tumor, a cervical
tumor, a vaginal tumor, a Hodgkin's lymphoma, a non-Hodgkin's lymphoma, an
esophageal
tumor, an intestinal tumor, a thyroid tumor, an adrenal tumor, a bladder
tumor, a kidney tumor,
breast tumor, a multiple myeloma tumor, a sarcoma, or a squamous cell tumor.
[0013] In some aspects, the invention provides methods for treating cancer in
an individual
comprising administering to the individual an effective amount of an 02
carrier polypeptide. In
some embodiments, the cancer is brain cancer, glioblastoma, bone cancer,
pancreatic cancer,
skin cancer, cancer of the head or neck, melanoma, lung cancer, uterine
cancer, ovarian cancer,
colorectal cancer, anal cancer, liver cancer, hepatocellular carcinoma,
stomach cancer, testicular
cancer, endometrial cancer, cervical cancer, Hodgkin's Disease, non-Hodgkin's
lymphoma,
esophageal cancer, intestinal cancer, thyroid cancer, adrenal cancer, bladder
cancer, kidney
cancer, breast cancer, multiple myeloma, sarcoma, anal cancer or squamous cell
cancer.
[0014] In some embodiments of the above aspects and embodiments, the
individual is a
mammal. In further embodiments, the mammal is a human (e.g., a human patient).
In other
embodiments, the mammal is a pet, a laboratory research animal, or a farm
animal. In some
embodiments, the pet, research animal or farm animal is a dog, a cat, a horse,
a monkey, a rabbit,
a rat, a mouse, a guinea pig, a hamster, a pig, or a cow.
[0015] In some embodiments of the above aspects and embodiments, the 02
carrier
polypeptide is administered by intravenous, intra-arterial, intratumoral,
intravesicular, inhalation,
intraperitoneal, intrapulmonary, intramuscular, subcutaneous, intra-tracheal,
transmucosal,
intraocular, intrathecal, or transdermal administration. In some embodiments,
administration of
the 02 carrier polypeptide is repeated. In some embodiments, administration of
the 02 carrier
4
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
polypeptide is repeated daily or twice a day from about 4 weeks to about 8
weeks. In some
embodiments, the 02 carrier polypeptide is administered every four, every 8,
every 12 or every
24 hours for a period of about one to about 10 days. In some embodiments, the
02 carrier
polypeptide is administered as a bolus. In other embodiments, the 02 carrier
polypeptide is
administered by infusion. In some embodiments, the 02 carrier polypeptide is
infused in the
individual for about 15 minutes, about 30 minutes, about 1 hour, about 2
hours, about 3 hours,
about 6 hours, about 12 hours, about 24 hours or more than 24 hours.
[0016] In some embodiments, the invention provides methods to modulate tumor
immunity or
to treat cancer in an individual wherein an 02 carrier polypeptide is
administered in combination
with radiation therapy. In some embodiments, the radiation therapy is
administered to the
individual 1, 2, 3, 4, 5, 6, 8, 10, 12, 14, 16, 18, 20 or 24 hours after the
02 carrier polypeptide is
administered. In some embodiments, the radiation is X-radiation. In some
embodiments, the X-
radiation is administered at about 0.5 gray to about 75 gray. In some
embodiments, the
administration of the 02 carrier polypeptide and/or the administration of the
radiation is
repeated. In some embodiments, the administration is repeated more than about
any of two,
three, four times, five times, ten times, 15 times, 20 times, 25 times or 30
times. In some
embodiments, the administration is repeated after one week, two weeks, three
weeks, or four
weeks.
[0017] In some embodiments, the invention provides methods to modulate tumor
immunity or
to treat cancer in an individual wherein an 02 carrier polypeptide is
administered in combination
with chemotherapy or immunotherapy. In some embodiments, the chemotherapy
comprises a
cytotoxin. In some embodiments, the administration of the 02 carrier
polypeptide and/or the
administration of the chemotherapy is repeated. In some embodiments, the
immunotherapy is
one or more of an anticancer vaccine, an adoptive immune cell therapy or an
agent that targets
an immune checkpoint regulator. In some embodiments, the immunotherapy targets
one or more
of CTLA-4, PD1, PD-L1, or an immune checkpoint regulator. In some embodiments,
the
adoptive immune therapy is a chimeric antigen receptor expressing T cell or an
engineered TCR-
T cell. In some embodiments, the immune therapy is an oncolytic virus or a
Bispecific T cell
Engager (BiTE). In some embodiments, the administration of the 02 carrier
polypeptide and/or
the administration of the immunotherapy is repeated.
[0018] In some embodiments of the above embodiments, the 02 carrier
polypeptide is in a
pharmaceutical composition. In some embodiments, the pharmaceutical
composition further
comprises a pharmaceutically acceptable carrier. In some embodiments of any of
the above
embodiments, the 02 carrier polypeptide is an H-NOX protein.
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[0019] In some aspects, the invention provides methods for modulating tumor
immunity in an
individual with a tumor comprising administering to the individual an
effective amount of an H-
NOX protein. In some embodiments, the invention provides methods for enhancing
an immune
response to the tumor. In some embodiments, the invention provides methods for
increasing
leucocyte infiltration to a tumor in an individual comprising administering to
the individual an
effective amount of an H-NOX protein. In some embodiments, the invention
provides methods
for increasing lymphocyte infiltration to a tumor in an individual comprising
administering to
the individual an effective amount of an H-NOX protein. In some embodiments,
the increase in
lymphocyte infiltration to the tumor comprises an increase in infiltration of
one or more of CD4
cells, CD8 cells, or NK cells. In some embodiments, the increase in lymphocyte
infiltration to
the tumor is accompanied by inhibition of one or more of Treg cells, tumor
associated
macrophages or myeloid derived suppressor cells in the tumor. In some
embodiments, the
increase in lymphocyte infiltration to the tumor is accompanied by an increase
in MHC1
expression on the tumor cells. In some embodiments, the modulating of tumor
immunity
comprises increasing antigen processing. In some embodiments, the modulating
of tumor
immunity comprises increasing lymphocyte activation. In some embodiments, the
modulating
of tumor immunity comprises increasing the presentation capabilities of
dendritic cells (DC).
[0020] In some embodiments, the invention provides methods for decreasing
expression of
hypoxia inducible factor 1a (HIF-1a) and/or hypoxia inducible factor 2a (HIF-
2a) in a tumor in
an individual comprising administering to the individual an effective amount
of an H-NOX
protein. In some embodiments, the invention provides methods for decreasing
expression of
programmed death ligand-1 (PD-L1) in a tumor in an individual comprising
administering to the
individual an effective amount of an H-NOX protein. In some embodiments, the
invention
provides methods for decreasing expression of A2A adenosine receptor (A2AR) in
a tumor in an
individual comprising administering to the individual an effective amount of
an H-NOX protein.
[0021] In some embodiments of the above embodiments, the tumor is a brain
tumor, a
glioblastoma, a bone tumor, a pancreatic tumor, a skin tumor, a tumor of the
head or neck, a
melanoma, a lung tumor, a uterine tumor, an ovarian tumor, a colorectal tumor,
an anal tumor, a
liver tumor, a hepatocellular carcinoma, a stomach tumor, a testicular tumor,
an endometrial
tumor, a cervical tumor, a vaginal tumor, a Hodgkin's lymphoma, a non-
Hodgkin's lymphoma,
an esophageal tumor, an intestinal tumor, a thyroid tumor, an adrenal tumor, a
bladder tumor, a
kidney tumor, breast tumor, a multiple myeloma tumor, a sarcoma, or a squamous
cell tumor.
[0022] In some aspects, the invention provides methods for treating cancer in
an individual
comprising administering to the individual an effective amount of an H-NOX
protein. In some
6
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
embodiments, the cancer is brain cancer, glioblastoma, bone cancer, pancreatic
cancer, skin
cancer, cancer of the head or neck, melanoma, lung cancer, uterine cancer,
ovarian cancer,
colorectal cancer, anal cancer, liver cancer, hepatocellular carcinoma,
stomach cancer, testicular
cancer, endometrial cancer, cervical cancer, Hodgkin's Disease, non-Hodgkin's
lymphoma,
esophageal cancer, intestinal cancer, thyroid cancer, adrenal cancer, bladder
cancer, kidney
cancer, breast cancer, multiple myeloma, sarcoma or squamous cell cancer.
[0023] In some embodiments of the above aspects and embodiments, the
individual is a
mammal. In further embodiments, the mammal is a human (e.g., a human patient).
In other
embodiments, the mammal is a pet, a laboratory research animal, or a farm
animal. In some
embodiments, the pet, research animal or farm animal is a dog, a cat, a horse,
a monkey, a rabbit,
a rat, a mouse, a guinea pig, a hamster, a pig, or a cow.
[0024] In some embodiments of the above aspects and embodiments, the H-NOX
protein is
administered by intravenous, intra-arterial, intratumoral, intravesicular,
inhalation,
intraperitoneal, intrapulmonary, intramuscular, subcutaneous, intra-tracheal,
transmucosal,
intraocular, intrathecal, or transdermal administration. In some embodiments,
administration of
the H-NOX protein is repeated. In some embodiments, administration of the H-
NOX protein is
repeated daily or twice a day from about 4 weeks to about 8 weeks. In some
embodiments, the
H-NOX protein is administered every four, every 8, every 12, every 24 hours,
or every 48 hours
for a period of about one to about 10 days. In some embodiments, the H-NOX
protein is
administered as a bolus. In other embodiments, the H-NOX protein is
administered by infusion.
In some embodiments, the H-NOX protein is infused in the individual for about
15 minutes,
about 30 minutes, about 1 hour, about 2 hours, about 3 hours, about 6 hours,
about 12 hours,
about 24 hours or more than 24 hours.
[0025] In some embodiments, the invention provides methods to modulate tumor
immunity or
to treat cancer in an individual wherein an H-NOX protein is administered in
combination with
radiation therapy. In some embodiments, the radiation therapy is administered
to the individual
1, 2, 3, 4, 5, 6, 8, 10, 12, 14, 16, 18, 20 or 24 hours after the H-NOX
protein is administered. In
some embodiments, the radiation is X-radiation. In some embodiments, the X-
radiation is
administered at about 0.5 gray to about 75 gray. In some embodiments, the
administration of the
H-NOX protein and/or the administration of the radiation is repeated. In some
embodiments, the
administration is repeated more than about any of two, three, four times, five
times, ten times, 15
times, 20 times, 25 times, 30 times or 40 times. In some embodiments, the
administration is
repeated after one week, two weeks, three weeks, or four weeks or more.
7
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[0026] In some embodiments, the invention provides methods to modulate tumor
immunity or
to treat cancer in an individual wherein an H-NOX protein is administered in
combination with
chemotherapy or immunotherapy. In some embodiments, the chemotherapy comprises
a
cytotoxin. In some embodiments, the administration of the H-NOX protein and/or
the
administration of the chemotherapy is repeated. In some embodiments, the
immunotherapy is
one or more of an anticancer vaccine, an adoptive immune cell therapy or an
agent that targets
an immune checkpoint regulator. In some embodiments, the immunotherapy targets
one or more
of CTLA-4, PD1, PD-L1, or an immune checkpoint regulator. In some embodiments,
the
adoptive immude therapy is a chimeric antigen receptor expressing T cell or an
engineered TCR-
T cell. In some embodiments, the immune therapy is an oncolytic virus or a
Bispecific T cell
Engager (BiTE). In some embodiments, the administration of the H-NOX protein
and/or the
administration of the immunotherapy is repeated.
[0027] In some embodiments of the above aspects and embodiments, the H-NOX
protein is a
T tengcongensis H-NOX, a L. pneumophilia 2 H-NOX, a H. sapiens 131, a R.
norvegicus 131, a
C. lupus H-NOX, a D. melangaster131, a D. melangaster CG14885-PA, a C. elegans
GCY-35, a
N. punctiforme H-NOX, C. crescentus H-NOX, a S. oneidensis H-NOX, or C.
acetobutylicum
H-NOX. In some embodiments, the H-NOX protein comprises a H-NOX domain
corresponding
to the H-NOX domain of T tengcongensis set forth in SEQ ID NO:2.
[0028] In some embodiments, the H-NOX comprises one or more distal pocket
mutations. In
some embodiments, the distal pocket mutation is an amino acid substitution at
a site
corresponding to L144 of T. tengcongensis H-NOX. In some embodiments, the H-
NOX is a T
tengcongensis H-NOX comprising an amino acid substitution at position 144. In
some
embodiments, the amino acid substitution at position 144 is an L144F
substitution.
[0029] In some embodiments, the H-NOX protein is a polymeric H-NOX protein. In
some
embodiments, the polymeric H-NOX protein comprises monomers, wherein the
monomers
comprise an H-NOX domain and a polymerization domain. In some embodiments, the
H-NOX
domain is covalently linked to the polymerization domain. In some embodiments,
the polymeric
H-NOX protein is a trimeric H-NOX protein. In some embodiments, the trimeric H-
NOX
protein comprises one or more trimerization domains. In some embodiments, the
trimeric H-
NOX protein comprises three monomers, wherein the monomers comprise an H-NOX
domain
and a trimerization domain, wherein the trimerization domain is a
bacteriophage T4
trimerization domain. In some embodiments, the trimerization domain is a
foldon domain. In
some embodiments, the foldon domain comprises the amino acid sequence of SEQ
ID NO:4.
8
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[0030] In some embodiments, the H-NOX protein is fused to an Fc domain of an
immunoglobulin. In some embodiments, the H-NOX protein is covalently bound to
polyethylene glycol.
[0031] In some embodiments, the 02 dissociation constant of the H-NOX protein
is within 2
orders of magnitude of that of hemoglobin, and wherein the NO reactivity of
the H-NOX protein
is at least 10-fold lower than that of hemoglobin. In some embodiments, the 02
dissociation
constant of the polymeric H-NOX protein is between about 1 nM and about 1000
nM at 20 C.
In some embodiments, the 02 dissociation constant of the H-NOX protein is
between about 1
uM and about 10 uM at 20 C. In some embodiments, the 02 dissociation constant
of the H-
NOX protein is between about 10 uM and about 50 uM at 20 C. In some
embodiments, the NO
reactivity of the H-NOX protein is less than about 700 s-1 at 20 C. In some
embodiments, the
NO reactivity of the H-NOX protein is at least 100-fold lower than that of
hemoglobin. In some
embodiments, the NO reactivity of the H-NOX protein is at least 1,000-fold
lower than that of
hemoglobin. In some embodiments, the koff for oxygen of the H-NOX protein is
less than or
equal to about 0.65 slat 20 C. In some embodiments, the koff for oxygen of
the H-NOX protein
is between about 0.21 s-land about 0.65 s-1 at 20 C. In some embodiments, the
koff for oxygen
of the H-NOX protein is between about 1.35 s-1 and about 2.9 s-1 at 20 C. In
some
embodiments, the rate of heme autoxidation of the H-NOX protein is less than
about 1 h-lat 37
C.
[0032] In some embodiments of the above embodiments, the H-NOX protein is in a
pharmaceutical composition. In some embodiments, the pharmaceutical
composition further
comprises a pharmaceutically acceptable carrier.
[0033] In some aspects the invention provides the use of an 02 carrier protein
for modulating
tumor immunity in an individual. In some embodiments, the modulating tumor
immunity
comprises enhancing an immune response to the tumor. In some embodiments, the
invention
provides the use of an 02 carrier polypeptide for increasing leucocyte
infiltration to a tumor in an
individual. In some embodiments, the invention provides the use of an 02
carrier polypeptide
for increasing lymphocyte infiltration to a tumor in an individual. In some
embodiments, the
increase in lymphocyte infiltration to the tumor comprises an increase in
infiltration of one or
more of CD4 cells, CD8 cells, or NK cells. In some embodiments, the increase
in lymphocyte
infiltration to the tumor is accompanied by inhibition of one or more of Treg
cells, tumor
associated macrophages or myeloid derived suppressor cells in the tumor. In
some
embodiments, the increase in leucocyte infiltration to the tumor is
accompanied by an increase in
9
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
MHC1 expression on the tumor cells. In some embodiments, the increase in
lymphocyte
infiltration to the tumor is accompanied by an increase in MHC1 expression on
the tumor cells.
[0034] In some embodiments, the invention provides the use of an 02 carrier
polypeptide for
decreasing expression of HIF-1a and/or HIF-2a in a tumor in an individual. In
some
embodiments, the invention provides the use of an 02 carrier polypeptide for
decreasing
expression of PD-Li in a tumor in an individual. In some embodiments, the
invention provides
the use of an 02 carrier polypeptide for decreasing expression of A2AR in a
tumor in an
individual.
[0035] In some embodiments of the above uses, the tumor is a brain tumor, a
glioblastoma, a
bone tumor, a pancreatic tumor, a skin tumor, a tumor of the head or neck, a
melanoma, a lung
tumor, a uterine tumor, an ovarian tumor, a colorectal tumor, an anal tumor, a
liver tumor, a
hepatocellular carcinoma, a stomach tumor, a testicular tumor, an endometrial
tumor, a cervical
tumor, a vaginal tumor, a Hodgkin's lymphoma, a non-Hodgkin's lymphoma, an
esophageal
tumor, an intestinal tumor, a thyroid tumor, an adrenal tumor, a bladder
tumor, a kidney tumor, a
breast tumor, a multiple myeloma tumor, a sarcoma, or a squamous cell tumor.
[0036] In some embodiments, the invention provides the use of an 02 carrier
protein for
treating cancer in an individual. In some embodiments, the cancer is brain
cancer, glioblastoma,
bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck,
melanoma, lung cancer,
uterine cancer, ovarian cancer, colorectal cancer, anal cancer, liver cancer,
hepatocellular
carcinoma, stomach cancer, testicular cancer, endometrial cancer, cervical
cancer, Hodgkin's
Disease, non-Hodgkin's lymphoma, esophageal cancer, intestinal cancer, thyroid
cancer, adrenal
cancer, bladder cancer, kidney cancer, breast cancer, multiple myeloma,
sarcoma, or squamous
cell cancer.
[0037] In some embodiments of the above uses, the individual is a mammal. In
some
embodiments, the mammal is a human.
[0038] In some embodiments of the above uses, the 02 carrier polypeptide is an
H-NOX
protein. In some embodiments, the H-NOX protein is a T tengcongensis H-NOX, a
L.
pneumophilia 2 H-NOX, a H. sapiens 131, a R. norvegicus 131, a C. lupus H-NOX,
a D.
melangaster 131, a D. melangaster CG14885-PA, a C. elegans GCY-35, a N.
punctiforme H-
NOX, C. crescentus H-NOX, a S. oneidensis H-NOX, or C. acetobutylicum H-NOX.
In some
embodiments, the H-NOX protein comprises a H-NOX domain corresponding to the H-
NOX
domain of T tengcongensis set forth in SEQ ID N0:2. In some embodiments, the H-
NOX
comprises one or more distal pocket mutations. In some embodiments, the distal
pocket
mutation is an amino acid substitution at a site corresponding to L144 of T
tengcongensis H-
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
NOX. In some embodiments, the H-NOX is a T. tengcongensis H-NOX comprising an
amino
acid substitution at position 144. In some embodiments, the amino acid
substitution at position
144 is an L144F substitution.
[0039] In some embodiments, the H-NOX protein is a polymeric H-NOX protein. In
some
embodiments, the polymeric H-NOX protein comprises monomers, wherein the
monomers
comprise an H-NOX domain and a polymerization domain. In some embodiments, the
H-NOX
domain is covalently linked to the polymerization domain. In some embodiments,
the polymeric
H-NOX protein is a trimeric H-NOX protein. In some embodiments, the trimeric H-
NOX
protein comprises one or more trimerization domains. In some embodiments, the
trimeric H-
NOX protein comprises three monomers, wherein the monomers comprise an H-NOX
domain
and a trimerization domain, wherein the trimerization domain is a
bacteriophage T4
trimerization domain. In some embodiments, the trimerization domain is a
foldon domain. In
some embodiments, the foldon domain comprises the amino acid sequence of SEQ
ID NO:4.
[0040] In some embodiments, the H-NOX protein is fused to an Fc domain of an
immunoglobulin. In some embodiments, the H-NOX protein is covalently bound to
polyethylene glycol.
[0041] In some aspects, the invention provides kits for modulating tumor
immunity in an
individual comprising an 02 carrier protein for use in the methods described
herein. In some
embodiments, the kit further comprises one or more of a vial, a vessel, an
ampule, a bottle, a
jars, or flexible packaging. In some embodiments, the kit further comprises
one or more buffer.
In some embodiments, the kit further comprises instructions for use.
11
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
BRIEF DESCRIPTION OF THE DRAWINGS
[0042] Figs. 1A and 1B shows a model of the major immunosuppressive pathways
promoted
by hypoxia (Fig. 1A) and the points of therapeutic intervention that may be
exerted by 02 carrier
polypeptide treatment (Fig. 1B).
[0043] Figs. 2A-2C show tumor oxygenation after single bolus dose of PEGylated
trimer Tt
H-NOX L144F assessed by pimonidazole and HIF-1 ELISA. Fig. 2A shows
pimonidazole
levels measured by competitive ELISA. Fig. 2B shows HIF-1 a levels measured by
sandwich
ELISA. Graphs show quantification of pimonidazole and HIF-la signals after
PEGylated trimer
Tt H-NOX L144F administration. Mean values +/- SEM. *** p<0.001, ** p<0.01 by
One way
ANOVA and Bonferroni's post-hoc tests. Fig. 2C shows assessment of tumors for
the
accumulation of PEGylated trimer Tt H-NOX L144F by sandwich H-NOX ELISA and
results
expressed per gram of tumor tissue.
[0044] Figs. 3A-3D show direct measurements of tumor tissue oxygenation
following
PEGylated trimer Tt H-NOX L144F administration. Tumors were treated either
with PEGylated
trimer Tt H-NOX L144F (Fig. 3A), non-functional control Tt H-NOX protein (Fig.
3C), or with
100% oxygen starting at p02= 0.44 mmHg (Fig. 3B) with 100% oxygen starting at
p02 = 5
mmHg (Fig. 3D).
[0045] Fig. 4 shows enhancement of radiation efficacy following PEGylated
trimer Tt H-NOX
L144F treatment of mice bearing H460 tumors. Mice bearing H460 subcutaneous
xenograft
tumors (150-300 mm3) were either pre-treated with PEGylated trimer Tt H-NOX
L144F or
treated with 10 Gy alone, irradiated, tumors extracted and processed for
clonogenic assay. Cell
numbers were counted 7 days later in triplicate samples from each tumor. Each
dot on the graph
represents average surviving fraction for one tumor.
[0046] Figs. 5A-5C show PEGylated trimer Tt H-NOX L144F downregulates HIF-la
targets
involved in immunosuppression. Mice bearing H460 subcutaneous xenograft tumors
(150-300
mm3) were either pre-treated with PEGylated trimer Tt H-NOX L144For treated
with vehicle
alone, and harvested for qRT-PCR analysis. Fig. 5A shows expression of VEGF.
Fig. 5B shows
expression of GLUT1. Fig. 5C shows expression of PD-Li.
[0047] Fig. 6A shows the nucleic acid (SEQ ID NO:5) and amino acid sequence
(SEQ ID
NO:6) of the foldon domain of bacteriophage T4 fibritin fused to the C-
terminus of a
Thermoanaerobacter tengcongensis L144F H-NOX sequence and including the His6
tag.
Fig. 6B shows the nucleic acid (SEQ ID NO:7) and amino acid sequence (SEQ ID
NO:8) of the
L144F H-NOX-foldon monomer without a His6 tag.
12
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[0048] Figs. 7A-7C show representative images of tumor hypoxia and T cell
infiltration is
B 16F10 subcutaneous tumors (Fig. 7A), CT26 subcutaneous tumors (Fig. 7B) and
GL261
intracranial tumors (Fig. 7C). Hypoxia (top panels) and T cell infiltration
(middle panels) is
shown by immunohistochemistry. Bottom panels show results of quantitative
analysis of
multiple tumor sections. Significantly fewer CD4 and CD8 T cells infiltrate
the hypoxic regions
of tumors.
[0049] Fig. 8 shows quantification of CD8 T cells in hypoxic areas of tumors
after H-NOX
treatment (OMX) or vehicle control treatment (Veh). Representative images are
shown.
Hypoxic areas were labeled with pimondazole by immunohistochemical analysis.
Following
OMX treatment there is an increase in CD4 (data not shown) and CD8 T cell
infiltration into
regions of tumors that were hypoxic prior to OMX administration.
[0050] Figs. 9A and 9B show quantification of T cells in normoxic and hypoxic
areas of
tumors after H-NOX treatment (OMX) or vehicle control treatment (Veh). Both
CD4 and CD8
T cells were evaluated. Tumor areas evaluated included areas on the periphery
of the tumor and
in the tumor center. Results of quantitative image analysis of multiple
sections are shown in Fig.
9A and representative images in Fig. 9B. Hypoxic areas were labelled using
immunohistochemical analysis of carbonic anhydrase IX (CAIX) expression.
Following OMX
treatment, there is an increase in CD4 and CD8 T cell infiltration into
regions of tumors that
were hypoxic prior to OMX administration.
[0051] Fig. 10 shows the results of immunohistochemistry for hypoxia
(pimondazole) and
CD3 vessels is GL261 tumor model.
[0052] Fig. 11 shows immunohistochemical analysis of H-NOX tumor penetration,
tumor
hypoxia and CD8 T cell localization in canine oral melanoma tumors. Tissues
were stained with
hematoxylin and eosin (H&E), DNA interchelating dye (DAPI) and with anti-H-NOX
(OMX),,
-carbonic anhydrase IX (CAIX) and -CD8 antibodies to assess CD8 lymphocyte
localization in
tumor regions that were hypoxic prior to H-NOX (OMX) treatment. Images reveal
CD8 positive
T cells localized throughout rregions of the tumor that were hypoxic prior to
H-NOX (OMX)
treatment (CAIX positive).
[0053] Figs. 12A-12K show that larger tumor size correlates with enhanced
hypoxia and
reduced lymphocyte infiltration in subcutaneous 4T1-Luc syngeneic mouse
tumors. Fig. 12A
shows tumor volumes on day 10 and day 14 post-implant. Fig. 12B shows fraction
of
lymphocytes within the viable cell population. Fig. 12C shows the absolute
lymphocyte cell
numbers within the viable population. Fig. 12D shows a negative correlation
between tumor
volume and percentage lymphocytes. Fig. 12E shows a positive correlation
between tumor
13
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
volume and percentage hypoxia. Fig. 12F shows a negative correlation between
percentage
hypoxia and percentage lymphocytes. Fig. 12G shows a negative correlation
between tumor
volume and percentage CD3-positive T cells. Fig. 12H shows a negative
correlation between
tumor volume and percentage CD4-positive T cells. Fig. 121 shows a negative
correlation
between tumor volume and percentage CD8-positive T cells. Fig. 12J shows a
negative
correlation between tumor volume and percentage CD3-CD4-double-positive T
cells. Fig. 12K
shows a negative correlation between tumor volume and percentage CD3-CD8-
double-positive
T cells.
[0054] Figs. 13A-13F shows that hypoxic tumor regions are immunosuppressive
and exhibit
reduced T cell infiltration in subcutaneous 4T1-Luc syngeneic mouse tumors.
Immunofluorescence staining of tumor region #1 for (Fig. 13A) pimonidazole-
positive hypoxic
areas and (Fig. 13B) CD8-positive T cells, counterstained with (Fig. 13C) DAPI
to highlight
nuclei. Immunofluorescence staining of tumor region #2 for (Fig. 13D)
pimonidazole-positive
hypoxic areas and (Fig. 13E) CD4-positive T cells, counterstained with (Fig.
13F) DAPI to
highlight nuclei.
DETAILED DESCRIPTION OF THE INVENTION
[0055] The present invention provides methods for treating cancer in an
individual comprising
administering to the individual an effective amount of an 02 carrier
polypeptide such as an H-
NOX protein. In certain aspects, the invention provides methods for modulating
hypoxia-
mediated tumor immunity in an individual comprising administering to the
individual an
effective amount of an 02 carrier polypeptide, such as an H-NOX protein. The
02 carrier
polypeptide is delivered to the tumor where it enhances an immune response to
the tumor.
Enhancement of an immune response to the tumor may be mediated by targeting
hypoxia
inducible factor la (HIF-1a)¨mediated pathways of tumor immunity and/or non-
HIF-la¨
mediated pathways of tumor immunity. In some aspects, the invention provides
methods for
increasing lymphocyte infiltration to a tumor in an individual comprising
administering to the
individual an effective amount of an 02 carrier polypeptide. In some
embodiments, the increase
in lymphocyte infiltration to the tumor comprises an increase in infiltration
of one or more of
CD4 cells, CD8 cells, or NK cells. In some embodiments, the increase in
lymphocyte
infiltration to the tumor is accompanied by inhibition of one or more of Treg
cells, tumor
associated macrophages or myeloid derived suppressor cells in the tumor. In
some
embodiments, the increase in lymphocyte infiltration to the tumor is
accompanied by an increase
in MHC1 expression on the tumor cells. In some embodiments, the invention
provides methods
14
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
for decreasing expression of hypoxia inducible factor 1a (HIF-1 a) in a tumor
in an individual
comprising administering to the individual an effective amount of an 02
carrier polypeptide
(e.g., an H-NOX protein). In some embodiments, the invention provides methods
for decreasing
expression of programmed death ligand-1 (PD-L1) in a tumor in an individual
comprising
administering to the individual an effective amount of an 02 carrier
polypeptide (e.g., an H-NOX
protein). In some embodiments, the invention provides methods for decreasing
expression of
A2A adenosine receptor (A2AR) in a tumor in an individual comprising
administering to the
individual an effective amount of an 02 carrier polypeptide (e.g., an H-NOX
protein).
Definitions
[0056] Unless defined otherwise, the meanings of all technical and scientific
terms used herein
are those commonly understood by one of skill in the art to which this
invention belongs. One of
skill in the art will also appreciate that any methods and materials similar
or equivalent to those
described herein can also be used to practice or test the invention.
[0057] For use herein, unless clearly indicated otherwise, use of the terms
"a", "an," and the
like refers to one or more.
[0058] In this application, the use of "or" means "and/or" unless expressly
stated or
understood by one skilled in the art. In the context of a multiple dependent
claim, the use of
"or" refers back to more than one preceding independent or dependent claim.
[0059] Reference to "about" a value or parameter herein includes (and
describes)
embodiments that are directed to that value or parameter per se. For example,
description
referring to "about X" includes description of "X."
[0060] It is understood that aspect and embodiments of the invention described
herein include
"comprising," "consisting," and "consisting essentially of' aspects and
embodiments.
[0061] The terms "polypeptide" and "protein" are used interchangeably to refer
to a polymer
of amino acid residues, and are not limited to a minimum length. Such polymers
of amino acid
residues may contain natural or non-natural amino acid residues, and include,
but are not limited
to, peptides, oligopeptides, dimers, trimers, and polymers of amino acid
residues. Both full-
length proteins and fragments thereof are encompassed by the definition. The
terms also include
post-expression modifications of the polypeptide, for example, glycosylation,
sialylation,
acetylation, phosphorylation, and the like. Furthermore, for purposes of the
present invention, a
"polypeptide" refers to a protein which includes modifications, such as
deletions, additions, and
substitutions (generally conservative in nature), to the native sequence, as
long as the protein
maintains the desired activity. These modifications may be deliberate, as
through site-directed
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
mutagenesis, or may be accidental, such as through mutations of hosts which
produce the
proteins or errors due to PCR amplification. As used herein, a protein may
include two or more
subunits, covalently or non-covalently associated; for example, a protein may
include two or
more associated monomers.
[0062] The terms "nucleic acid molecule", "nucleic acid" and "polynucleotide"
may be used
interchangeably, and refer to a polymer of nucleotides. Such polymers of
nucleotides may
contain natural and/or non-natural nucleotides, and include, but are not
limited to, DNA, RNA,
and PNA. "Nucleic acid sequence" refers to the linear sequence of nucleotides
that comprise the
nucleic acid molecule or polynucleotide.
[0063] As used herein, the term "hypoxia inducible factor" or "HIF" refers to
a family of
transcription factor that respond to decreases in oxygen, or hypoxia, in the
cellular environment.
Members of the human HIF family include HIF-la, HIF-1(3, HIF-2a, HIF-213,
HIF3a, HIF3(3.
HIF-1 functions as a master regulator of homeostatic responses to hypoxia by
activating
transcription of many genes, including those involved in energy metabolism,
angiogenesis,
apoptosis, and other genes whose protein products increase oxygen delivery or
facilitate
metabolic adaptation to hypoxia. HIF-1 plays a role in embryonic
vascularization, tumor
angiogenesis and pathophysiology of ischemic disease. Human hypoxia-inducible
factor 1,
alpha subunit or human HIF-1a interacts with a number of polypeptides
including but not
limited to ARNTL, ARNT, CREBB, EP300, HIF-1AN, Mdm2, NR4A, p53, PSMA7, STAT3,
UBC, VH and pVHL. Human HIF-la is encoded by the HIF-1A gene. The amino acid
sequence of human HIF-la is provided by GenBank Accession no. NP_001230013 and
the
nucleotide sequence of human HIF-1a mRNA is provided by GenBank Accession No.
NM_001243084. The amino acid sequence of mouse HIF-la is provided by GenBank
Accession no. NP_010431 and the nucleotide sequence of mouse HIF-la mRNA is
provided by
GenBank Accession No. NM_034561.
[0064] As used herein, "programmed death-ligand 1" or "PD-Li" refers to a
transmembrane
protein that is part of an immune checkpoint pathway that plays a role in
suppressing the
immune system. Interaction of PDL1 with the PD1 receptor or the B7.1 receptor
inhibits T cell
receptor-mediated activation of IL-2 and T cell proliferation. Human PD-Li is
encoded by the
CD27 4 gene. The amino acid sequence of human PD-Li is provided by GenBank
Accession no.
NP_001254635 and the nucleotide sequence of human PD-Li mRNA is provided by
GenBank
Accession No. NM_001267706. The amino acid sequence of mouse PD-Li is provided
by
GenBank Accession no. NP_021893 and the nucleotide sequence of mouse PD-Li
mRNA is
provided by GenBank Accession No. NM_068693.
16
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[0065] As used herein, an "adenosine A2A receptor" or "A2AR" refers to a
receptor of the G
protein-coupled receptor superfamily. A2AR is a receptor for adenosine that
plays a role in
oxygen consumption and is thought to play a role in suppressing overreactive
immune cells by
way or increased levels of cAMP. Human A2AR is encoded by ADORA2A the gene.
The
amino acid sequence of human A2AR is provided by GenBank Accession no.
NP_000666 and
the nucleotide sequence of human A2AR mRNA is provided by GenBank Accession
No.
NM_000675. The amino acid sequence of mouse A2AR is provided by GenBank
Accession no.
NP_033760 and the nucleotide sequence of mouse A2AR mRNA is provided by
GenBank
Accession No. NM_09630.
[0066] As used herein, an "H-NOX protein" means a protein that has an H-NOX
domain
(named for Heme-Nitric oxide and OXygen binding domain). An H-NOX protein may
or may
not contain one or more other domains in addition to the H-NOX domain. In some
examples, an
H-NOX protein does not comprise a guanylyl cyclase domain. An H-NOX protein
may or may
not comprise a polymerization domain.
[0067] As used herein, a "polymeric H-NOX protein" is an H-NOX protein
comprising two or
more H-NOX domains. The H-NOX domains may be covalently or non-covalently
associated.
[0068] As used herein, an "H-NOX domain" is all or a portion of a protein that
binds nitric
oxide and/or oxygen by way of heme. The H-NOX domain may comprise heme or may
be
found as an apoproprotein that is capable of binding heme. In some examples,
an H-NOX
domain includes six alpha-helices, followed by two beta-strands, followed by
one alpha-helix,
followed by two beta strands. In some examples, an H-NOX domain corresponds to
the H-NOX
domain of Thermoanaerobacter tengcongensis H-NOX set forth in SEQ ID NO:2. For
example,
the H-NOX domain may be at least about 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%,
70%,
80%, 90%, 95%, or 99% identical to the H-NOX domain of Thermoanaerobacter
tengcongensis
H-NOX set forth in SEQ ID NO:2. In some embodiments, the H-NOX domain may be
10%-
20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%,
95%-99% or 100% identical to the H-NOX domain of Thermoanaerobacter
tengcongensis H-
NOX set forth in SEQ ID NO:2.
[0069] As used herein, a "polymerization domain" is a domain (e.g. a
polypeptide domain)
that promotes the association of monomeric moieties to form a polymeric
structure. For
example, a polymerization domain may promote the association of monomeric H-
NOX domains
to generate a polymeric H-NOX protein. An exemplary polymerization domain is
the foldon
domain of T4 bacteriophage, which promotes the formation of trimeric
polypeptides. Other
examples of polymerization domains include, but are not limited to, Arc, POZ,
coiled coil
17
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
domains (including GCN4, leucine zippers, Velcro), uteroglobin, collagen, 3-
stranded coiled
colis (matrilin-1), thrombosporins, TRPV1-C, P53, Mnt, avadin, streptavidin,
Bcr-Abl, COMP,
verotoxin subunit B, CamKII, RCK, and domains from N ethylmaleimide-sensitive
fusion
protein, STM3548, KaiC, TyrR, Hcpl, CcmK4, GP41, anthrax protective antigen,
aerolysin, a-
hemolysin, C4b-binding protein, Mi-CK, arylsurfatase A, and viral capsid
proteins.
[0070] As used herein, an "amino acid linker sequence" or an "amino acid
spacer sequence" is
a short polypeptide sequence that may be used to link two domains of a
protein. In some
embodiments, the amino acid linker sequence is one, two, three, four, five,
six, seven, eight,
nine, ten or more than ten amino acids in length. Exemplary amino acid linker
sequences
include but are not limited to a Gly-Ser-Gly sequence and an Arg-Gly-Ser
sequence.
[0071] As used herein, a "His6 tag" refers to a peptide comprising six His
residues attached to
a polypeptide. A His6 tag may be used to facilitate protein purification; for
example, using
chromatography specific for the His6 tag. Following purification, the His6 tag
may be cleaved
using an exopeptidase.
[0072] The term "substantially similar" or "substantially the same," as used
herein, denotes a
sufficiently high degree of similarity between two or more numeric values such
that one of skill
in the art would consider the difference between the two or more values to be
of little or no
biological and/or statistical significance within the context of the
biological characteristic
measured by said value. In some embodiments the two or more substantially
similar values
differ by no more than about any one of 5%, 10%, 15%, 20%, 25%, or 50%.
[0073] The phrase "substantially reduced," or "substantially different," as
used herein, denotes
a sufficiently high degree of difference between two numeric values such that
one of skill in the
art would consider the difference between the two values to be of statistical
significance within
the context of the biological characteristic measured by said values. In some
embodiments, the
two substantially different numeric values differ by greater than about any
one of 10%, 20%,
25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, or 90%. In some embodiment, the
two
substantially different numeric values differ by about any one of 10%-20%, 20%-
30%, 30%-
40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-99% or 100%.
[0074] A "native sequence" polypeptide comprises a polypeptide having the same
amino acid
sequence as a polypeptide found in nature. Thus, a native sequence polypeptide
can have the
amino acid sequence of naturally occurring polypeptide from any organism. Such
native
sequence polypeptide can be isolated from nature or can be produced by
recombinant or
synthetic means. The term "native sequence" polypeptide specifically
encompasses naturally
occurring truncated or secreted forms of the polypeptide (e.g., an
extracellular domain
18
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
sequence), naturally occurring variant forms (e.g., alternatively spliced
forms) and naturally
occurring allelic variants of the polypeptide.
[0075] A polypeptide "variant" means a biologically active polypeptide having
at least about
80% amino acid sequence identity with the native sequence polypeptide after
aligning the
sequences and introducing gaps, if necessary, to achieve the maximum percent
sequence
identity, and not considering any conservative substitutions as part of the
sequence identity.
Such variants include, for instance, polypeptides wherein one or more amino
acid residues are
added, or deleted, at the N- or C-terminus of the polypeptide. In some
embodiments, a variant
will have at least about any one of 80%, 90% or 95% amino acid sequence
identity with the
native sequence polypeptide. In some embodiments, a variant will have about
any one of 80%-
90%, 90%-95% or 95% -99% amino acid sequence identity with the native sequence
polypeptide.
[0076] As used herein, a "mutant protein" means a protein with one or more
mutations
compared to a protein occurring in nature. In one embodiment, the mutant
protein has a
sequence that differs from that of all proteins occurring in nature. In
various embodiments, the
amino acid sequence of the mutant protein is at least about any of 10, 15, 20,
25, 30, 40, 50, 60,
70, 80, 90, 95, 97, 98, 99, or 99.5% identical to that of the corresponding
region of a protein
occurring in nature. In some embodiments, the amino acid sequence of the
mutant protein is at
least about any of 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-
80%,
80%-90%, 90%-95%, 95%-99% or 100% identical to that of the corresponding
region of a
protein occurring in nature. In some embodiments, the mutant protein is a
protein fragment that
contains at least about any of 25, 50, 75, 100, 150, 200, 300, or 400
contiguous amino acids from
a full-length protein. In some embodiments, the mutant protein is a protein
fragment that
contains about any of 25-50, 50-75, 75-100, 100-150, 150-200, 200-300, or 300-
400 contiguous
amino acids from a full-length protein. Sequence identity can be measured, for
example, using
sequence analysis software with the default parameters specified therein
(e.g., Sequence
Analysis Software Package of the Genetics Computer Group, University of
Wisconsin
Biotechnology Center, 1710 University Avenue, Madison, WI 53705). This
software program
matches similar sequences by assigning degrees of homology to various amino
acids
replacements, deletions, and other modifications.
[0077] As used herein, a "mutation" means an alteration in a reference nucleic
acid or amino
acid sequence occurring in nature. Exemplary nucleic acid mutations include an
insertion,
deletion, frameshift mutation, silent mutation, nonsense mutation, or missense
mutation. In
some embodiments, the nucleic acid mutation is not a silent mutation.
Exemplary protein
19
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
mutations include the insertion of one or more amino acids (e.g., the
insertion of 2, 3, 4, 5, 6, 7,
8, 9, or 10 amino acids), the deletion of one or more amino acids (e.g., a
deletion of N-terminal,
C-terminal, and/or internal residues, such as the deletion of at least about
any of 5, 10, 15, 25,
50, 75, 100, 150, 200, 300, or more amino acids or a deletion of about any of
5-10, 10-15, 15-25,
25-50, 50-75, 75-100, 100-150, 150-200, 200-300, or 300-400 amino acids), the
replacement of
one or more amino acids (e.g., the replacement of 1, 2, 3, 4, 5, 6, 7, 8, 9,
or 10 amino acids), or
combinations of two or more of the foregoing. The nomenclature used in
referring to a
particular amino acid mutation first identifies the wild-type amino acid,
followed by the residue
number and finally the substitute amino acid. For example, Y140L means that
tyrosine has been
replaced by a leucine at residue number 140. Likewise, a variant H-NOX protein
may be
referred to by the amino acid variations of the H-NOX protein. For example, a
T tengcongensis
Y140L H-NOX protein refers to a T tengcongensis H-NOX protein in which the
tyrosine
residue at position number 140 has been replaced by a leucine residue and a T
tengcongensis
W9F/Y140L H-NOX protein refers to a T tengcongensis H-NOX protein in which the
tryptophan residue at position 9 has been replaced by a phenylalanine residue
and the tyrosine
residue at position number 140 has been replaced by a leucine residue.
[0078] An "evolutionary conserved mutation" is the replacement of an amino
acid in one
protein by an amino acid in the corresponding position of another protein in
the same protein
family.
[0079] As used herein, "derived from" refers to the source of the protein into
which one or
more mutations is introduced. For example, a protein that is "derived from a
mammalian
protein" refers to protein of interest that results from introducing one or
more mutations into the
sequence of a wild-type (i.e., a sequence occurring in nature) mammalian
protein.
[0080] As used herein, "Percent (%) amino acid sequence identity" and
"homology" with
respect to a peptide, polypeptide or antibody sequence are defined as the
percentage of amino
acid residues in a candidate sequence that are identical with the amino acid
residues in the
specific peptide or polypeptide sequence, after aligning the sequences and
introducing gaps, if
necessary, to achieve the maximum percent sequence identity, and not
considering any
conservative substitutions as part of the sequence identity. Alignment for
purposes of
determining percent amino acid sequence identity can be achieved in various
ways that are
within the skill in the art, for instance, using publicly available computer
software such as
BLAST, BLAST-2, ALIGN or MEGALIGNTM (DNASTAR) software. Those skilled in the
art
can determine appropriate parameters for measuring alignment, including any
algorithms needed
to achieve maximal alignment over the full length of the sequences being
compared.
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[0081] As used herein, a "koff" refers to a dissociation rate, such as the
rate of release of 02 or
NO from a protein. A lower numerical lower koff indicates a slower rate of
dissociation.
[0082] As used herein, "Icon" refers to an association rate, such as the rate
of binding of 02 or
NO to a protein. A lower numerical lower Icon indicates a slower rate of
association.
[0083] As used herein, "dissociation constant" refers to a "kinetic
dissociation constant" or a
"calculated dissociation constant." A "kinetic dissociation constant" or "KD"
is a ratio of kinetic
off-rate (koff) to kinetic on-rate (Icon), such as a KD value determined as an
absolute value using
standard methods (e.g., standard spectroscopic, stopped-flow, or flash-
photolysis methods)
including methods known to the skilled artisan and/or described herein.
"Calculated dissociation
constant" or "calculated KD" refers to an approximation of the kinetic
dissociation constant
based on a measured koff. A value for the Icon is derived via the correlation
between kinetic KD
and koff as described herein.
[0084] As used herein, "oxygen affinity" is a qualitative term that refers to
the strength of
oxygen binding to the heme moiety of a protein. This affinity is affected by
both the koff and Icor,
for oxygen. A numerically lower oxygen KD value means a higher affinity.
[0085] As used herein, "NO affinity" is a qualitative term that refers to the
strength of NO
binding to a protein (such as binding to a heme group or to an oxygen bound to
a heme group
associated with a protein). This affinity is affected by both the koff and
Icon for NO. A
numerically lower NO KD value means a higher affinity.
[0086] As used herein, "NO stability" refers to the stability or resistance of
a protein to
oxidation by NO in the presence of oxygen. For example, the ability of the
protein to not be
oxidized when bound to NO in the presence of oxygen is indicative of the
protein's NO stability.
In some embodiments, less than about any of 50, 40, 30, 10, or 5% of an H-NOX
protein is
oxidized after incubation for about any of 1, 2, 4, 6, 8, 10, 15, or 20 hours
at 20 C.
[0087] As used herein, "NO reactivity" refers to the rate at which iron in the
heme of a heme-
binding protein is oxidized by NO in the presence of oxygen. A lower numerical
value for NO
reactivity in units of s-1 indicates a lower NO reactivity
[0088] As used herein, an "autoxidation rate" refers to the rate at which iron
in the heme of a
heme-binding protein is autoxidized. A lower numerical autoxidation rate in
units of s-1
indicates a lower autoxidation rate.
[0089] The term "vector" is used to describe a polynucleotide that may be
engineered to
contain a cloned polynucleotide or polynucleotides that may be propagated in a
host cell. A
vector may include one or more of the following elements: an origin of
replication, one or more
regulatory sequences (such as, for example, promoters and/or enhancers) that
regulate the
21
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
expression of the polypeptide of interest, and/or one or more selectable
marker genes (such as,
for example, antibiotic resistance genes and genes that may be used in
colorimetric assays, e.g.,
0-galactosidase). The term "expression vector" refers to a vector that is used
to express a
polypeptide of interest in a host cell.
[0090] A "host cell" refers to a cell that may be or has been a recipient of a
vector or isolated
polynucleotide. Host cells may be prokaryotic cells or eukaryotic cells.
Exemplary eukaryotic
cells include mammalian cells, such as primate or non-primate animal cells;
fungal cells, such as
yeast; plant cells; and insect cells. Exemplary prokaryotic cells include
bacterial cells; for
example, E. coli cells.
[0091] The term "isolated" as used herein refers to a molecule that has been
separated from at
least some of the components with which it is typically found in nature or
produced. For
example, a polypeptide is referred to as "isolated" when it is separated from
at least some of the
components of the cell in which it was produced. Where a polypeptide is
secreted by a cell after
expression, physically separating the supernatant containing the polypeptide
from the cell that
produced it is considered to be "isolating" the polypeptide. Similarly, a
polynucleotide is
referred to as "isolated" when it is not part of the larger polynucleotide
(such as, for example,
genomic DNA or mitochondrial DNA, in the case of a DNA polynucleotide) in
which it is
typically found in nature, or is separated from at least some of the
components of the cell in
which it was produced, e.g., in the case of an RNA polynucleotide. Thus, a DNA
polynucleotide
that is contained in a vector inside a host cell may be referred to as
"isolated".
[0092] The terms "individual" or "subject" are used interchangeably herein to
refer to an
animal; for example a mammal. In some embodiments, methods of treating
mammals, including,
but not limited to, humans, rodents, simians, felines, canines, equines,
bovines, porcines, ovines,
caprines, mammalian laboratory animals, mammalian farm animals, mammalian
sport animals,
and mammalian pets, are provided. In some examples, an "individual" or
"subject" refers to an
individual or subject in need of treatment for a disease or disorder.
[0093] A "disease" or "disorder" as used herein refers to a condition where
treatment is
needed.
[0094] The term "cancer" refers to a malignant proliferative disorder
associated with
uncontrolled cell proliferation, unrestrained cell growth, and decreased cell
death via apoptosis.
[0095] The term "tumor" is used herein to refer to a group of cells that
exhibit abnormally
high levels of proliferation and growth. A tumor may be benign, pre-malignant,
or malignant;
malignant tumor cells are cancerous. Tumor cells may be solid tumor cells or
leukemic tumor
22
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
cells. The term "tumor growth" is used herein to refer to proliferation or
growth by a cell or
cells that comprise a tumor that leads to a corresponding increase in the size
of the tumor.
[0096] As used herein, "treatment" is an approach for obtaining beneficial or
desired clinical
results. "Treatment" as used herein, covers any administration or application
of a therapeutic for
disease in a mammal, including a human. For purposes of this invention,
beneficial or desired
clinical results include, but are not limited to, alleviation of symptoms,
diminishment of extent
of disease, stabilized (e.g., not worsening) state of disease, preventing
spread (e.g., metastasis) of
disease, delay or slowing of disease progression, amelioration or palliation
of the disease state,
and remission (whether partial or total), whether detectable or undetectable.
"Treatment" can
also mean prolonging survival as compared to expected survival if not
receiving treatment. Also
encompassed by "treatment" is a reduction of pathological consequence of a
proliferative
disease. The methods of the invention contemplate any one or more of these
aspects of
treatment.
[0097] In the context of cancer, the term "treating" includes any or all of:
inhibiting growth of
tumor cells or cancer cells, inhibiting replication of tumor cells or cancer
cells, lessening of
overall tumor burden and ameliorating one or more symptoms associated with the
disease.
[0098] The terms "inhibition" or "inhibit" refer to a decrease or cessation of
any phenotypic
characteristic or to the decrease or cessation in the incidence, degree, or
likelihood of that
characteristic. To "reduce" or "inhibit" is to decrease, reduce or arrest an
activity, function,
and/or amount as compared to a reference. In certain embodiments, by "reduce"
or "inhibit" is
meant the ability to cause an overall decrease of 20% or greater. In another
embodiment, by
"reduce" or "inhibit" is meant the ability to cause an overall decrease of 50%
or greater. In yet
another embodiment, by "reduce" or "inhibit" is meant the ability to cause an
overall decrease of
75%, 85%,90%, 95%, or 99%.
[0099] As used herein, "delaying development of a disease" means to defer,
hinder, slow,
retard, stabilize, suppress and/or postpone development of the disease (such
as cancer). This
delay can be of varying lengths of time, depending on the history of the
disease and/or individual
being treated. As is evident to one skilled in the art, a sufficient or
significant delay can, in
effect, encompass prevention, in that the individual does not develop the
disease. For example, a
late stage cancer, such as development of metastasis, may be delayed.
[00100] A "reference" as used herein, refers to any sample, standard, or level
that is used for
comparison purposes. A reference may be obtained from a healthy and/or non-
diseased sample.
In some examples, a reference may be obtained from an untreated sample. In
some examples, a
reference is obtained from a non-diseased on non-treated sample of a subject
individual. In
23
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
some examples, a reference is obtained from one or more healthy individuals
who are not the
subject or patient.
[00101] "Preventing," as used herein, includes providing prophylaxis with
respect to the
occurrence or recurrence of a disease in a subject that may be predisposed to
the disease but has
not yet been diagnosed with the disease.
[00102] An "effective amount" of an agent refers to an amount effective, at
dosages and for
periods of time necessary, to achieve the desired therapeutic or prophylactic
result.
[00103] A "therapeutically effective amount" of a substance/molecule of the
invention, agonist
or antagonist may vary according to factors such as the disease state, age,
sex, and weight of the
individual, and the ability of the substance/molecule, agonist or antagonist
to elicit a desired
response in the individual. A therapeutically effective amount is also one in
which any toxic or
detrimental effects of the substance/molecule, agonist or antagonist are
outweighed by the
therapeutically beneficial effects. A therapeutically effective amount may be
delivered in one or
more administrations.
[00104] A "prophylactically effective amount" refers to an amount effective,
at dosages and for
periods of time necessary, to achieve the desired prophylactic result.
Typically but not
necessarily, since a prophylactic dose is used in subjects prior to or at an
earlier stage of disease,
the prophylactically effective amount will be less than the therapeutically
effective amount.
[00105] The terms "pharmaceutical formulation" and "pharmaceutical
composition" refer to a
preparation which is in such form as to permit the biological activity of the
active ingredient(s)
to be effective, and which contains no additional components which are
unacceptably toxic to a
subject to which the formulation would be administered. Such formulations may
be sterile and
essentially free of endotoxins.
[00106] A "pharmaceutically acceptable carrier" refers to a non-toxic solid,
semisolid, or liquid
filler, diluent, encapsulating material, formulation auxiliary, or carrier
conventional in the art for
use with a therapeutic agent that together comprise a "pharmaceutical
composition" for
administration to a subject. A pharmaceutically acceptable carrier is non-
toxic to recipients at
the dosages and concentrations employed and is compatible with other
ingredients of the
formulation. The pharmaceutically acceptable carrier is appropriate for the
formulation
employed.
[00107] A "sterile" formulation is aseptic or essentially free from living
microorganisms and
their spores.
[00108] Administration "in combination with" one or more further therapeutic
agents includes
simultaneous (concurrent) and consecutive or sequential administration in any
order.
24
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[00109] The term "concurrently" is used herein to refer to administration of
two or more
therapeutic agents, where at least part of the administration overlaps in time
or where the
administration of one therapeutic agent falls within a short period of time
relative to
administration of the other therapeutic agent. For example, the two or more
therapeutic agents
are administered with a time separation of no more than about 60 minutes, such
as no more than
about any of 30, 15, 10, 5, or 1 minutes.
[00110] The term "sequentially" is used herein to refer to administration of
two or more
therapeutic agents where the administration of one or more agent(s) continues
after
discontinuing the administration of one or more other agent(s). For example,
administration of
the two or more therapeutic agents are administered with a time separation of
more than about
15 minutes, such as about any of 20, 30, 40, 50, or 60 minutes, 1 day, 2 days,
3 days, 1 week, 2
weeks, or 1 month.
[00111] As used herein, "in conjunction with" refers to administration of one
treatment
modality in addition to another treatment modality. As such, "in conjunction
with" refers to
administration of one treatment modality before, during or after
administration of the other
treatment modality to the individual.
[00112] The term "package insert" is used to refer to instructions customarily
included in
commercial packages of therapeutic products, that contain information about
the indications,
usage, dosage, administration, combination therapy, contraindications and/or
warnings
concerning the use of such therapeutic products.
[00113] An "article of manufacture" is any manufacture (e.g., a package or
container) or kit
comprising at least one reagent, e.g., a medicament for treatment of a disease
or disorder (e.g.,
cancer), or a probe for specifically detecting a biomarker described herein.
In certain
embodiments, the manufacture or kit is promoted, distributed, or sold as a
unit for performing
the methods described herein.
H-NOX Proteins
Overview of H-NOX Protein Family
[00114] Unless otherwise indicated, any wild-type or mutant H-NOX protein can
be used in the
compositions, kits, and methods as described herein. As used herein, an "H-NOX
protein"
means a protein that has an H-NOX domain (named for Heme-Nitric oxide and
OXygen binding
domain). An H-NOX protein may or may not contain one or more other domains in
addition to
the H-NOX domain. H-NOX proteins are members of a highly-conserved, well-
characterized
family of hemoproteins (Iyer, L. M. et al. (February 3, 2003). BMC Genomics
4(1):5; Karow,
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
D. S. et al. (August 10, 2004). Biochemistry 43(31):10203-10211; Boon, E. M.
et al. (2005).
Nature Chem. Biol. 1:53-59; Boon, E. M. et al. (October 2005). Curr. Opin.
Chem. Biol.
9(5):441-446; Boon, E. M. et al. (2005). J. Inorg. Biochem. 99(4):892-902). H-
NOX proteins
are also referred to as Pfam 07700 proteins or HNOB proteins (Pfam - A
database of protein
domain family alignments and Hidden Markov Models, Copyright (C) 1996-2006 The
Pfam
Consortium; GNU LGPL Free Software Foundation, Inc., 59 Temple Place - Suite
330, Boston,
MA 02111-1307, USA). In some embodiments, an H-NOX protein has, or is
predicted to have,
a secondary structure that includes six alpha-helices, followed by two beta-
strands, followed by
one alpha-helix, followed by two beta-strands. An H-NOX protein can be an
apoprotein that is
capable of binding heme or a holoprotein with heme bound. An H-NOX protein can
covalently
or non-covalently bind a heme group. Some H-NOX proteins bind NO but not 02,
and others
bind both NO and 02. H-NOX domains from facultative aerobes that have been
isolated bind
NO but not 02. H-NOX proteins from obligate aerobic prokaryotes, C. elegans,
and D.
melanogaster bind NO and 02 Mammals have two H-NOX proteins: 131 and 132. An
alignment
of mouse, rat, cow, and human H-NOX sequences shows that these species share
>99% identity.
In some embodiments, the H-NOX domain of an H-NOX protein or the entire H-NOX
protein is
at least about any of 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 95, 97, 98,
99, or 99.5% identical
to that of the corresponding region of a naturally-occurring
Thermoanaerobacter tengcongensis
H-NOX protein (e.g. SEQ ID NO:2) or a naturally-occurring sGC protein (e.g., a
naturally-
occurring sGC 131 protein). In some embodiments, the H-NOX domain of an H-NOX
protein or
the entire H-NOX protein is at least about any of 10-20%, 20-30%, 30-40%, 40-
50%, 50-60%,
60-70%, 70-80%, 80-90%, 90-95%, 95-99, or 99-99.9% identical to that of the
corresponding
region of a naturally-occurring Thermoanaerobacter tengcongensis H-NOX protein
(e.g. SEQ
ID NO:2) or a naturally-occurring sGC protein (e.g., a naturally-occurring sGC
131 protein). As
discussed further herein, an H-NOX protein may optionally contain one or more
mutations
relative to the corresponding naturally-occurring H-NOX protein. In some
embodiments, the H-
NOX protein includes one or more domains in addition to the H-NOX domain. In
particular
embodiments, the H-NOX protein includes one or more domains or the entire
sequence from
another protein. For example, the H-NOX protein may be a fusion protein that
includes an H-
NOX domain and part or all of another protein, such as albumin (e.g., human
serum albumin).
In some embodiments, only the H-NOX domain is present. In some embodiments,
the H-NOX
protein does not comprise a guanylyl cyclase domain. In some embodiments, the
H-NOX
protein comprises a tag; for example, a His6 tag.
Polymeric H-NOX proteins
26
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[00115] In some aspects, the invention provides polymeric H-NOX proteins
comprising two or
more H-NOX domains. The two or more H-NOX domains may be covalently linked or
noncovalently linked. In some embodiments, the polymeric H-NOX protein is in
the form of a
dimer, a trimer, a tetramer, a pentamer, a hexamer, a heptamer, an octomer, a
nanomer, or a
decamer. In some embodiments, the polymeric H-NOX protein comprises homologous
H-NOX
domains. In some embodiments, the polymeric H-NOX protein comprises
heterologous H-NOX
domains; for example, the H-NOX domains may comprises amino acid variants of a
particular
species of H-NOX domain or may comprise H-NOX domains from different species.
In some
embodiments, at least one of the H-NOX domains of a polymeric H-NOX protein
comprises a
mutation corresponding to an L144F mutation of T tengcongensis H-NOX. In some
embodiments, at least one of the H-NOX domains of a polymeric H-NOX protein
comprises a
mutation corresponding to a W9F/L144F mutation of T tengcongensis H-NOX. In
some
embodiments, the polymeric H-NOX proteins comprise one or more polymerization
domains.
In some embodiments, the polymeric H-NOX protein is a trimeric H-NOX protein.
In some
embodiments, the polymeric H-NOX protein comprises at least one trimerization
domain. In
some embodiments, the trimeric H-NOX protein comprises three T tengcongensis H-
NOX
domains. In some embodiments the trimeric H-NOX domain comprises three T
tengcongensis
L144F H-NOX domains (trimeric Tt H-NOX L144F). In some embodiments the
trimeric H-
NOX domain comprises three T tengcongensis W9F/L144F H-NOX domains
[00116] In some aspects of the invention, the polymeric H-NOX protein
comprises two or more
associated monomers. The monomers may be covalently linked or noncovalently
linked. In
some embodiments, monomeric subunits of a polymeric H-NOX protein are produced
where the
monomeric subunits associate in vitro or in vivo to form the polymeric H-NOX
protein. In some
embodiments, the monomers comprise an H-NOX domain and a polymerization
domain. In
some embodiments, the polymerization domain is covalently linked to the H-NOX
domain; for
example, the C-terminus of the H-NOX domain is covalently linked to the N-
terminus or the C-
terminus of the polymerization domain. In other embodiments, the N-terminus of
the H-NOX
domain is covalently linked to the N-terminus or the C-terminus of the
polymerization domain.
In some embodiments, an amino acid spacer is covalently linked between the H-
NOX domain
and the polymerization domain. An "amino acid spacer" and an "amino acid
linker" are used
interchangeably herein. In some embodiments, at least one of the monomeric
subunits of a
polymeric H-NOX protein comprises a mutation corresponding to an L144F
mutation of T
tengcongensis H-NOX. In some embodiments, at least one of the monomeric
subunits of a
polymeric H-NOX protein comprises a mutation corresponding to a W9F/L144F
mutation of T
27
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
tengcongensis H-NOX. In some embodiments the polymeric H-NOX protein is a
trimeric H-
NOX protein. In some embodiments, the monomer of a trimeric H-NOX protein
comprises an
H-NOX domain and a foldon domain of T4 bacteriophage. In some embodiments, the
monomer
of a trimeric H-NOX protein comprises a T tengcongensis H-NOX domain and a
foldon
domain. In some embodiments, the monomer of a trimeric H-NOX protein comprises
a T
tengcongensis L144F H-NOX domain and a foldon domain. In some embodiments, the
monomer of a trimeric H-NOX protein comprises a T tengcongensis W9F/L144F H-
NOX
domain and a foldon domain. In some embodiments, the trimer H-NOX protein
comprises three
monomers, each monomer comprising a T tengcongensis L144F H-NOX domain and a
foldon
domain. In some embodiments, the H-NOX domain is linked to the foldon domain
with an
amino acid linker; for example a Gly-Ser-Gly linker. In some embodiments, at
least one H-
NOX domain comprises a tag. In some embodiments, at least one H-NOX domain
comprises a
His6 tag. In some embodiments, the His6 tag is linked to the foldon domain
with an amino acid
linker; for example an Arg-Gly-Ser linker. In some embodiments, all of the H-
NOX domains
comprise a His6 tag. In some embodiments, the trimeric H-NOX protein comprises
the amino
acid sequence set forth in SEQ ID NO:6 or SEQ ID NO:8.
[00117] The exemplary H-NOX domain from T tengcongensis is approximately 26.7
kDal. In
some embodiments, the polymeric H-NOX protein has an atomic mass greater than
any of about
50 kDal, 75 kDal, 100 kDal, 125kDal, to about 150 kDal.
[00118] The invention provides polymeric H-NOX proteins that show greater
accumulation in
one or more tissues in an individual compared to a corresponding monomeric H-
NOX protein
comprising a single H-NOX domain following administration of the H-NOX protein
to the
individual. A corresponding H-NOX protein refers to a monomeric form of the H-
NOX protein
comprising at least one of the H-NOX domains of the polymeric H-NOX protein.
Tissues of
preferential polymeric H-NOX accumulation include, but are not limited to
tumors and tissue
with damaged vasculature. In some embodiments the polymeric H-NOX protein
persists in a
mammal for at least about 1, 2, 3, 4, 6, 12 or 24 hours following
administration of the H-NOX
protein to the individual. In some embodiments the polymeric H-NOX protein
persists in a
mammal for about 1-2, 2-3, 3-4, 4-6, 6-12 or 12-24 hours following
administration of the H-
NOX protein to the individual In some embodiments, less than about 10% of the
polymeric H-
NOX is cleared from mammal by the kidneys within less than any of about 1
hour, 2 hours or 3
hours following administration of the H-NOX protein to the individual.
Sources of H-NOX Proteins and H-NOX domains
28
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[00119] H-NOX proteins and H-NOX domains from any genus or species can be used
in the
compositions, kits, and methods described herein. In various embodiments, the
H-NOX protein
or the H-NOX domains of a polymeric H-NOX protein is a protein or domain from
a mammal
(e.g., a primate (e.g., human, monkey, gorilla, ape, lemur, etc), a bovine, an
equine, a porcine, a
canine, or a feline), an insect, a yeast, or a bacteria or is derived from
such a protein. Exemplary
mammalian H-NOX proteins include wild-type human and rat soluble guanylate
cyclase (such as
the 131 subunit). Non-limiting examples of H-NOX proteins include wild-type
mammalian H-
NOX proteins, e.g. H. sapiens, M. musculus, C. familiaris, B. Taurus, C. lupus
and R.
norvegicus and examples of prokaryotic wild-type H-NOX proteins include T ten
gcongensis, V.
cholera, V. fischerii, N. punctiforme, D. desulfuricans, L. pneumophila 1, L.
pneumophila 2, and
C. acetobutylicum. Examples of H-NOX proteins including their NCBI accession
numbers may
be found in US Patent Nos 8,404,631 and 8,404,632, WO 2007/139791 and WO
2007/139767;
the contents of each is incorporated herein by reference in its entirety.
[00120] Additional H-NOX proteins, H-NOX domains of polymeric H-NOX proteins,
and
nucleic acids, which may be suitable for use in the pharmaceutical
compositions and methods
described herein, can be identified using standard methods. For example,
standard sequence
alignment and/or structure prediction programs can be used to identify
additional H-NOX
proteins and nucleic acids based on the similarity of their primary and/or
predicted protein
secondary structure with that of known H-NOX proteins and nucleic acids. For
example, the
Pfam database uses defined alignment algorithms and Hidden Markov Models (such
as Pfam
21.0) to categorize proteins into families, such as the H-NOX protein family
(Pfam - A database
of protein domain family alignments and Hidden Markov Models, Copyright (C)
1996-2006 The
Pfam Consortium; GNU LGPL Free Software Foundation, Inc., 59 Temple Place -
Suite 330,
Boston, MA 02111-1307, USA). Standard databases such as the swissprot-trembl
database
(world-wide web at "expasy.org", Swiss Institute of Bioinformatics Swiss-Prot
group CMU - 1
rue Michel Servet CH-1211 Geneva 4, Switzerland) can also be used to identify
members of the
H-NOX protein family. The secondary and/or tertiary structure of an H-NOX
protein can be
predicted using the default settings of standard structure prediction
programs, such as
PredictProtein (630 West, 168 Street, BB217, New York, N.Y. 10032, USA).
Alternatively, the
actual secondary and/or tertiary structure of an H-NOX protein can be
determined using standard
methods.
[00121] In some embodiments, the H-NOX domain has the same amino acid in the
corresponding position as any of following distal pocket residues in T
tengcongensis H-NOX:
Thr4, Ile5, Thr8, Trp9, Trp67, Asn74, 11e75, Phe78, Phe82, Tyr140, Leu144, or
any combination
29
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
of two or more of the foregoing. In some embodiments, the H-NOX domain has a
proline or an
arginine in a position corresponding to that of Proll5 or Arg135 of T
tengcongensis H-NOX,
respectively, based on sequence alignment of their amino acid sequences. In
some
embodiments, the H-NOX domain has a histidine that corresponds to His105 of R.
norvegicus
131 H-NOX. In some embodiments, the H-NOX domain has or is predicted to have a
secondary
structure that includes six alpha-helices, followed by two beta-strands,
followed by one alpha-
helix, followed by two beta-strands. This secondary structure has been
reported for H-NOX
proteins.
[00122] If desired, a newly identified H-NOX protein or H-NOX domain can be
tested to
determine whether it binds heme using standard methods. The ability of an H-
NOX domain to
function as an 02 carrier can be tested by determining whether the H-NOX
domain binds 02
using standard methods, such as those described herein. If desired, one or
more of the mutations
described herein can be introduced into the H-NOX domain to optimize its
characteristics as an
02 carrier. For example, one or more mutations can be introduced to alter its
02 dissociation
constant, koff for oxygen, rate of heme autoxidation, NO reactivity, NO
stability or any
combination of two or more of the foregoing. Standard techniques such as those
described
herein can be used to measure these parameters.
Mutant H-NOX Proteins
[00123] As discussed further herein, an H-NOX protein or an H-NOX domain of a
polymeric
H-NOX protein may contain one or more mutations, such as a mutation that
alters the 02
dissociation constant, the koff for oxygen, the rate of heme autoxidation, the
NO reactivity, the
NO stability, or any combination of two or more of the foregoing compared to
that of the
corresponding wild-type protein. In some embodiments, the invention provides a
polymeric H-
NOX protein comprising one or more H-NOX domains that may contain one or more
mutations,
such as a mutation that alters the 02 dissociation constant, the koff for
oxygen, the rate of heme
autoxidation, the NO reactivity, the NO stability, or any combination of two
or more of the
foregoing compared to that of the corresponding wild-type protein. Panels of
engineered H-
NOX domains may be generated by random mutagenesis followed by empirical
screening for
requisite or desired dissociation constants, dissociation rates, NO-
reactivity, stability, physio-
compatibility, or any combination of two or more of the foregoing in view of
the teaching
provided herein using techniques as described herein and, additionally, as
known by the skilled
artisan. Alternatively, mutagenesis can be selectively targeted to particular
regions or residues
such as distal pocket residues apparent from the experimentally determined or
predicted three-
dimensional structure of an H-NOX protein (see, for example, Boon, E. M. et
al. (2005). Nature
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
Chemical Biology 1:53-59, which is hereby incorporated by reference in its
entirety, particularly
with respect to the sequences of wild-type and mutant H-NOX proteins) or
evolutionarily
conserved residues identified from sequence alignments (see, for example, Boon
E.M. et al.
(2005). Nature Chemical Biology 1:53-59, which is hereby incorporated by
reference in its
entirety, particularly with respect to the sequences of wild-type and mutant H-
NOX proteins).
[00124] In some embodiments of the invention, the mutant H-NOX protein or
mutant H-NOX
domain of a polymeric H-NOX protein has a sequence that differs from that of
all H-NOX
proteins or domains occurring in nature. In various embodiments, the amino
acid sequence of
the mutant protein is at least about any of 10, 15, 20, 25, 30, 40, 50, 60,
70, 80, 90, 95, 97, 98,
99, or 99.5% identical to that of the corresponding region of an H-NOX protein
occurring in
nature. In various embodiments, the amino acid sequence of the mutant protein
is about 10-
20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, 80-90%, 90-95%, 95-99%,
or
99.5% identical to that of the corresponding region of an H-NOX protein
occurring in nature. In
some embodiments, the mutant protein is a protein fragment that contains at
least about any of
25, 50, 75, 100, 150, 200, 300, or 400 contiguous amino acids from a full-
length protein. In
some embodiments, the mutant protein is a protein fragment that contains 25-
50, 50-75, 75-100,
100-150, 150-200, 200-300, or 300-400 contiguous amino acids from a full-
length protein.
Sequence identity can be measured, for example, using sequence analysis
software with the
default parameters specified therein (e.g., Sequence Analysis Software Package
of the Genetics
Computer Group, University of Wisconsin Biotechnology Center, 1710 University
Avenue,
Madison, WI 53705). This software program matches similar sequences by
assigning degrees of
homology to various amino acids replacements, deletions, and other
modifications.
[00125] In some embodiments of the invention, the mutant H-NOX protein or
mutant H-NOX
domain of a polymeric H-NOX protein comprises the insertion of one or more
amino acids (e.g.,
the insertion of 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids). In some
embodiments of the invention,
the mutant H-NOX protein or mutant H-NOX domain comprises the deletion of one
or more
amino acids (e.g., a deletion of N-terminal, C-terminal, and/or internal
residues, such as the
deletion of at least about any of 5, 10, 15, 25, 50, 75, 100, 150, 200, 300,
or more amino acids or
a deletion of 5-10, 10-15, 15-25, 25-50, 50-75, 75-100, 100-150, 150-200, 200-
300, or 300-400
amino acids). In some embodiments of the invention, the mutant H-NOX protein
or mutant H-
NOX domain comprises the replacement of one or more amino acids (e.g., the
replacement of 1,
2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids), or combinations of two or more of
the foregoing. In
some embodiments, a mutant protein has at least one amino acid alteration
compared to a protein
occurring in nature. In some embodiments, a mutant nucleic acid sequence
encodes a protein
31
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
that has at least one amino acid alteration compared to a protein occurring in
nature. In some
embodiments, the nucleic acid is not a degenerate version of a nucleic acid
occurring in nature
that encodes a protein with an amino acid sequence identical to a protein
occurring in nature.
[00126] In some embodiments the mutation in the H-NOX protein or H-NOX domain
of a
polymeric H-NOX protein is an evolutionary conserved mutations (also denoted
class I
mutations). Examples of class I mutations are listed in Table 1A. In Table 1A,
mutations are
numbered/annotated according to the sequence of human (31 H-NOX, but are
analogous for all
H-NOX sequences. Thus, the corresponding position in any other H-NOX protein
can be
mutated to the indicated residue. For example, Phe4 of human (31 H-NOX can be
mutated to a
tyrosine since other H-NOX proteins have a tyrosine in this position. The
corresponding
phenylalanine residue can be mutated to a tyrosine in any other H-NOX protein.
In particular
embodiments, the one or more mutations are confined to evolutionarily
conserved residues. In
some embodiments, the one or more mutations may include at least one
evolutionarily conserved
mutation and at least one non-evolutionarily conserved mutation. If desired,
these mutant H-
NOX proteins are subjected to empirical screening for NO/02 dissociation
constants, NO-
reactivity, stability, and physio-compatibility in view of the teaching
provided herein.
Table 1A. Exemplary Class I H-NOX mutations targeting evolutionary conserved
residues
F4Y Q30G I145Y
F4L E33PI145H
H7G N61G K151E
A8E C78H I157F
L9W A109F E183F
[00127] In some embodiments, the mutation is a distal pocket mutation, such as
mutation of a
residue in alpha-helix A, D, E, or G (Pellicena, P. et al. (August 31, 2004).
Proc Natl. Acad Sci
USA 101(35):12854-12859). Exemplary distal pocket mutations (also denoted
class II
mutations) are listed in Table 1B. In Table 1B, mutations are
numbered/annotated according to
the sequence of human 131 H-NOX, but are analogous for all H-NOX sequences.
Because
several substitutions provide viable mutations at each recited residue, the
residue at each
indicated position can be changed to any other naturally or non-naturally-
occurring amino acid
(denoted "X"). Such mutations can produce H-NOX proteins with a variety of
desired affinity,
stability, and reactivity characteristics.
32
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
Table 1B. Exemplary Class II H-NOX mutations targeting distal pocket residues
V8X M73X I145X
L9X F77X I149X
F7OX C78X
[00128] In particular embodiments, the mutation is a heme distal pocket
mutation. As
described herein, a crucial molecular determinant that prevents 02 binding in
NO-binding
members of the H-NOX family is the lack of a H-bond donor in the distal pocket
of the heme.
Accordingly, in some embodiments, the mutation alters H-bonding between the H-
NOX domain
and the ligand within the distal pocket. In some embodiments, the mutation
disrupts an H-bond
donor of the distal pocket and/or imparts reduced 02 ligand-binding relative
to the corresponding
wild-type H-NOX domain. Exemplary distal pocket residues include Thr4, 11e5,
Thr8, Trp9,
Trp67, Asn74, 11e75, Phe78, Phe82, Tyr140, and Leu144 of T tengcongensis H-NOX
and the
corresponding residues in any other H-NOX protein. In some embodiments, the H-
NOX protein
or H-NOX domain of a polymeric H-NOX protein comprises one or more distal
pocket
mutations. In some embodiments, the H-NOX protein or H-NOX domain of a
polymeric H-
NOX protein comprises one, two, three, four, five, six, seven, eight, nine,
ten or more than ten
distal pocket mutations. In some embodiments, the distal pocket mutation
corresponds to a
L144F mutation of T tengcongensis H-NOX. In some embodiments, the distal
pocket mutation
is a L144F mutation of T tengcongensis H-NOX. In some embodiments, H-NOX
protein or the
H-NOX domain of a polymeric H-NOX protein comprises two distal pocket
mutations. In some
embodiments, the H-NOX protein or H-NOX domain of a polymeric H-NOX protein
corresponds to a W9F/ L144F mutation of T tengcongensis H-NOX. In some
embodiments, the
H-NOX protein or H-NOX domain of a polymeric H-NOX protein is a W9F/ L144F
mutation of
T tengcongensis H-NOX.
[00129] Residues that are not in the distal pocket can also affect the three-
dimensional structure
of the heme group; this structure in turn affects the binding of 02 and NO to
iron in the heme
group. Accordingly, in some embodiments, the H-NOX protein or H-NOX domain of
a
polymeric H-NOX protein has one or more mutations outside of the distal
pocket. Examples of
residues that can be mutated but are not in the distal pocket include Proll5
and Arg135 of T
tengcongensis H-NOX. In some embodiments, the mutation is in the proximal
pocket which
includes His105 as a residue that ligates to the heme iron.
33
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[00130] In some embodiments when two or more mutations are present; at least
one mutation is
in the distal pocket, and at least one mutation is outside of the distal
pocket (e.g., a mutation in
the proximal pocket). In some embodiments, all the mutations are in the distal
pocket.
[00131] To reduce the immunogenicity of H-NOX protein or H-NOX domains derived
from
sources other than humans, amino acids in an H-NOX protein or H-NOX domain can
be mutated
to the corresponding amino acids in a human H-NOX. For example, one or more
amino acids on
the surface of the tertiary structure of a non-human H-NOX protein or H-NOX
domain can be
mutated to the corresponding amino acid in a human H-NOX protein or H-NOX
domain. In
some variations, mutation of one or more surface amino acids may be combined
with mutation
of two or more distal pocket residues, mutation of one or more residues
outside of the distal
pocket (e.g., a mutation in the proximal pocket), or combinations of two or
more of the
foregoing.
[00132] The invention also relates to any combination of mutation described
herein, such as
double, triple, or higher multiple mutations. For example, combinations of any
of the mutations
described herein can be made in the same H-NOX protein. Note that mutations in
equivalent
positions in other mammalian or non-mammalian H-NOX proteins are also
encompassed by this
invention. Exemplary mutant H-NOX proteins or mutant H-NOX domains comprise
one or
more mutations that impart altered 02 or NO ligand-binding relative to the
corresponding wild-
type H-NOX domain and are operative as a physiologically compatible mammalian
02 blood gas
carrier.
[00133] The residue number for a mutation indicates the position in the
sequence of the
particular H-NOX protein being described. For example, T tengcongensis I5A
refers to the
replacement of isoleucine by alanine at the fifth position in T tengcongensis
H-NOX. The same
isoleucine to alanine mutation can be made in the corresponding residue in any
other H-NOX
protein or H-NOX domain (this residue may or may not be the fifth residue in
the sequence of
other H-NOX proteins). Since the amino acid sequences of mammalian 131 H-NOX
domains
differ by at most two amino acids, mutations that produce desirable mutant H-
NOX proteins or
H-NOX domains when introduced into wild-type rat 131 H-NOX proteins are also
expected to
produce desirable mutant H-NOX proteins or H-NOX domains when introduced into
wild-type
131 H-NOX proteins or H-NOX domains from other mammals, such as humans.
[00134] In some embodiments, the H-NOX protein is a trimer comprising three T
tengcongensis L144F H-NOX domains and three foldon domains. In some
embodiments, the H-
NOX protein is a trimer comprising three T tengcongensis W9F/L144F H-NOX
domains and
34
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
three foldon domains. In some embodiments, the H-NOX protein is a trimer
comprising three T
tengcongensis wildtype H-NOX domains and three foldon domains.
Modifications to H-NOX Proteins
[00135] Any of the wild-type or mutant H-NOX proteins, including polymeric H-
NOX
proteins, can be modified and/or formulated using standard methods to enhance
therapeutic or
industrial applications. For example, and particularly as applied to
heterologous engineered H-
NOX proteins, a variety of methods are known in the art for insulating such
agents from immune
surveillance, including crosslinking, PEGylation, carbohydrate decoration,
etc. (e.g., Rohlfs, R.
J. et al. (May 15, 1998). J. Biol. Chem. 273(20):12128-12134; Migita, R. et
al. (June 1997). J.
Appl. Physiol. 82(6):1995-2002; Vandegriff, K. D. et al. (August 15, 2004).
Biochem J. 382(Pt
1):183-189, which are each hereby incorporated by reference in their
entireties, particularly with
respect to the modification of proteins) as well as other techniques known to
the skilled artisan.
Fusing an H-NOX protein, including a polymeric H-NOX protein, with a human
protein such as
human serum albumin can increase the serum half-life, viscosity, and colloidal
oncotic pressure.
In some embodiments, an H-NOX protein is modified during or after its
synthesis to decrease its
immunogenicity and/or to increase its plasma retention time. H-NOX proteins
can also be
encapsulated (such as encapsulation within liposomes or nanoparticles).
[00136] In some embodiments, the H-NOX protein comprises one of more tags;
e.g. to assist in
purification of the H-NOX protein. Examples of tags include, but are not
limited to His6, FLAG,
GST, and MBP. In some embodiments, the H-NOX protein comprises one of more
His6 tags.
The one or more His6 tags may be removed prior to use of the polymeric H-NOX
protein; e.g. by
treatment with an exopeptidase. In some embodiments, the H-NOX protein is a
trimer
comprising three T tengcongensis L144F H-NOX domains, three foldon domains,
and three
His6 tags. In some embodiments, the H-NOX protein is a trimer comprising three
T
tengcongensis W9F/L144F H-NOX domains, three foldon domains, and three His6
tags. In
some embodiments, the H-NOX protein is a trimer comprising three T
tengcongensis wildtype
H-NOX domains, three foldon domains, and three His6 tags.
[00137] In some embodiments, the H-NOX protein comprises one or more
polyethylene glycol
(PEG) molecules (i.e., is PEGylated). In some embodiments, the H-NOX protein
is a trimer
comprising three T tengcongensis L144F H-NOX domains, three foldon domains,
and one or
more polyethylene glycol molecules (PEGylated trimer Tt H-NOX L144F). In some
embodiments, the H-NOX protein is a trimer comprising three T tengcongensis
W9F/L144F H-
NOX domains, three foldon domains, and one or more polyethylene glycol
molecules. In some
embodiments, the H-NOX protein is a trimer comprising three T tengcongensis
wildtype H-
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
NOX domains, three foldon domains, and one or more polyethylene glycol
molecules. In some
embodiments, the molecular weight of the PEG is between about 1 kDa and about
50 kDa. In
some emobodiments, the molecular weight of the PED is between about any of 1
kDa and 50
kDa, 1 kDa and 40 kDa, 1 kDa and 30 kDa, 1 kDa and 25 kDa, 1 kDa and 20 kDa, 1
kDa and 15
kDa, 1 kDa and 10 kDa, 1 kDa and 5 kDa, 5 kDa and 50 kDa, 5 kDa and 40 kDa, 5
kDa and 30
kDa, 5 kDa and 25 kDa, 5 kDa and 20 kDa, 5 kDa and 15 kDa, 5 kDa and 10 kDa,
10 kDa and
50 kDa, 10 kDa and 40 kDa, 10 kDa and 30 kDa, 10 kDa and 25 kDa, 10 kDa and 20
kDa, 10
kDa and 15 kDa, 15 kDa and 50 kDa, 15 kDa and 40 kDa, 15 kDa and 35 kDa, 15
kDa and 30
kDa, 15 kDa and 25 kDa, 15 kDa and 20 kDa, 20 kDa and 50 kDa, 20 kDa and 40
kDa, 20 kDa
and 30 kDa, 20 kDa and 25 kDa, 25 kDa and 50 kDa, 25 kDa and 40 kDa, 25 kDa
and 30 kDa,
30 kDa and 50 kDa, 30 kDa and 40 kDa, or 40 kDa and 50 kDa. In some
embodiments, the H-
NOX protein comprises any one of more than about 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 15, 20, 25, 30, 35,
40, 45, or 50 PEG molecules per H-NOX monomer or any number therebetween. In
some
embodiments, the H-NOX protein comprises an average of 1, 2, 3, 4, 5, 6, 7, 8,
9, 10, 15, 20, 25,
30, 35, 40, 45, or 50 PEG molecules per H-NOX monomer or any number
therebetween.
Polymerization domains
[00138] In some aspects, the invention provides polymeric H-NOX proteins
comprising two or
more H-NOX domains and one or more polymerization domains. Polymerization
domains are
used to link two or more H-NOX domains to form a polymeric H-NOX protein. One
or more
polymerization domains may be used to produce dimers, trimers, tetramers,
pentamers, etc. of H-
NOX proteins. Polymerization domains are known in the art, such as: the foldon
of T4
bacteriophage fibritin, Arc, POZ, coiled coil domains (including GCN4, leucine
zippers,
Velcro), uteroglobin, collagen, 3-stranded coiled colis (matrilin-1),
thrombosporins, TRPV1-C,
P53, Mnt, avadin, streptavidin, Bcr-Abl, COMP, verotoxin subunit B, CamKII,
RCK, and
domains from N ethylmaleimide-sensitive fusion protein, STM3548, KaiC, TyrR,
Hcpl,
CcmK4, GP41, anthrax protective antigen, aerolysin, a-hemolysin, C4b-binding
protein, Mi-CK,
arylsurfatase A, and viral capsid proteins. The polymerization domains may be
covalently or
non-covalently linked to the H-NOX domains. In some embodiments, a
polymerization domain
is linked to an H-NOX domain to form a monomer subunit such that the
polymerization domains
from a plurality of monomer subunits associate to form a polymeric H-NOX
domain. In some
embodiments, the C-terminus of an H-NOX domain is linked to the N-terminus of
a
polymerization domain. In other embodiments, the N-terminus of an H-NOX domain
is linked
to the N-terminus of a polymerization domain. In yet other emodiments, the C-
terminus of an
36
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
H-NOX domain is linked to the C-terminus of a polymerization domain. In some
emodiments,
the N-terminus of an H-NOX domain is linked to the C-terminus of a
polymerization domain.
[00139] Linkers may be used to join a polymerization domain to an H-NOX
domain; for
example, for example, amino acid linkers. In some embodiments, a linker
comprising any one
of one, two, three, four, five, six, seven, eight, nine, ten or more than ten
amino acids may be
placed betweent the polymerization domain and the H-NOX domain. Exemplary
linkers include
but are not limited to Gly-Ser-Gly and Arg-Gly-Ser linkers.
Bacteriophage T4 fibritin trimerization domain
[00140] An exemplary polymerization domain is the foldon domain of
bacteriophage T4. The
wac gene from the bacteriophage T4 encodes the fibritin protein, a 486 amino
acid protein with a
C-terminal trimerization domain (residues 457-483) (Efimov, V. P. et al.
(1994) J Mol Biol
242:470-486). The domain is able to trimerize fibritin both in vitro and in
vivo (Boudko, S. P. et
al. (2002) Eur Biochem 269:833-841; Letarov, A. V., et al., (1999)
Biochemistry
(Mosc)64:817-823; Tao, Y., et al., (1997) Structure 5:789-798). The isolated
27 residue
trimerization domain, often referred to as the "foldon domain," has been used
to construct
chimeric trimers in a number of different proteins (including HIV envelope
glycoproteins (Yang,
X. et al., (2002) J Virol 76:4634-4642), adenoviral adhesins
(Papanikolopoulou, K., et al.,
(2004) J Biol Chem 279:8991-8998; Papanikolopoulou, K. et al. (2004) J Mol
Biol 342:219-
227), collagen (Zhang, C., et al. (2009) Biotechnol Prog 25:1660-1668), phage
P22 gp26
(Bhardwaj, A., et al. (2008) Protein Sci 17:1475-1485), and rabies virus
glycoprotein (Sissoeff,
L., et al. (2005) J Gen Virol 86:2543-2552). An exemplary sequence of the
foldon domain is
shown in Figure 1 and provided by SEQ ID NO:4.
[00141] The isolated foldon domain folds into a single 0-hairpin structure and
trimerizes into a
0-propeller structure involving three hairpins (Guthe, S. et al. (2004) J Mol
Biol 337:905-915).
The structure of the foldon domain alone has been determined by NMR (Guthe, S.
et al. (2004) J
Mol Biol 337:905-915) and the structures of several proteins trimerized with
the foldon domain
have been solved by X-ray crystallography (Papanikolopoulou, K., et al.,
(2004) J Biol Chem
279:8991-8998; Stetefeld, J. et al. (2003) Structure 11:339-346; Yokoi, N. et
al. (2010) Small
6:1873-1879). The domain folds and trimerizes rapidly reducing the opportunity
for misfolding
intermediates or off-pathway oligomerization products (Guthe, S. et al. (2004)
J Mol Biol
337:905-915). The foldon domain is very stable, able to maintain tertiary
structure and
oligomerization in >10% SDS, 6.0M guanidine hydrochloride, or 80 C (Bhardwaj,
A., et al.
(2008) Protein Sci 17:1475-1485; Bhardwaj, A., et al. (2007) J Mol Biol
371:374-387) and can
37
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
improve the stability of sequences fused to the foldon domain (Du, C. et al.
(2008) Appl
Microbiol Biotechnol 79:195-202.
[00142] In some embodiments, the C-terminus of an H-NOX domain is linked to
the N-
terminus of a foldon domain. In other embodiments, the N-terminus of an H-NOX
domain is
linked to the N-terminus of a foldon domain. In yet other emodiments, the C-
terminus of an H-
NOX domain is linked to the C-terminus of a foldon domain. In some emodiments,
the N-
terminus of an H-NOX domain is linked to the C-terminus of a foldon domain.
[00143] In some embodiments, linkers are be used to join a foldon domain to an
H-NOX
domain. In some embodiments, a linker comprising any one of one, two, three,
four, five, six,
seven, eight, nine, ten or more than ten amino acids may be placed betweent
the polymerization
domain and the H-NOX domain. Exemplary linkers include but are not limited to
Gly-Ser-Gly
and Arg-Gly-Ser linkers. In some embodiments, the invention provides a
trimeric H-NOX
protein comprising from N-terminus to C-terminus: a T tengcongensis H-NOX
domain, a Gly-
Ser-Gly amino acid linker, and a foldon domain. In some embodiments, the
invention provides
a trimeric H-NOX protein comprising from N-terminus to C-terminus: a T
tengcongensis H-
NOX domain, a Gly-Ser-Gly amino acid linker, a foldon domain, an Arg-Gly-Ser
amino acid
linker, and a His6 tag. In some embodiments, the T tengcongensis H-NOX domain
comprises
an L144F mutation. In some embodiments, the T tengcongensis H-NOX domain
comprises a
W9F mutation and a L144F mutation. In some embodiments, the T tengcongensis H-
NOX
domain is a wild-type H-NOX domain.
Monomeric H-NOX domain subunits
[00144] In one aspect, the invention provides recombinant monomeric H-NOX
proteins (i.e.
monomeric H-NOX subunits of polymeric H-NOX proteins) that can associate to
form
polymeric H-NOX proteins. In some embodiments, the invention provides
recombinant H-NOX
proteins comprising an H-NOX domain as described herein and a polymerization
domain. The
H-NOX domain and the polymerization domain may be covalently linked or
noncovalently
linked. In some embodiments, the C-terminus of an H-NOX domain of the
recombinant
monomeric H-NOX protein is linked to the N-terminus of a polymerization
domain. In other
embodiments, the N-terminus of an H-NOX domain of the recombinant monomeric H-
NOX
protein is linked to the N-terminus of a polymerization domain. In yet other
emodiments, the C-
terminus of an H-NOX domain of the recombinant monomeric H-NOX protein is
linked to the
C-terminus of a polymerization domain. In some emodiments, the N-terminus of
an H-NOX
domain of the recombinant monomeric H-NOX protein is linked to the C-terminus
of a
38
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
polymerization domain.In some embodiments, the recombinant monomeric H-NOX
protein does
not comprise a guanylyl cyclase domain.
[00145] In some embodiments, the monomeric H-NOX protein comprises a wild-type
H-NOX
domain. In some embodiments of the invention, the monomeric H-NOX protein
comprises one
of more mutations in the H-NOX domain. In some embodiments, the one or more
mutations
alter the 02 dissociation constant, the koff for oxygen, the rate of heme
autooxidation, the NO
reactivity, the NO stabilty or any combination of two or more of the foregoing
compared to that
of the corresponding wild-type H-NOX domain. In some embodiments, the mutation
is a distal
pocket mutation. In some embodiments, the mutation comprises a mutation that
is not in the
distal pocket. In some embodiments, the distal pocket mutation corresponds to
a L144 mutation
of T tengcongensis (e.g. a L144F mutation). In some embodiments, the
recombinant
monomeric H-NOX protein comprises two distal pocket mutations corresponding to
a W9 and a
L144 mutation of T tengcongensis (e.g. a W9F/L144F mutation).
[00146] In some aspects, the invention provides recombinant monomeric H-NOX
proteins that
associate to form trimeric H-NOX proteins. In some embodiments, the
recombinant H-NOX
protein comprises an H-NOX domain and a trimerization domain. In some
embodiments, the
trimerization domain is a foldon domain as discussed herein. In some
embodiments, the H-NOX
domain is a T tengcongensis H-NOX domain. In some embodiments the C-terminus
of the T
tengcongensis H-NOX domain is covalently linked to the N-terminus of the
foldon domain. In
some embodiments the C-terminus of the T tengcongensis H-NOX domain is
covalently linked
to the C-terminus of the foldon domain. In some embodiments, the T
tengcongensis domain is
an L144F H-NOX domain. In some embodiments, the T tengcongensis domain is a
W9F/L144F H-NOX domain. In some embodiments, the T tengcongensis domain is a
wild-
type H-NOX domain.
[00147] In some embodiments, the H-NOX domain is covalently linked to the
polymerization
domain using an amino acid linker sequence. In some embodiments, the amino
acid linker
sequence is one, two, three, four, five, six, seven, eight, nine, ten or more
than ten amino acids in
length. Exemplary amino acid linker sequences include but are not limited to a
Gly-Ser-Gly
sequence and an Arg-Gly-Ser sequence. In some embodiments, the polymeric H-NOX
protein is
a trimeric H-NOX protein comprising three H-NOX domains and three
trimerization sequences
wherein the H-NOX domain is covalently linked to the trimerization domain via
an amino acid
linker sequence. In some embodiments, the monomeric H-NOX protein comprises
the following
from the N-terminus to the C-terminus: an L144F T tengcongensis H-NOX domain,
a Gly-Ser-
Gly amino acid linker sequence, and a foldon domain. In some embodiments, the
monomeric H-
39
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
NOX protein comprises the following from the N-terminus to the C-terminus: a
W9F/L144F T
tengcongensis H-NOX domain, a Gly-Ser-Gly amino acid linker sequence, and a
foldon domain.
In some embodiments, the monomeric H-NOX protein comprises the following from
the N-
terminus to the C-terminus: a wild-type T tengcongensis H-NOX domain, a Gly-
Ser-Gly amino
acid linker sequence, and a foldon domain.
[00148] In some embodiments, the recombinant monomeric H-NOX protein comprises
a tag;
e.g., a His6, a FLAG, a GST, or an MBP tag. In some embodiments, the
recombinant
monomeric H-NOX protein comprises a His6 tag. In some embodiments, the
recombinant
monomeric H-NOX protein does not comprise a tag. In some embodiments, the tag
(e.g. a His6
tag) is covalently linked to the polymerization domain using an amino acid
spacer sequence. In
some embodiments, the amino acid linker sequence is one, two, three, four,
five, six, seven,
eight, nine, ten or more than ten amino acids in length. Exemplary amino acid
linker sequences
include but are not limited to a Gly-Ser-Gly sequence and an Arg-Gly-Ser
sequence. In some
embodiments, the polymeric H-NOX protein is a trimeric H-NOX protein
comprising three H-
NOX domains, three trimerization sequences, and three His6 tags, wherein the H-
NOX domain is
covalently linked to the trimerization domain via an amino acid linker
sequence and the
trimerization domain is covalently linked to the His6 tag via an amino acid
linker sequence. In
some embodiments, the monomeric H-NOX protein comprises the following from the
N-
terminus to the C-terminus: an L144F T tengcongensis H-NOX domain, a Gly-Ser-
Gly amino
acid linker sequence, a foldon domain, an Arg-Gly-Ser linker sequence, and a
His6 tag. In some
embodiments, the monomeric H-NOX protein comprises the following from the N-
terminus to
the C-terminus: a W9F/L144F T tengcongensis H-NOX domain, a Gly-Ser-Gly amino
acid
linker sequence, a foldon domain, an Arg-Gly-Ser linker sequence, and a His6
tag. In some
embodiments, the monomeric H-NOX protein comprises the following from the N-
terminus to
the C-terminus: a wild-type T tengcongensis H-NOX domain, a Gly-Ser-Gly amino
acid linker
sequence, a foldon domain, an Arg-Gly-Ser linker sequence, and a His6 tag.
[00149] In some embodiments the recombinant monomeric H-NOX protein comprises
the
amino acid sequence of SEQ ID NO:6 or SEQ ID NO:8.
Characteristics of Wild-type and Mutant H-NOX Proteins
[00150] The present invention provides the use of 02 carrier polypeptides for
use in enhancing
tumor immunogenicity; for example, by inhibiting the immune suppressive
activities associated
with tumor hypoxia. A non-limiting exemplary family of 02 carrier polypeptides
is the H-NOX
family of 02 carrier polypeptides. As described herein, a large number of
diverse H-NOX
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
mutant proteins, including polymeric H-NOX proteins, providing ranges of NO
and 02
dissociation constants, 02 koff, NO reactivity, and stability have been
generated. To provide
operative blood gas carriers, the H-NOX proteins may be used to functionally
replace or
supplement endogenous 02 carriers, such as hemoglobin. In some embodiments, H-
NOX
proteins such as polymeric H-NOX proteins, are used to deliver 02 to hypoxic
tumor tissue (e.g.
a glioblastoma) as an adjuvant to radiation therapy or chemotherapy.
Accordingly, in some
embodiments, an H-NOX protein has a similar or improved 02 association rate,
02 dissociation
rate, dissociation constant for 02 binding, NO stability, NO reactivity,
autoxidation rate, plasma
retention time, or any combination of two or more of the foregoing compared to
an endogenous
02 carrier, such as hemoglobin. In some embodiments, the H-NOX protein is a
polymeric H-
NOX protein. In some embodiments, the polymeric H-NOX protein is a trimeric H-
NOX
protein comprising three monomers, each monomer comprising a T tengcongensis
L144F H-
NOX domain and a foldon domain. In some embodiments, the polymeric H-NOX
protein is a
trimeric H-NOX protein comprising three monomers, each monomer comprising a T
tengcongensis W9F/L144F H-NOX domain and a foldon domain. In some embodiments,
the
polymeric H-NOX protein is a trimeric H-NOX protein comprising three monomers,
each
monomer comprising a T tengcongensis L144F H-NOX domain and a foldon domain.
[00151] In various embodiments, the koff for 02 for an H-NOX protein,
including a polymeric
H-NOX protein, is between about 0.01 to about 200 s-1 at 20 C, such as about
0.1 to about 200
-1 -1 -1 -1
s , about 0.1 to 100 s , about 1.0 to about 16.0 s , about 1.35 to about 23.4
s , about 1.34 to
about 18 s-1, about 1.35 to about 14.5 s-1, about 0.21 to about 23. 4 s-1,
about1.35 to about 2.9 s-1,
about 2 to about 3 s-1, about 5 to about 15 s-1, or about 0.1 to about 1 s-1.
In some embodiments,
the H-NOX protein has a koff for oxygen that is less than or equal to about
0.65 slat 20 C (such
as between about 0.21 s1 toabout 0.65 s-1 at 20 C).
[00152] In various embodiments, the Icon for 02 for an H-NOX protein,
including a polymeric
H-NOX protein, is between about 0.14 to about 60 uM-is-1 at 20 C, such as
about 6 to about 60
uM-ls-1, about 6 to 12 uM-ls-1, about 15 to about 60 uM-ls-1, about 5 to about
18 M- s-1, or about
6 to about 15 uM-ls-1.
[00153] In various embodiments, the kinetic or calculated KD for 02 binding by
an H-NOX
protein, including a polymeric H-NOX protein, is between about 1 nM to 1 mM,
about 1 uM to
about 10 uM, or about 10 uM to about 50 M. In some embodiments the calculated
KD for 02
binding is any one of about 2 nM to about 2 uM, about 2 M to about 1 mM,
about 100 nM to
about 1 uM, about 9 uM to about 50 uM, about 100 uM to about 1 mM, about 50 nM
to about
uM, about 2 nM to about 50 uM, about 100 nM to about 1.9 uM, about 150 nM to
about 1
41
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
uM, or about 100 nM to about 255 nM, about 20 nM to about 2 uM, 20 nM to about
75 nM,
about 1 uM to about 2 uM, about 2 uM to about 10 uM, about 2 uM to about 9 uM,
or about
100 nM to 500 nM at 20 C. In some embodiments, the kinetic or calculated KD
for 02 binding
is less than about any of 100 nM, 80 nM, 50 nM, 30 nM, 25 nM, 20 nM, or 10 nM
at 20 C.
[00154] In various embodiments, the kinetic or calculated KD for 02 binding by
an H-NOX
protein, including a polymeric H-NOX protein, is within about 0.01 to about
100-fold of that of
hemoglobin under the same conditions (such as at 20 C), such as between about
0.1 to about 10-
fold or between about 0.5 to about 2-fold of that of hemoglobin under the same
conditions (such
as at 20 C). In various embodiments, the kinetic or calculated KD for NO
binding by an H-NOX
protein is within about 0.01 to about 100-fold of that of hemoglobin under the
same conditions
(such as at 20 C), such as between about 0.1 to about 10-fold or between
about 0.5 to about 2-
fold of that of hemoglobin under the same conditions (such as at 20 C).
[00155] In some embodiments, less than about any of 50, 40, 30, 10, or 5% of
an H-NOX
protein, including a polymeric H-NOX protein, is oxidized after incubation for
about any of 1, 2,
4, 6, 8, 10, 15, or 20 hours at 20 C.
[00156] In various embodiments, the NO reactivity of an H-NOX protein,
including a
polymeric H-NOX protein, is less than about 700 s-1 at 20 C, such as less
than about 600 s-1,
500 s-1, 400 s-1, 300 s-1, 200 s-1, 100 s-1, 75 s-1, 50 s-1, 25 s-1, 20 s-1,
10 s-1, 50 s-1, 3 s-1, 2 s-1, 1.8 s-
-1 -1 -1 -1 -1 -1
1, 1.5 s , 1.2 s , 1.0 s , 0.8 s , 0.7 s , or 0.6 s at 20 C. In various
embodiments, the NO
reactivity of an H-NOX protein is between about 0.1 to about 600 s-1 at 20 C,
such as between
about 0.5 to about 400 s-1, about 0.5 to about 100 s-1, about 0.5 to about 50
s-1, about 0.5 to about
s-1, about 1 to about 5 s-1, or about 0.5 to about 2.1 s-1 at 20 C. In
various embodiments, the
reactivity of an H-NOX protein is at least about 10, 100, 1,000, or 10,000
fold lower than that of
hemoglobin under the same conditions, such as at 20 C.
[00157] In various embodiments, the rate of heme autoxidation of an H-NOX
protein, including
a polymeric H-NOX protein, is less than about 1.0 'flat 37 C, such as less
than about any of 0.9
111, 0.8 h-1, 0.7 h-1, 0.6 h-1, 0.5111, 0.4 111, 0.3 111, 0.2 h-1, 0.1 h-1, or
0.05111 at 37 C. In various
embodiments, the rate of heme autoxidation of an H-NOX protein is between
about 0.006 to
about 5.01-flat 37 C, such as about 0.006 to about 1.0111, 0.006 to about
0.9111, or about 0.06
to about 0.5 111 at 37 C.
[00158] In various embodiments, a mutant H-NOX protein, including a polymeric
H-NOX
protein, has (a) an 02 or NO dissociation constant, association rate (Icon for
02 or NO), or
dissociation rate (koff for 02 or NO) within 2 orders of magnitude of that of
hemoglobin, (b) has
an NO affinity weaker (e.g., at least about 10-fold, 100-fold, or 1000-fold
weaker) than that of
42
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
sGC 131, respectively, (c) an NO reactivity with bound 02 at least 1000-fold
less than
hemoglobin, (d) an in vivo plasma retention time at least 2, 10, 100, or 1000-
fold higher than
that of hemoglobin, or (e) any combination of two or more of the foregoing.
[00159] Exemplary suitable 02 carriers provide dissociation constants within
two orders of
magnitude of that of hemoglobin, i.e. between about 0.01 and 100-fold, such as
between about
0.1 and 10-fold, or between about 0.5 and 2-fold of that of hemoglobin. A
variety of established
techniques may be used to quantify dissociation constants, such as the
techniques described
herein (Boon, E. M. et al. (2005). Nature Chem. Biol. 1:53-59; Boon, E. M. et
al. (October
2005). Curr. Opin. Chem. Biol. 9(5):441-446; Boon, E. M. et al. (2005). J.
Inorg. Biochem.
99(4):892-902), Vandegriff, K. D. et al. (August 15, 2004). Biochem J. 382(Pt
1):183-189,
which are each hereby incorporated by reference in their entireties,
particularly with respect to
the measurement of dissociation constants), as well as those known to the
skilled artisan.
Exemplary 02 carriers provide low or minimized NO reactivity of the H-NOX
protein with
bound 02, such as an NO reactivity lower than that of hemoglobin. In some
embodiments, the
NO reactivity is much lower, such as at least about 10, 100, 1,000, or 10,000-
fold lower than that
of hemoglobin. A variety of established techniques may be used to quantify NO
reactivity
(Boon, E. M. et al. (2005). Nature Chem. Biol. 1:53-59; Boon, E. M. et al.
(October 2005). Curr.
Opin. Chem. Biol. 9(5):441-446; Boon, E. M. et al. (2005). J. Inorg. Biochem.
99(4):892-902),
Vandegriff, K. D. et al. (August 15, 2004). Biochem J. 382(Pt 1):183-189,
which are each
hereby incorporated by reference in their entireties, particularly with
respect to the measurement
of NO reactivity) as well as those known to the skilled artisan. Because wild-
type T
tengcongensis H-NOX has such a low NO reactivity, other wild-type H-NOX
proteins and
mutant H-NOX proteins may have a similar low NO reactivity. For example, T
tengcongensis
H-NOX Y140H has an NO reactivity similar to that of wild-type T tengcongensis
H-NOX.
[00160] In addition, suitable 02 carriers provide high or maximized stability,
particularly in
vivo stability. A variety of stability metrics may be used, such as oxidative
stability (e.g.,
stability to autoxidation or oxidation by NO), temperature stability, and in
vivo stability. A
variety of established techniques may be used to quantify stability, such as
the techniques
described herein (Boon, E. M. et al. (2005). Nature Chem. Biol. 1:53-59; Boon,
E. M. et al.
(October 2005). Curr. Opin. Chem. Biol. 9(5):441-446; Boon, E. M. et al.
(2005). J. Inorg.
Biochem. 99(4):892-902), as well as those known to the skilled artisan. For in
vivo stability in
plasma, blood, or tissue, exemplary metrics of stability include retention
time, rate of clearance,
and half-life. H-NOX proteins from thermophilic organisms are expected to be
stable at high
temperatures. In various embodiments, the plasma retention times are at least
about 2-, 10-, 100-
43
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
, or 1000-fold greater than that of hemoglobin (e.g. Bobofchak, K. M. et al.
(August 2003). Am.
J. Physiol. Heart Circ. Physiol. 285(2):H549-H561). As will be appreciated by
the skilled
artisan, hemoglobin-based blood substitutes are limited by the rapid clearance
of cell-free
hemoglobin from plasma due the presence of receptors for hemoglobin that
remove cell-free
hemoglobin from plasma. Since there are no receptors for H-NOX proteins in
plasma, wild-type
and mutant H-NOX proteins are expected to have a longer plasma retention time
than that of
hemoglobin. If desired, the plasma retention time can be increased by
PEGylating or
crosslinking an H-NOX protein or fusing an H-NOX protein with another protein
using standard
methods (such as those described herein and those known to the skilled
artisan).
[00161] In various embodiments, the H-NOX protein, including a polymeric H-NOX
protein,
has an 02 dissociation constant between about 1 nM to about 1 mM at 20 C and
a NO reactivity
at least about 10-fold lower than that of hemoglobin under the same
conditions, such as at 20 C.
In some embodiments, the H-NOX protein has an 02 dissociation constant between
about 1 nM
to about 1 mM at 20 C and a NO reactivity less than about 700 s-1 at 20 C
(e.g., less than about
600 s-1, 500 s-1, 100 s-1, 20 s-1, or 1.8 slat 20 C). In some embodiments,
the H-NOX protein has
an 02 dissociation constant within 2 orders of magnitude of that of hemoglobin
and a NO
reactivity at least about 10-fold lower than that of hemoglobin under the same
conditions, such
as at 20 C. In some embodiments, the H-NOX protein has a koff for oxygen
between about 0.01
to about 200 s-1 at 20 C and an NO reactivity at least about 10-fold lower
than that of
hemoglobin under the same conditions, such as at 20 C. In some embodiments,
the H-NOX
protein has a koff for oxygen that is less than about 0.65 slat 20 C (such as
between about 0.21
s1 toabout 0.64 s-1 at 20 C) and a NO reactivity at least about 10-fold lower
than that of
hemoglobin under the same conditions, such as at 20 C. In some embodiments of
the invention,
the 02 dissociation constant of the H-NOX protein is between about 1 nM to
about 1 M (1000
nM), about 1 M to about 10 M, or about 10 M to about 50 M. In particular
embodiments,
the 02 dissociation constant of the H-NOX protein is between about 2 nM to
about 50 M, about
50 nM to about 10 M, about 100 nM to about 1.9 M, about 150 nM to about 1
M, or about
100 nM to about 255 nM at 20 C. In various embodiments, the 02 dissociation
constant of the
H-NOX protein is less than about 80 nM at 20 C, such as between about 20 nM
to about 75 nM
at 20 C. In some embodiments, the NO reactivity of the H-NOX protein is at
least about 100-
fold lower or about 1,000 fold lower than that of hemoglobin, under the same
conditions, such as
at 20 C. In some embodiments, the NO reactivity of the H-NOX protein is less
than about 700
s-1 at 20 C, such as less than about 600 s-1, 500 s-1, 400 s-1, 300 s-1, 200
s-1, 100 s-1, 75 s-1, 50 s-1,
25 s-1, 20 s-1, 10 s-1, 50 s-1, 3 s-1, 2 s-1, 1.8 s-1, 1.5 s-1, 1.2 s-1, 1.0 s-
1, 0.8 s-1, 0.7 s-1, or 0.6 s-1 at 20
44
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
C. In some embodiments, the koff for oxygen of the H-NOX protein is between
0.01 to 200 slat
20 C, such as about 0.1 to about 200 s-1, about 0.1 to 100 s-1, about 1.35 to
about 23.4 s-1, about
1.34 to about 18 s-1, about 1.35 to about 14.5 s-1, about 0.21 to about 23. 4
s-1, about 2 to about 3
-1 -1 -1
s , about 5 to about 15 s , or about 0.1 to about 1 s . In some embodiments,
the 02 dissociation
constant of the H-NOX protein is between about 100 nM to about 1.9 uM at 20
C, and the kaf
for oxygen of the H-NOX protein is between about 1.35 s-1 to about 14.5 s-1 at
20 C. In some
embodiments, the rate of heme autoxidation of the H-NOX protein is less than
about 1 'flat 37
C, such as less than about any of 0.9 111, 0.8111, 0.7111, 0.6111, 0.5111,
0.4111, 0.3 111, 0.2 111,
or 0.1111. In some embodiments, the koff for oxygen of the H-NOX protein is
between about
1.35 s-1 to about 14.5 s-1 at 20 C, and the rate of heme autoxidation of the
H-NOX protein is less
than about 1 'flat 37 C. In some embodiments, the koff for oxygen of the H-
NOX protein is
between about 1.35 s-1 to about 14.5 s-1 at 20 C, and the NO reactivity of
the H-NOX protein is
less than about 700 s-1 at 20 C (e.g., less than about 600 s-1, 500 s-1, 100
s-1, 20 s-1, or 1.8 s-1 at 20
C). In some embodiments, the rate of heme autoxidation of the H-NOX protein is
less than
about 1 'flat 37 C, and the NO reactivity of the H-NOX protein is less than
about 700 s-1 at 20
C (e.g., less than about 600 s-1, 500 s-1, 100 s-1, 20 s-1, or 1.8 s-1 at 20
C).
[00162] In some embodiments, the viscosity of the H-NOX protein solution,
including a
polymeric H-NOX protein solution, is between 1 and 4 centipoise (cP). In some
embodiments,
the colloid oncotic pressure of the H-NOX protein solution is between 20 and
50 mm Hg.
Measurement of 02 and/or NO binding
[00163] One skilled in the art can readily determine the oxygen and nitric
oxide binding
characteristics of any H-NOX protein including a polymeric H-NOX protein such
as a trimeric
H-NOX protein by methods known in the art and by the non-limiting exemplary
methods
described below.
Kinetic Km: Ratio of koff to lc.
[00164] The kinetic KD value is determined for wild-type and mutant H-NOX
proteins,
including polymeric H-NOS proteins, essentially as described by Boon, E.M. et
al. (2005).
Nature Chemical Biology 1:53-59, which is hereby incorporated by reference in
its entirety,
particularly with respect to the measurement of 02 association rates, 02
dissociation rates,
dissociation constants for 02 binding, autoxidation rates, and NO dissociation
rates.
k. (02 Association Rate)
[00165] 02 association to the heme is measured using flash photolysis at 20
C. It is not
possible to flash off the Fell-02 complex as a result of the very fast
geminate recombination
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
kinetics; thus, the Fen¨CO complex is subjected to flash photolysis with laser
light at 560 nm
(Hewlett-Packard, Palo Alto, CA), producing the 5-coordinate Fell
intermediate, to which the
binding of molecular 02 is followed at various wavelengths. Protein samples
are made by
anaerobic reduction with 10 mM dithionite, followed by desalting on a PD-10
column
(Millipore, Inc., Billerica, MA). The samples are then diluted to 20 p,M heme
in 50 mM TEA,
50 mM NaC1, pH 7.5 buffer in a controlled-atmosphere quartz cuvette, with a
size of 100 pt to 1
mL and a path-length of 1-cm. CO gas is flowed over the headspace of this
cuvette for 10
minutes to form the Fe"¨CO complex, the formation of which is verified by UV-
visible
spectroscopy (Soret maximum 423 nm). This sample is then either used to
measure CO-
rebinding kinetics after flash photolysis while still under 1 atmosphere of CO
gas, or it is opened
and stirred in air for 30 minutes to fully oxygenate the buffer before flash
photolysis to watch
02-rebinding events. 02 association to the heme is monitored at multiple
wavelengths versus
time. These traces are fit with a single exponential using Igor Pro software
(Wavemetrics, Inc.,
Oswego, OR; latest 2005 version). This rate is independent of observation
wavelength but
dependent on 02 concentration. UV-visible spectroscopy is used throughout to
confirm all the
complexes and intermediates (Cary 3K, Varian, Inc. Palo Alto, CA). Transient
absorption data
are collected using instruments described in Dmochowski, I. J. et al. (August
31, 2000). J Inorg
Biochem. 81(3):221-228, which is hereby incorporated by reference in its
entirety, particularly
with respect to instrumentation. The instrument has a response time of 20 ns,
and the data are
digitized at 200 megasamples s-1.
k off (02 dissociation rate)
[00166] To measure the kat, Fe"-02 complexes of protein (5 p,M heme), are
diluted in
anaerobic 50 mM TEA, 50 mM NaC1, pH 7.5 buffer, and are rapidly mixed with an
equal
volume of the same buffer (anaerobic) containing various concentrations of
dithionite and/or
saturating CO gas. Data are acquired on a HI-TECH Scientific SF-61 stopped-
flow
spectrophotometer equipped with a Neslab RTE-100 constant-temperature bath set
to 20 C
(TGK Scientific LTD., Bradford On Avon, United Kingdom). The dissociation of
02 from the
heme is monitored as an increase in the absorbance at 437 nm, a maximum in the
Feu ¨ Fe"-02
difference spectrum, or 425 nm, a maximum in the Fell ¨ Fe"-CO difference
spectrum. The final
traces are fit to a single exponential using the software that is part of the
instrument. Each
experiment is done a minimum of six times, and the resulting rates are
averaged. The
dissociation rates measured are independent of dithionite concentration and
independent of
saturating CO as a trap for the reduced species, both with and without 10 mM
dithionite present.
Kinetic KD
46
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[00167] The kinetic KD is determined by calculating the ratio of koff to Icon
using the
measurements of koff and Icon described above.
Calculated KD
[00168] To measure the calculated KD, the values for the koff and kinetic KD
that are obtained as
described above are graphed. A linear relationship between koff and kinetic KD
is defined by the
equation (y=mx+b). koff values were then interpolated along the line to derive
the calculated KD
using Excel: MAC 2004 (Microsoft, Redmond, WA). In the absence of a measured
Icon, this
interpolation provides a way to relate koff to KD.
Rate of Autoxidation
[00169] To measure the rate of autoxidation, the protein samples are
anaerobically reduced,
then diluted to 5 M heme in aerobic 50 mM TEA, 50 mM NaC1, pH 7.5 buffer.
These samples
are then incubated in a Cary 3E spectrophotometer equipped with a Neslab RTE-
100 constant-
temperature bath set to 37 C and scanned periodically (Cary 3E, Varian, Inc.,
Palo Alto, CA).
The rate of autoxidation is determined from the difference between the maximum
and minimum
in the Fe" ¨ Fen difference spectrum plotted versus time and fit with a single
exponential using
Excel: MAC 2004 (Microsoft, Redmond, WA).
Rate of reaction with NO
[00170] NO reactivity is measured using purified proteins (H-NOX, polymeric H-
NOX, Homo
sapiens hemoglobin (Hs Hb) etc.) prepared at 2 p,M in buffer A and NO prepared
at 200 p,M in
Buffer A (Buffer A: 50 mM Hepes, pH 7.5, 50 mM NaC1). Data are acquired on a
HI-TECH
Scientific SF-61 stopped-flow spectrophotometer equipped with a Neslab RTE-100
constant-
temperature bath set to 20 C (TGK Scientific LTD., Bradford On Avon, United
Kingdom).
The protein is rapidly mixed with NO in a 1:1 ratio with an integration time
of 0.00125 sec. The
wavelengths of maximum change are fit to a single exponential using the
software that is part of
the spectrometer, essentially measuring the rate-limiting step of oxidation by
NO. The end
products of the reaction are ferric-NO for the HNOX proteins and ferric-aquo
for Hs Hb.
p50 measurements
[00171] If desired, the p50 value for mutant or wild-type H-NOX proteins can
be measured as
described by Guarnone, R. et al. (September/October 1995). Haematologica
80(5):426-430,
which is hereby incorporated by reference in its entirety, particularly with
respect to the
measurement of p50 values. The p50 value is determined using a HemOx analyzer.
The
measurement chamber starts at 0% oxygen and slowly is raised, incrementally,
towards 100%
oxygen. An oxygen probe in the chamber measures the oxygen saturation %. A
second probe
(UV-Vis light) measures two wavelengths of absorption, tuned to the alpha and
beta peaks of the
47
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
hemoprotein's (e.g., a protein such as H-NOX complexed with heme) UV-Vis
spectra. These
absorption peaks increase linearly as hemoprotein binds oxygen. The percent
change from
unbound to 100% bound is then plotted against the % oxygen values to generate
a curve. The
p50 is the point on the curve where 50% of the hemoprotein is bound to oxygen.
[00172] Specifically, the Hemox-Analyzer (TCS Scientific Corporation, New
Hope, PA)
determines the oxyhemoprotein dissociation curve (ODC) by exposing 50 uL of
blood or
hemoprotein to an increasing partial pressure of oxygen and deoxygenating it
with nitrogen gas.
A Clark oxygen electrode detects the change in oxygen tension, which is
recorded on the x-axis
of an x-y recorder. The resulting increase in oxyhemoprotein fraction is
simultaneously
monitored by dual-wavelength spectrophotometry at 560 nm and 576 nm and
displayed on the y-
axis. Blood samples are taken from the antemedial vein, anticoagulated with
heparin, and kept
at 4 C on wet ice until the assay. Fifty uL of whole blood are diluted in 5 uL
of Hemox-
solution, a manufacturer-provided buffer that keeps the pH of the solution at
a value of 7.4 0.01.
The sample-buffer is drawn into a cuvette that is part of the Hemox-Analyzer
and the
temperature of the mixture is equilibrated and brought to 37 C; the sample is
then oxygenated to
100% with air. After adjustment of the p02 value the sample is deoxygenated
with nitrogen;
during the deoxygenation process the curve is recorded on graph paper. The P50
value is
extrapolated on the x-axis as the point at which 02 saturation is 50% using
the software that is
part of the Hemox-Analyzer. The time required for a complete recording is
approximately 30
minutes.
H-NOX Nucleic Acids
[00173] The invention also features nucleic acids encoding any of the mutant H-
NOX proteins,
polymeric H-NOX, or recombinant monomer H-NOX protein subunits as described
herein.
[00174] In particular embodiments, the nucleic acid includes a segment of or
the entire nucleic
acid sequence of any of nucleic acids encoding an H-NOX protein or an H-NOX
domain. In
some embodiments, the nucleic acid includes at least about 50, 100, 150, 200,
300, 400, 500,
600, 700, 800, or more contiguous nucleotides from a H-NOX nucleic acid and
contains one or
more mutations (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mutations) compared to
the H-NOX nucleic
acid from which it was derived. In various embodiments, a mutant H-NOX nucleic
acid
contains less than about 20, 15, 12, 10, 9, 8, 7, 6, 5, 4, 3, or 2 mutations
compared to the H-NOX
nucleic acid from which it was derived. The invention also features degenerate
variants of any
nucleic acid encoding a mutant H-NOX protein.
48
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[00175] In some embodiments, the nucleic acid includes nucleic acids encoding
two or more H-
NOX domains. In some embodiments, the nucleic acids including two or more H-
NOX domains
are linked such that a polymeric H-NOX protein is expressed from the nucleic
acid. In further
embodiments, the nucleic acid includes nucleic acids encoding one or more
polymerization
domains. In some embodiments, the nucleic acids including the two or more H-
NOX domains
and the one or more polymerization domains are linked such that a polymeric H-
NOX protein is
expressed from the nucleic acid.
[00176] In some embodiments, the nucleic acid includes a segment or the entire
nucleic acid
sequence of any nucleic acid encoding a polymerization domain. In some
embodiments the
nucleic acid comprises a nucleic acid encoding an H-NOX domain and a
polymerization
domain. In some embodiments, the nucleic acid encoding an H-NOX domain and the
nucleic
acid encoding a polymerization domain a linked such that the produced
polypeptide is a fusion
protein comprising an H-NOX domain and a polymerization domain.
[00177] In some embodiments, the nucleic acid comprises nucleic acid encoding
one or more
His6 tags. In some embodiments the nucleic acid further comprised nucleic
acids encoding
linker sequences positioned between nucleic acids encoding the H-NOX domain,
the
polymerization domain and/or a His6 tag.
[00178] In some embodiments, the invention provides a nucleic acid encoding an
H-NOX
domain and a foldon domain. In some embodiments, the H-NOX domain is a T
the rmoanaerobacter H-NOX domain. In some embodiments, the H-NOX domain is a
wild-type
T thermoanaerobacter H-NOX domain. In some embodiments, the H-NOX domain is a
T
the rmoanaerobacter L144F H-NOX domain. In some embodiments, the H-NOX domain
is a T
the rmoanaerobacter W9F/L144F H-NOX domain.
[00179] In some embodiments, the invention provides nucleic acids encoding the
following 5'
to 3' : a L144F T tengcongensis H-NOX domain, a Gly-Ser-Gly amino acid linker
sequence,
and a foldon domain. In some embodiments, the invention provides nucleic acids
encoding the
following 5' to 3': a W9F/L144F T tengcongensis H-NOX domain, a Gly-Ser-Gly
amino acid
linker sequence, and a foldon domain. In some embodiments, the invention
provides nucleic
acids encoding the following 5' to 3': a wild-type T tengcongensis H-NOX
domain, a Gly-Ser-
Gly amino acid linker sequence, and a foldon domain.
[00180] In some embodiments, the invention provides nucleic acids encoding the
following 5'
to 3': a L144F T tengcongensis H-NOX domain, a Gly-Ser-Gly amino acid linker
sequence, a
foldon domain, an Arg-Gly-Ser linker sequence, and a His6 tag. In some
embodiments, the
invention provides nucleic acids encoding the following 5' to 3': a W9F/L144F
T tengcongensis
49
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
H-NOX domain, a Gly-Ser-Gly amino acid linker sequence, a foldon domain, an
Arg-Gly-Ser
linker sequence, and a His6 tag. In some embodiments, the invention provides
nucleic acids
encoding the following 5' to 3': a wild-type T tengcongensis H-NOX domain, a
Gly-Ser-Gly
amino acid linker sequence, a foldon domain, an Arg-Gly-Ser linker sequence,
and a His6 tag.
[00181] In some embodiments, the nucleic acid comprises the nucleic acid
sequence set forth in
SEQ ID N0:5 or SEQ ID N0:7.
[00182] The invention also includes a cell or population of cells containing
at least one nucleic
acid encoding a mutant H-NOX protein described herein. Exemplary cells include
insect, plant,
yeast, bacterial, and mammalian cells. These cells are useful for the
production of mutant H-
NOX proteins using standard methods, such as those described herein.
[00183] In some embodiments, the invention provides a cell comprising a
nucleic acid encoding
an H-NOX domain and a foldon domain. In some embodiments, the H-NOX domain is
a T
the rmoanaerobacter H-NOX domain. In some embodiments, the H-NOX domain is a
wild-type
T thermoanaerobacter H-NOX domain. In some embodiments, the H-NOX domain is a
T
the rmoanaerobacter L144F H-NOX domain. In some embodiments, the H-NOX domain
is a T
the rmoanaerobacter W9F/L144F H-NOX domain. In some embodiments, the invention
provides a cell comprising a nucleic acid comprising the nucleic acid sequence
set forth in SEQ
ID NO:5 or SEQ ID N0:7.
Formulations of H-NOX Proteins
[00184] The present invention provides formulations of 02 carrier polypeptides
for use in
enhancing tumor immunogenicity; for example, by inhibiting the immune
suppressive activities
associated with tumor hypoxia. A non-limiting exemplary family of 02 carrier
polypeptides is
the H-NOX family of 02 carrier polypeptides. Any wild-type or mutant H-NOX
protein,
including polymeric H-NOX proteins, described herein may be used for the
formulation of
pharmaceutical or non-pharmaceutical compositions. In some embodiments, the
formulations
comprise a monomeric H-NOX protein comprising an H-NOX domain and a
polymerization
domain such that the monomeric H-NOX proteins associate in vitro or in vivo to
produce a
polymeric H-NOX protein. As discussed further below, these formulations are
useful in a
variety of therapeutic and industrial applications.
[00185] In some embodiments, the pharmaceutical composition includes one or
more wild-type
or mutant H-NOX proteins described herein including polymeric H-NOX proteins
and a
pharmaceutically acceptable carrier or excipient. Examples of pharmaceutically
acceptable
carriers or excipients include, but are not limited to, any of the standard
pharmaceutical carriers
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
or excipients such as phosphate buffered saline solutions, water, emulsions
such as oil/water
emulsion, and various types of wetting agents. Exemplary diluents for aerosol
or parenteral
administration are phosphate buffered saline or normal (0.9%) saline.
Compositions comprising
such carriers are formulated by well-known conventional methods (see, for
example,
Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro, ed., Mack
Publishing Co.,
Easton, PA, 1990; and Remington, The Science and Practice of Pharmacy 20th Ed.
Mack
Publishing, 2000, which are each hereby incorporated by reference in their
entireties,
particularly with respect to formulations). In some embodiments, the
formulations are sterile. In
some embodiments, the formulations are essentially free of endotoxin.
[00186] While any suitable carrier known to those of ordinary skill in the art
may be employed
in the pharmaceutical compositions of this invention, the type of carrier will
vary depending on
the mode of administration. Compositions can be formulated for any appropriate
manner of
administration, including, for example, intravenous, intra-arterial,
intravesicular, intratumoral,
inhalation, intraperitoneal, intrapulmonary, intramuscular, subcutaneous,
intra-tracheal,
transmucosal, intraocular, intrathecal, or transdermal administration. For
parenteral
administration, such as subcutaneous injection, the carrier may include, e.g.,
water, saline,
alcohol, a fat, a wax, or a buffer. For oral administration, any of the above
carriers or a solid
carrier, such as mannitol, lactose, starch, magnesium stearate, sodium
saccharine, talcum,
cellulose, glucose, sucrose, or magnesium carbonate, may be employed.
Biodegradable
microspheres (e.g., polylactate polyglycolate) may also be used as carriers.
[00187] In some embodiments, the pharmaceutical or non-pharmaceutical
compositions include
a buffer (e.g., neutral buffered saline, phosphate buffered saline, etc), a
carbohydrate (e.g.,
glucose, mannose, sucrose, dextran, etc.), an antioxidant, a chelating agent
(e.g., EDTA,
glutathione, etc.), a preservative, another compound useful for binding and/or
transporting
oxygen, an inactive ingredient (e.g., a stabilizer, filler, etc.), or
combinations of two or more of
the foregoing. In some embodiments, the composition is formulated as a
lyophilizate. H-NOX
proteins may also be encapsulated within liposomes or nanoparticles using well
known
technology. Other exemplary formulations that can be used for H-NOX proteins
are described
by, e.g., U.S. Pat. Nos. 6,974,795, and 6,432,918, which are each hereby
incorporated by
reference in their entireties, particularly with respect to formulations of
proteins.
[00188] The compositions described herein may be administered as part of a
sustained release
formulation (e.g., a formulation such as a capsule or sponge that produces a
slow release of
compound following administration). Such formulations may generally be
prepared using well
known technology and administered by, for example, oral, rectal or
subcutaneous implantation,
51
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
or by implantation at the desired target site. Sustained-release formulations
may contain an H-
NOX protein dispersed in a carrier matrix and/or contained within a reservoir
surrounded by a
rate controlling membrane. Carriers for use within such formulations are
biocompatible, and
may also be biodegradable. In some embodiments, the formulation provides a
relatively
constant level of H-NOX protein release. The amount of H-NOX protein contained
within a
sustained release formulation depends upon the site of implantation, the rate
and expected
duration of release, and the nature of the condition to be treated or
prevented.
[00189] In some embodiments, the pharmaceutical composition contains an
effective amount of
a wild-type or mutant H-NOX protein. In some embodiments, the pharmaceutical
composition
contains an effective amount of a polymeric H-NOX protein comprising two or
more wild-type
or mutant H-NOX domains. In some embodiments, the pharmaceutical composition
contains an
effective amount of a recombinant monomeric H-NOX protein comprising a wild-
type or mutant
H-NOX domain and a polymerization domain as described herein. In some
embodiments, the
formulation comprises a trimeric H-NOX protein comprising three monomers, each
monomer
comprising a T tengcongensis L144F H-NOX domain and a foldon domain. In some
embodiments, the formulation comprises a trimeric H-NOX protein comprising
three monomers,
each monomer comprising a T tengcongensis W9F/L144F H-NOX domain and a foldon
domain. In some embodiments, the formulation comprises a trimeric H-NOX
protein
comprising three monomers, each monomer comprising a T tengcongensis L144F H-
NOX
domain and a foldon domain. In some embodiments, the formulation comprises a
PEGylated
trimeric H-NOX protein comprising three monomers, each monomer comprising a T
tengcongensis L144F H-NOX domain and a foldon domain. In some embodiments, the
pharmaceutical composition comprises an 02 carrier polypeptide (e.g., an H-NOX
protein) in an
amount effective to modulate tumor immunity (e.g., enhance an immune response
to the tumor).
[00190] In some embodiments, an effective amount of an H-NOX protein for
administration to
a human is between a few grams to over about 350 grams. Other exemplary doses
of an H-NOX
protein include about any of 4.4., 5, 10, or 13 G/DL (where G/DL is the
concentration of the H-
NOX protein solution prior to infusion into the circulation) at an appropriate
infusion rate, such
as about 0.5 ml/min (see, for example, Winslow, R. Chapter 12 In Blood
Substitutes). It will be
appreciated that the unit content of active ingredients contained in an
individual dose of each
dosage form need not in itself constitute an effective amount since the
necessary effective
amount could be reached by the combined effect of a plurality of
administrations. The selection
of the amount of an H-NOX protein to include in a pharmaceutical composition
depends upon
52
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
the dosage form utilized, the condition being treated, and the particular
purpose to be achieved
according to the determination of the ordinarily skilled artisan in the field.
[00191] Exemplary compositions include genetically engineered, recombinant H-
NOX proteins,
which may be isolated or purified, comprising one or more mutations that
collectively impart
altered 02 or NO ligand-binding relative to the corresponding wild-type H-NOX
protein, and
operative as a physiologically compatible mammalian blood gas carrier. For
example, mutant
H-NOX proteins as described herein. In some embodiments, the H-NOX protein is
a polymeric
H-NOX protein. In some embodiments, the H-NOX protein is a recombinant
monomeric H-
NOX protein comprising a wild-type or mutant H-NOX domain and a polymerization
domain as
described herein. In some embodiments, the composition comprises a trimeric H-
NOX protein
comprising three monomers, each monomer comprising a T tengcongensis L144F H-
NOX
domain and a foldon domain. In some embodiments, the composition comprises a
trimeric H-
NOX protein comprising three monomers, each monomer comprising a T
tengcongensis
W9F/L144F H-NOX domain and a foldon domain. In some embodiments, the
composition
comprises a trimeric H-NOX protein comprising three monomers, each monomer
comprising a
T tengcongensis L144F H-NOX domain and a foldon domain. In some embodiments,
the
composition comprises a PEGylated trimeric H-NOX protein comprising three
monomers, each
monomer comprising a T tengcongensis L144F H-NOX domain and a foldon domain.
[00192] To reduce or prevent an immune response in human subjects who are
administered a
pharmaceutical composition, human H-NOX proteins or domains (either wild-type
human
proteins or human proteins into which one or more mutations have been
introduced) or other
non-antigenic H-NOX proteins or domains (e.g., mammalian H-NOX proteins) can
be used. To
reduce or eliminate the immunogenicity of H-NOX proteins derived from sources
other than
humans, amino acids in an H-NOX protein or H-NOX domain can be mutated to the
corresponding amino acids in a human H-NOX. For example, one or more amino
acids on the
surface of the tertiary structure of a non-human H-NOX protein can be mutated
to the
corresponding amino acid in a human H-NOX protein.
Methods to modulate tumor immunity
[00193] In some aspects, the invention provides methods modulate to tumor
immunity and thus
can be used in anticancer treatments. Hypoxic tumor microenvironments suppress
the host's
immune anti-tumor defenses by modulating multiple signaling pathways (Fig. 1)
including, but
not limited to, hypoxia inducible factor (HIF-1) signaling (Codo et al., 2014
Oncotarget, 5(17),
7651-7662; Lee, Mace, & Repasky, 2010 Int J Hyperthermia, 26(3), 232-246; Wei
et al., 2011
53
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
PLoS One, 6(1), e16195), miRNA epigenetic regulation of antitumor T cells,
MHC1 expression
on tumor cells, and recruitment of tumor associated macrophages and myeloid-
derived
suppressor cells (MDSC). Hypoxic activation of the HIF-1 pathway has been
shown to activate
adenosinergic A2 and PD-Li pathways which in turn inhibit recruitment and
activation of helper
and killer T-cells and NK cells (Noman et al., 2014 J Exp Med, 211(5), 781-
790; Ohta et al.,
2006 Proc Nall Acad Sci USA, 103(35), 13132-13137). Hypoxic activation of the
HIF-1
pathway may also lead to the recruitment and activation of inhibitory
regulatory T cells (Treg),
tumor associated macrophages (TAM) and other myeloid-derived suppressor cells
(MDSC)
(Chaturvedi et al., 2014 Proc Natl Acad Sci US A, 111(20), E2120-2129; Corzo
et al., 2010 J
Exp Med, 207(11), 2439-2453; Wei et al., 2011). HIF-1 pathway activation may
also directly
inhibit the ability of tumor cells to be recognized by immune system by
increasing tumor
shedding of MHC1 receptors (Siemens et al., 2008 Cancer Res, 68(12), 4746-
4753).
[00194] In some aspects, the invention provides methods for modulating tumor
immunity in an
individual with a tumor comprising administering to the individual an
effective amount of an 02
carrier polypeptide (e.g., an H-NOX protein). In some embodiments, the
modulating of tumor
immunity comprises enhancing an immune response to the tumor. In some
embodiments, the
invention provides methods for increasing leucocyte infiltration to a tumor in
an individual
comprising administering to the individual an effective amount of an 02
carrier polypeptide. In
some embodiments, the invention provides methods for increasing lymphocyte
infiltration to a
tumor in an individual comprising administering to the individual an effective
amount of an 02
carrier polypeptide. In some embodiments, the increase in lymphocyte
infiltration to the tumor
comprises an increase in infiltration of one or more of CD4 cells, CD8 cells,
or NK cells. In
some embodiments, the modulating of tumor immunity comprises increasing
antigen processing.
In some embodiments, the modulating of tumor immunity comprises increasing the
presentation
capabilities of dendritic cells (DC). In some embodiments, the modulating of
tumor immunity
comprises one or more of increasing lymphocyte infiltration to the tumor,
increasing antigen
processing, or increasing DC presentation capability. In some embodiments, the
modulating of
tumor immunity comprises lymphocyte activation. In some embodiments, the
modulateing of
tumor immunity comprises cytokine secretion. In some embodiments, the 02
carrier polypeptide
is a trimeric Tt H-NOX L144F polypeptide. In some embodiments, the 02 carrier
polypeptide is
a PEGylated trimeric Tt H-NOX L144F polypeptide.
[00195] In some embodiments of the invention, the increase in lymphocyte
infiltration to the
tumor is accompanied by inhibition of one or more of Treg cells, tumor
associated macrophages
or myeloid derived suppressor cells in the tumor. In some embodiments, the
increase in
54
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
lymphocyte infiltration to the tumor is accompanied by an increase in MHC1
expression on the
tumor cells.
[00196] In some embodiments, the invention provides methods for decreasing
expression of
HIF-1a in a tumor in an individual comprising administering to the individual
an effective
amount of an 02 carrier polypeptide (e.g. an H-NOX protein). In some
embodiments,
administration of an effective amount of an 02 carrier polypeptide (e.g., an H-
NOX protein) to
an individual results in a decrease in expression of HIF-1a. In some
embodiments, the
expression of HIF-la is decreased by more than about any of 10%, 20%, 30%,
40%, 50%, 60%,
70%, 80%, 90% or 100% compared to expression of HIF-la in the absence of
treatment with an
02 carrier polypeptide. In some embodiments, the expression of HIF-la is
reduced compared to
expression of HIF-1a in the absence of treatment with an 02 carrier protein
for more than about
any of 1 hr, 2 hr, 3 hr, 4 hr, 5 hr, 6 hr, 8 hr, 10 hr, 12 hr, 16 hr, 20 hr,
24 hr, 30 hr, 36, hr 42 hr or
48 hr. In some embodiments, the 02 carrier polypeptide is a trimeric Tt H-NOX
L144F
polypeptide. In some embodiments, the 02 carrier polypeptide is a PEGylated
trimeric Tt H-
NOX L144F polypeptide.
[00197] In some embodiments, the invention provides methods for decreasing
expression of
HIF-1a in a tumor in an individual comprising administering to the individual
an effective
amount of an 02 carrier polypeptide (e.g. an H-NOX protein) wherein the
decrease in expression
of HIF-la is measured as a decrease in expression of vascular epithelial cell
growth factor
(VEGF). In some embodiments, administration of an effective amount of an 02
carrier
polypeptide (e.g., an H-NOX protein) to an individual results in a decrease in
expression of
VEGF. In some embodiments, the expression of VEGF is decreased by more than
about any of
10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% compared to expression of
VEGF
in the absence of treatment with an 02 carrier polypeptide. In some
embodiments, the expression
of VEGF is reduced compared to expression of VEGF in the absence of treatment
with an 02
carrier protein for more than about any of 1 hr, 2 hr, 3 hr, 4 hr, 5 hr, 6 hr,
8 hr, 10 hr, 12 hr, 16
hr, 20 hr, 24 hr, 30 hr, 36, hr 42 hr or 48 hr. In some embodiments, the 02
carrier polypeptide is
a trimeric Tt H-NOX L144F polypeptide. In some embodiments, the 02 carrier
polypeptide is a
PEGylated trimeric Tt H-NOX L144F polypeptide.
[00198] In some embodiments, the invention provides methods for decreasing
expression of
HIF-la in a tumor in an individual comprising administering to the individual
an effective
amount of an 02 carrier polypeptide (e.g. an H-NOX protein) herein the
decrease in expression
of HIF-la is measured as a decrease in expression of glucose transporter type
1(Glut1). In some
embodiments, administration of an effective amount of an 02 carrier
polypeptide (e.g., an H-
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
NOX protein) to an individual results in a decrease in expression of Glutl. In
some
embodiments, the expression of Glutl is decreased by more than about any of
10%, 20%, 30%,
40%, 50%, 60%, 70%, 80%, 90% or 100% compared to expression of Glutl in the
absence of
treatment with an 02 carrier polypeptide. In some embodiments, the expression
of Glutl is
reduced compared to expression of Glutl in the absence of treatment with an 02
carrier protein
for more than about any of 1 hr, 2 hr, 3 hr, 4 hr, 5 hr, 6 hr, 8 hr, 10 hr, 12
hr, 16 hr, 20 hr, 24 hr,
30 hr, 36, hr 42 hr or 48 hr. In some embodiments, the 02 carrier polypeptide
is a trimeric Tt H-
NOX L144F polypeptide. In some embodiments, the 02 carrier polypeptide is a
PEGylated
trimeric Tt H-NOX L144F polypeptide.
[00199] In some embodiments, the invention provides methods for decreasing
expression of
PD-Li in a tumor in an individual comprising administering to the individual
an effective
amount of an 02 carrier polypeptide (e.g. an H-NOX protein). In some
embodiments,
administration of an effective amount of an 02 carrier polypeptide (e.g., an H-
NOX protein) to
an individual results in a decrease in expression of PD-Li. In some
embodiments, the
expression of PD-Li is decreased by more than about any of 10%, 20%, 30%, 40%,
50%, 60%,
70%, 80%, 90% or 100% compared to expression of PD-Li in the absence of
treatment with an
02 carrier polypeptide. In some embodiments, administration of an effective
amount of an 02
carrier polypeptide (e.g., an H-NOX protein) to an individual results in a
decrease in the
interaction of PD-Li with PD-1. In some embodiments, the interaction of PD-Li
with PD1 is
decreased by more than about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%,
90% or
100% compared to interaction of PD-Li with PD1 in the absence of treatment
with an 02 carrier
polypeptide. In some embodiments, the expression of PD-Li is reduced compared
to expression
of PD-Li in the absence of treatment with an 02 carrier protein for more than
about any of 1 hr,
2 hr, 3 hr, 4 hr, 5 hr, 6 hr, 8 hr, 10 hr, 12 hr, 16 hr, 20 hr, 24 hr, 30 hr,
36, hr 42 hr or 48 hr. In
some embodiments, the 02 carrier polypeptide is a trimeric Tt H-NOX L144F
polypeptide. In
some embodiments, the 02 carrier polypeptide is a PEGylated trimeric Tt H-NOX
L144F
polypeptide.
[00200] In some embodiments, the invention provides methods for decreasing
expression of
A2AR in a tumor in an individual comprising administering to the individual an
effective
amount of an 02 carrier polypeptide (e.g. an H-NOX protein). In some
embodiments,
administration of an effective amount of an 02 carrier polypeptide (e.g., an H-
NOX protein) to
an individual results in a decrease in expression of A2AR. In some
embodiments, the expression
of A2AR is decreased by more than about any of 10%, 20%, 30%, 40%, 50%, 60%,
70%, 80%,
90% or 100% compared to expression of A2AR in the absence of treatment with an
02 carrier
56
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
polypeptide. In some embodiments, administration of an effective amount of an
02 carrier
polypeptide (e.g., an H-NOX protein) to an individual results in a decrease in
the interaction of
A2AR with adenosine. In some embodiments, the interaction of A2AR with
adenosine is
decreased by more than about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%,
90% or
100% compared to interaction of A2AR with adenosine in the absence of
treatment with an 02
carrier polypeptide. In some embodiments, the expression of A2AR is reduced
compared to
expression of A2AR in the absence of treatment with an 02 carrier protein for
more than about
any of 1 hr, 2 hr, 3 hr, 4 hr, 5 hr, 6 hr, 8 hr, 10 hr, 12 hr, 16 hr, 20 hr,
24 hr, 30 hr, 36, hr 42 hr or
48 hr. In some embodiments, the 02 carrier polypeptide is a trimeric Tt H-NOX
L144F
polypeptide. In some embodiments, the 02 carrier polypeptide is a PEGylated
trimeric Tt H-
NOX L144F polypeptide.
[00201] In some embodiments, the invention provides methods for decreasing
expression of
HIF-2a in a tumor in an individual comprising administering to the individual
an effective
amount of an 02 carrier polypeptide (e.g. an H-NOX protein). In some
embodiments,
administration of an effective amount of an 02 carrier polypeptide (e.g., an H-
NOX protein) to
an individual results in a decrease in expression of HIF-2a. In some
embodiments, the
expression of HIF-2a is decreased by more than about any of 10%, 20%, 30%,
40%, 50%, 60%,
70%, 80%, 90% or 100% compared to expression of HIF-2a in the absence of
treatment with an
02 carrier polypeptide. In some embodiments, administration of an effective
amount of an 02
carrier polypeptide (e.g., an H-NOX protein) to an individual results in a
decrease in the
expression of HIF-2a. In some embodiments, the expression of HIF-2a is
decreased by more
than about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% compared
to
expressoin of HIF-2a in the absence of treatment with an 02 carrier
polypeptide. In some
embodiments, the expression of HIF-2a is reduced compared to expression of HIF-
2a in the
absence of treatment with an 02 carrier protein for more than about any of 1
hr, 2 hr, 3 hr, 4 hr, 5
hr, 6 hr, 8 hr, 10 hr, 12 hr, 16 hr, 20 hr, 24 hr, 30 hr, 36, hr 42 hr or 48
hr. In some
embodiments, the 02 carrier polypeptide is a trimeric Tt H-NOX L144F
polypeptide. In some
embodiments, the 02 carrier polypeptide is a PEGylated trimeric Tt H-NOX L144F
polypeptide.
[00202] In some embodiments, the invention provides methods for modulating
tumor immunity
(e.g., enhancing an immune response to a tumor) in an individual by any of the
methods
described herein. Examples of tumors include but are not limited to a brain
tumor, a
glioblastoma, a bone tumor, a pancreatic tumor, a skin tumor, a tumor of the
head or neck, a
melanoma, a lung tumor, a uterine tumor, an ovarian tumor, a colorectal tumor,
an anal tumor, a
liver tumor, a hepatocellular carcinoma, a stomach tumor, a testicular tumor,
an endometrial
57
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
tumor, a cervical tumor, a vaginal tumor, a Hodgkin's lymphoma, a non-
Hodgkin's lymphoma,
an esophageal tumor, an intestinal tumor, a thyroid tumor, an adrenal tumor, a
bladder tumor, a
kidney tumor, a breast tumor, a multiple myeloma tumor, a sarcoma, or a
squamous cell tumor.
[00203] In some embodiments, the invention provides methods for modulating
tumor immunity
(e.g., enhancing an immune response to a tumor) in an individual by any of the
methods
described herein thereby providing methods for treating cancer in an
individual. Examples of
cancers that may be treated by the methods of the invention include but are
not limited to brain
cancer, glioblastoma, bone cancer, pancreatic cancer, skin cancer, cancer of
the head or neck,
melanoma, lung cancer, uterine cancer, ovarian cancer, colorectal cancer, anal
cancer, liver
cancer, hepatocellular carcinoma, stomach cancer, testicular cancer,
endometrial cancer, cervical
cancer, Hodgkin's Disease, non-Hodgkin's lymphoma, esophageal cancer,
intestinal cancer,
thyroid cancer, adrenal cancer, bladder cancer, kidney cancer, breast cancer,
multiple myeloma,
sarcoma, or squamous cell cancer.
[00204] In some embodiments, the invention provides methods for modulating
tumor immunity
in an individual by any of the methods described herein. In some embodiments,
the individual is
a mammal; for example a human. In some embodiments, the mammal is a pet, a
laboratory
research animal, or a farm animal. Non-limiting examples of pets, research
animals or farm
animals include dogs, cats, horses, monkeys, rabbits, rats, mice, guinea pigs,
hamsters, pigs and
cows.
[00205] 02 carrier polypeptides may be administered by any route including but
not limited to
intravenous, intra-arterial, intratumoral, intravesicular, inhalation,
intraperitoneal,
intrapulmonary, intramuscular, subcutaneous, intra-tracheal, transmucosal,
intraocular,
intrathecal, or transdermal administration.
[00206] In some aspects, sustained delivery of oxygen to a tumor is desired to
inhibit hypoxia-
mediated tumor immunity and to enhance an immune response to the tumor. In
some
embodiments of the invention, administration of the 02 carrier polypeptide
(e.g., H-NOX
protein) is repeated. Administration of the 02 carrier polypeptide may be
repeated until a robust
immune response to the tumor is established. In some embodiments,
administration of the 02
carrier polypeptide is repeated at least about any one of two times, three
times, four times, five
times, six times, seven times, eight times, nine times, ten times, twelve
times, fourteen times,
twenty times, thirty times, forty times, fifty times or one hundred times. In
some embodiments,
administration of the 02 carrier polypeptide is repeated between about two
times and about
twenty times. In some embodiments, administration of the 02 carrier
polypeptide is repeated
between any one of about twenty times and about forty times, any one of about
forty times and
58
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
about sixty times, any one of about sixty times and about eighty times, any
one of about eighty
times and about one hundred times, or any number of times therebetween. In
some
embodiments, administration of the 02 carrier polypeptide is repeated daily or
twice a day for
about 42 to about 84 administrations.
[00207] Exemplary dosing frequencies include, but are not limited to, at least
1, 2, 3, 4, 5, 6, or
7 times (i.e., daily) a week. In some embodiments, the 02 carrier polypeptide
(e.g., H-NOX
protein) is administered at least 2, 3, 4, or 6 times a day. In some
embodiments, the 02 carrier
polypeptide is administered every four, every 8, every 12, every 24 hours,
every 48 hours or two
times a week or three times a week. In some embodiments, the 02 carrier
polypeptide is
administered any one of between one hour and two hours, between two hours and
four hours,
between four hours and eight hours, between eight hours and twelve hours, or
between twelve
hours and 24 hours. In some embodiments, the 02 carrier polypeptide is
administered every
four, every 8, every 12 or every 24 hours for a period of about one to about
10 days. In some
embodiments, the 02 carrier polypeptide can be administered, e.g., over a
period of a few days
or weeks. In some embodiments, the 02 carrier polypeptide is administrated for
a longer period,
such as a few months or years. The dosing frequency of the composition may be
adjusted over
the course of the treatment based on the judgment of the administering
physician.
[00208] In some embodiments, the 02 carrier polypeptide (e.g., H-NOX protein)
is
administered as a bolus. In some embodiments, the volume of the bolus is
greater than about
any of 1 mL, 2 mL, 3 mL, 4 mL, 5 mL, 6 mL, 7 mL, 8 mL, 9 mL, 10 mL, 15 mL, 20
mL, 25 mL,
50 mL, 75 mL, or 100 mL. In some embodiments, administration of the bolus dose
is repeated as
above.
[00209] In some embodiments, the 02 carrier polypeptide (e.g., H-NOX protein)
is
administered by infusion. In some embodiments, the infusions is for greater
than about any of
15 minutes, 30 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7
hours, 8 hours, 9
hours, 10 hours, 12 hours, 16 hours, 20 hours or 24 hours. In some
embodiments, the infusions
is for between about any of 15 minutes and 30 minutes, 30 minutes and 1 hour,
1 hour and 2
hours, 2 hours and 3 hours, 3 hours and 4 hours, 4 hours and 5 hours, 5 hours
and 6 hours, 6
hours and 7 hours, 7 hours and 8 hours, 8 hours and 9 hours, 9 hours and 10
hours, 10 hours and
12 hours, 12 hours and 16 hours, 16 hours and 20 hours or 20 hours and 24
hours. In some
embodiments, the infusion rate is greater any of about 1 mL/hr, 2 mL/hr, 3
mL/hr, 4 mL/hr, 5
mL/hr, 6 mL/hr, 7 mL/hr, 8 mL/hr, 9 mL/hr, 10 mL/hr, 20 mL/hr, 30 mL/hr, 40
mL/hr, 50
mL/hr, 60 mL/hr, 70 mL/hr, 80 mL/hr, 90 mL/hr, 100 mL/hr, 200 mL/hr, 300
mL/hr, 400 mL/hr,
500 mL/hr, 600 mL/hr, 700 mL/hr, 800 mL/hr, 900 mL/hr, 1000 mL/hr, 2000 mL/hr,
3000
59
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
mL/hr, 4000 mL/hr, 5000 mL/hr, 6000 mL/hr, 7000 mL/hr, 8000 mL/hr, 9000 mL/hr,
10,000
mL/hr or any rate therebetween. In some embodiments, the infusion is repeated
as above.
[00210] In some embodiments, the 02 carrier polypeptide (e.g., H-NOX protein)
is
administered at a dose of greater than about any of 1 mg/kg, 2 mg/kg, 3 mg/kg,
4 mg/kg, 5
mg/kg, 6 mg/kg, 7 mg/kg, 8 mg/kg, 9 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25
mg/kg, 30
mg/kg, 35 mg/kg, 40 mg/kg, 45 mg/kg, 50 mg/kg, 55 mg/kg, 60 mg/kg, 65 mg/kg,
70 mg/kg, 75
mg/kg, 80 mg/kg, 85 mg/kg, 90 mg/kg, 95 mg/kg, 100 mg/kg, 200 mg/kg, 300
mg/kg, 400
mg/kg, 500 mg/kg, 600 mg/kg, 700 mg/kg, 800 mg/kg, 900 mg/kg, 1000 mg/kg, or
any dose
therebetween. In some embodiments, the dose is provided as one or more bolus
administrations.
In some embodiments, the dose is provided as one or more infusions. In some
embodiments the
dose is provided in more than one administration (e.g., a dose of 100 mg/kg
may be provided by
two doses of 50 mg/kg).
[00211] In some embodiments of the invention, the 02 carrier polypeptide (e.g.
an H-NOX
protein) is used in combination with radiation therapy. In some embodiments,
the 02 carrier
polypeptide is administered to the individual any of at least 1, 2, 3, 4, 5,
6, 8, 10, 12, 14, 16, 18,
20, 22, or 24 hours before administration of the radiation. In some
embodiments, the radiation is
X irradiation. In some embodiments, the dose of X irradiation is any of about
0.5 Gy to about
75 Gy. In some embodiments, the cycle of 02 carrier polypeptide administration
and radiation
administration is repeated any one of one, two, three, four, five or six
times. In some
embodiments, the cycle of 02 carrier polypeptide administration and radiation
administration is
repeated after any one of about one week, two weeks, three weeks, four weeks,
five weeks or six
weeks. In some embodiments, the administration of the 02 carrier polypeptide
and radiation
therapy is used in conjunction with another therapy; for example, a
chemotherapy and/or
immunotherapy.
[00212] In some embodiments of the invention, the 02 carrier polypeptide (e.g.
an H-NOX
protein) is used in combination with chemotherapy. In some embodiments, the
chemotherapy is
a cytotoxin. Chemotherapeutic agents including cytotoxins are known in the
art. In some
embodiments, the cytotoxin is an alkylating agent. In some embodiments, the
cytotoxin is
cyclophosphamide or temozolomide. In some embodiments, the 02 carrier
polypeptide is
administered before administration of the chemotherapy. In some embodiments,
the 02 carrier
polypeptide is administered with administration of the chemotherapy. In some
embodiments,
the 02 carrier polypeptide is administered after administration of the
chemotherapy. In some
embodiments, the 02 carrier polypeptide is administered to the individual any
of at least 1, 2, 3,
4, 5, 6, 7, 8, 10, 12, 14, 16, 18, 20, 22, or 24 hours or is administered
daily or twice a day for 1,
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
2, 3, 4, 5, 6, or 7 days before administration of the chemotherapy. In some
embodiments, the 02
carrier polypeptide is administered to the individual any of at least 1, 2, 3,
4, 5, 6, 7, 8, 10, 12, or
24 hours after administration of the chemotherapy. In some embodiments,
administration of the
02 carrier polypeptide and/or administration of the chemotherapy is repeated
any one of one,
two, three, four, five, six, seven, eight, nine, ten times or more than ten
times. In some
embodiments, administration of the 02 carrier polypeptide and/or
administration of the
chemotherapy is repeated after any one of about one week, two weeks, three
weeks, four weeks,
five weeks or six weeks. In some embodiments, administration of the 02 carrier
polypeptide and
the chemotherapy are on the same dosing cycle. In some embodiments,
administration of the 02
carrier polypeptide and the chemotherapy are on different dosing cycles. In
some embodiments,
the admiration of H-NOX and radiation therapy is used in conjunction with
another therapy; for
example, radiation therapy and/or immunotherapy.
[00213] In some embodiments, the 02 carrier polypeptide (e.g., an H-NOX
protein) is
administered to cancer patients prior to and/or in conjunction with an
immunotherapy. In some
embodiments, the immunotherapy is one or more of an anticancer vaccine, an
adoptive immune
cell therapy, an agent that targets an immune checkpoint regulator, an
oncolytic virus or a BiTE.
In some embodiments, the immunotherapy targets are one or more of CTLA-4, PD1,
PD-L1, or
an immune checkpoint regulator. In some embodiments, the immunotherapy is a
dual
PD1/CTLA-4 blockade therapy. In some embodiments, the immunotherapy is a PDL-1
treatment for patients with PDL1+ tumors or dual PD1/PD-L1 blockade.
Nonlimiting examples
include but are not limited to PD-1 and PDL-1 antagonists such as antibodies
(e.g., Nivolumab).
In some emobiments the checkpoint inhibitor is a CTLA4 antagonist such as an
antibody (e.g.,
ipilumumab). In some embodiments, the immunotherapy is an adoptive T cell
therapy including
but not limited to chimeric antigen receptor T cells (e.g., CAR-T cells) or
engineered TCR-T
cells. In some embodiments, the immunotherapy is a Bispecific T cell Engagers
(BiTE). In
some embodiments, the immunotherapy includes one or more of anti-lymphocyte
activation
gene3 (LAG-3) therapy, anti-T cell immunoglobin mucin-3 (TIM-3) therapy, anti-
killer
immunoglobin-like receptos (KIR) thereapy, anti-4-1BB (CD137)
agonizing/stimulatory
therapy, or glucocorticoid-induced TNFR family related gene (GITR)
agonizing/stimulatory
therepy ¨ each alone or in combinations with each other, and/or in combination
with one or more
of PD1, PDL-1, CTLA-4 or other therapies.
[00214] Nonlimiting examples of therapies that target checkpoint proteins
other than PD-
1/PDL-1 and CTLA4 negative regulators include both positive and negative
(checkpoint
inhibitors) regulators of immune response and can be antibodies or small
molecules such as IDO
61
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
(indoleamine-2.3 dioxygenase) pathway inhibitors such as direct IDO enzymatic
activity
inhibitors (e.g. NLG919), IDO effector pathway inhibitors (e.g. D-1-methyl-
tryptophan,
Indoximod, NLG8189), TDO (tryptophan 2,3-dioxygenase) inhibitors, or IDO-TDO
dual
inhibitors; Lymphocyte-activation gene 3 (LAG-3, CD223) antibody antagonists
(e.g. IMP321,
BMS-986016); Killer immunoglobulin-like receptors (KIRs) antagonists such as
antibodies (e.g.
lirilumab, IPH2101); T cell immunoglobulin mucin-3 (TIM-3) antagonists such as
antibodies; B-
and T cell attenuator (BTLA, CD272) antagonists such as antibodies; 0X40
(CD134) agonists
such as activating/stimulating antibodies; 4-1BB (CD137) agonists such as
stimulatory
antibodies (e.g. BMS-663513); Glucocorticoid-induced TNFR family related gene
(GITR)
agonists such as stimulatory antibodies (e.g. TRX518); and oncolytic viruses.
[00215] In some embodiments, the 02 carrier polypeptide is administered before
administration
of the immunotherapy. In some embodiments, the 02 carrier polypeptide is
administered with
administration of the immunotherapy. In some embodiments, the 02 carrier
polypeptide is
administered after administration of the immunotherapy. In some embodiments,
the 02 carrier
polypeptide is administered to the individual any of at least 1, 2, 3, 4, 5,
6, 7, 8, 10, 12, 24, or 48
hours before administration of the immunotherapy. In some embodiments, the 02
carrier
polypeptide is administered to the individual any of at least 3, 4, 5, 6, 7 or
more days before
administration of the immunotherapy. In some embodiments, the 02 carrier
polypeptide is
administered to the individual any of at least 1, 2, 3, 4, 5, 6, 7, 8, 10, 12,
24 or 48 hours after
administration of the immunotherapy. In some embodiments, the 02 carrier
polypeptide is
administered to the individual any of at least 3, 4, 5, 6, 7 or more days
after administration of the
immunotherapy. In some embodiments, administration of the 02 carrier
polypeptide and/or
administration of the immunotherapy is repeated any one of one, two, three,
four, five, six,
seven, eight, nine, ten times or more than ten times. In some embodiments,
administration of the
02 carrier polypeptide and/or administration of the immunotherapy is repeated
after any one of
about one week, two weeks, three weeks, four weeks, five weeks or six weeks.
In some
embodiments, administration of the 02 carrier polypeptide and the
immunotherapy are on the
same dosing cycle. In some embodiments, administration of the 02 carrier
polypeptide and the
immunotherapy are on different dosing cycles. In some embodiments, the
admiration of H-NOX
and radiation therapy is used in conjunction with another therapy; for
example, radiation therapy
and/or chemotherapy.
[00216] In some embodiments, the effectiveness of administration of the 02
carrier polypeptide
(e.g., H-NOX protein) is monitored; for example but not limited to tumor
hypoxia, expression
hypoxia-associated tumor suppressors and/or activators, presence of tumor-
associated immune
62
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
cells and/or immune cells directed against tumor cells and/or local (tumor
biopsy, lymph node
biopsy) or systemic (e.g. peripheral blood) cytokine and immune cell profiles.
Methods to
determine the level of tumor hypoxia are known in the art. Examples include
but are not limited
to measurement of any one of 18F-fluoromisonidazole (FMISO) tumor uptake,
pimidazole
uptake, 18F-fluoroazomycin arabinoside (FAZA) uptake, a nitroimidazole uptake,
Copper(II)-
diacetyl-bis(N4-methylthiosemicarbazone (Cu-ATSM) uptake, hexafluorobenzene
(C6F6)
uptake by 19F magnetic resonance imaging, hexamethyldisiloxane uptake by 1H
MRI, tumor
HIF-la expression, tumor HIF-2a expression, tumor HIF-3a expression, tumor
Glut-1
expression, tumor pH (pH-weighted MRI) qBOLD, 0E-MRI, MOBILE MRI tumor LDHA
expression, tumor carbonic anhydrase IX (CA-9) expression, VEGF expression, or
lactate and/or
pyruvate levels. In some embodiments of the methods of monitoring, treating,
and optimization
of therapy described above, tumor hypoxia is measured by 18F-FMISO uptake. In
some
embodiments, 18F-FMISO uptake is measured by Positron emission tomography
(PET) scan,
computed tomography (CT) scan or computed axial tomography (CAT) scan. Methods
to detect
expression of genes such as HIF-1 a, PD-Li and A2AR are known in the art; for
example, by
immunoassay, by immunohistochemistry, by quantitative PCR, by hybridization
(for example,
on a gene chip), and the like.
Kits with H-NOX proteins
[00217] Also provided are articles of manufacture and kits for the modulation
of tumor
immunity in an individual. In some embodiments, the article of manufacture or
kit comprises
any of the 02 carrier polypeptides including any of the H-NOX proteins
described herein
including polymeric H-NOX proteins and PEGylated polymeric H-NOX proteins, and
suitable
packaging. In some embodiments, the invention includes a kit with (i) a H-NOX
protein (such
as a wild-type or mutant H-NOX protein described herein or formulations
thereof as described
herein) and (ii) instructions for using the kit to deliver 02 to an
individual.
[00218] Suitable packaging for compositions described herein are known in the
art, and include,
for example, vials (e.g., sealed vials), vessels, ampules, bottles, jars,
flexible packaging (e.g.,
sealed Mylar or plastic bags), and the like. These articles of manufacture may
further be
sterilized and/or sealed. Also provided are unit dosage forms comprising the
compositions
described herein. These unit dosage forms can be stored in a suitable
packaging in single or
multiple unit dosages and may also be further sterilized and sealed.
Instructions supplied in the
kits of the invention are typically written instructions on a label or package
insert (e.g., a paper
sheet included in the kit), but machine-readable instructions (e.g.,
instructions carried on a
63
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
magnetic or optical storage disk) are also acceptable. The instructions
relating to the use of H-
NOX proteins generally include information regarding dosage, dosing schedule,
and route of
administration for the intended treatment or industrial use. The kit may
further comprise a
description of selecting an individual suitable for treatment.
[00219] The containers may be unit doses, bulk packages (e.g., multi-dose
packages) or sub-
unit doses. For example, kits may also be provided that contain sufficient
dosages of H-NOX
proteins disclosed herein to provide effective treatment for an individual for
an extended period,
such as about any of a week, 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 3
months, 4 months,
months, 6 months, 7 months, 8 months, 9 months, or more. Kits may also include
multiple
unit doses of H-NOX proteins and instructions for use and packaged in
quantities sufficient for
storage and use in pharmacies, for example, hospital pharmacies and
compounding pharmacies.
In some embodiments, the kit includes a dry (e.g., lyophilized) composition
that can be
reconstituted, resuspended, or rehydrated to form generally a stable aqueous
suspension of H-
NOX protein.
Exemplary Methods for Production of H-NOX Proteins
[00220] As noted above, the sequences of several wild-type H-NOX proteins and
nucleic acids
are known and can be used to generate mutant H-NOX domains and nucleic acids
of the present
invention. Techniques for the mutation, expression, and purification of
recombinant H-NOX
proteins have been described by, e.g., Boon, E.M. et al. (2005). Nature
Chemical Biology 1:53-
59 and Karow, D. S. et al. (August 10, 2004). Biochemistry 43(31):10203-10211,
US Patent Nos
8,404,631 and 8,404,632, WO 2007/139791, and WO 2007/139767 which are hereby
incorporated by reference in their entireties, particularly with respect to
the mutation, expression,
and purification of recombinant H-NOX proteins. These techniques or other
standard techniques
can be used to generate any mutant H-NOX protein.
[00221] A mutant H-NOX nucleic acid can be incorporated into a vector, such as
an expression
vector, using standard techniques. For example, restriction enzymes can be
used to cleave the
mutant H-NOX nucleic acid and the vector. Then, the compatible ends of the
cleaved mutant H-
NOX nucleic acid and the cleaved vector can be ligated. The resulting vector
can be inserted
into a cell (e.g., an insect cell, a plant cell, a yeast cell, or a bacterial
cell) using standard
techniques (e.g., electroporation) for expression of the encoded H-NOX
protein.
[00222] In particular, heterologous proteins have been expressed in a number
of biological
expression systems, such as insect cells, plant cells, yeast cells, and
bacterial cells. Thus, any
suitable biological protein expression system can be utilized to produce large
quantities of
64
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
recombinant H-NOX protein. In some embodiments, the H-NOX protein (e.g., a
mutant or wild-
type H-NOX protein) is an isolated protein.
[00223] If desired, H-NOX proteins can be purified using standard techniques.
In some
embodiments, the protein is at least about 60%, by weight, free from other
components that are
present when the protein is produced. In various embodiments, the protein is
at least about 75%,
90%, or 99%, by weight, pure. A purified protein can be obtained, for example,
by purification
(e.g., extraction) from a natural source, a recombinant expression system, or
a reaction mixture
for chemical synthesis. Exemplary methods of purification include
immunoprecipitation,
column chromatography such as immunoaffinity chromatography, magnetic bead
immunoaffinity purification, and panning with a plate-bound antibody, as well
as other
techniques known to the skilled artisan. Purity can be assayed by any
appropriate method, e.g.,
by column chromatography, polyacrylamide gel electrophoresis, or HPLC
analysis. In some
embodiments, the purified protein is incorporated into a pharmaceutical
composition of the
invention or used in a method of the invention. The pharmaceutical composition
of the
invention may have additives, carriers, or other components in addition to the
purified protein.
[00224] In some embodiments, the polymeric H-NOX protein comprises one or more
His6 tags.
An H-NOX protein comprising at least one His6 tag may be purified using
chromatography; for
example, using Ni2 -affinity chromatography. Following purification, the His6
tag may be
removed; for example, by using an exopeptidase. In some embodiments, the
invention provides
a purified polymeric H-NOX protein, wherein the polymeric H-NOX protein was
purified
through the use of a His6 tag. In some embodiments, the purified H-NOX protein
is treated with
an exopeptidase to remove the His6 tags.
[00225] In some embodiments, H-NOX protein comprises one or more molecules of
polyethylene glycol (i.e., PEGylated). Methods to produce PEGylated proteins
are known in
the art.
EXAMPLES
[00226] The examples, which are intended to be purely exemplary of the
invention and should
therefore not be considered to limit the invention in any way, also describe
and detail aspects
and embodiments of the invention discussed above. The examples are not
intended to represent
that the experiments below are all or the only experiments performed. Unless
indicated
otherwise, temperature is in degrees Centigrade and pressure is at or near
atmospheric.
Example 1. H-NOX enables efficient oxygenation of hypoxic tumor
microenvironments
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[00227] A PEGylated trimeric The rmoanaerobacter tengcongensis (Tt.) H-NOX
bearing a
L144F substitution in the distal pocket (Fig. 6B) was evaluated for the
ability to oxygenate
tumor microenvironments and increase radiation sensitity. Administration of
the PEGylated
trimeric Tt H-NOX L144F to mice bearing hypoxic tumors induces rapid and
sustained
oxygenation of the tumors as directly measured by the external hypoxia marker,
pimonidazole,
hypoxia inducible transcription factor 1 alpha, HIF-1-a, and OxyLite oxygen-
sensing nanofiber
(Figs 2 and 3, respectively).
[00228] Mice bearing H460 subcutaneous xenograft tumors were injected i.v.
with PEGylated
trimer H-NOX (L144F) at 650mg/kg when tumor volume reached ¨300-350 mm3 (-10-
14 days
after tumor cell subcutaneous implantation). Prior to euthanasia, mice were
injected with the
exogenous hypoxia marker pimonidazole at 60mg/kg and tumors were harvested.
Pimonidazole
(Fig. 2A) (Hypoxyprobe-1) and HIF-la (Fig. 2B) levels were measured by
competitive
(pimonidazole) and sandwich (HIF-la, Abcam) ELISAs, respectively. Graphs show
quantification of pimonidazole and HIF-la signals after PEGylated H-NOX
(L144F)
administration. Vehicle, lh and 4h: n=22, 7h: n=18, 12h: n=16, 24h: n=6.
Results from 4
independent experiments. Mean values +/- SEM. **** p<0.0001, *** p<0.001, **
p<0.01, *
p<0.05 by one-way ANOVA and Bonferroni's post-hoc tests. (Fig. 2C) Tumors were
assessed
for the accumulation of PEGylated H-NOX (L144F) by sandwich H-NOX ELISA at 1,
4, 7, 16
and 24 hours after injection and results expressed per gram of tumor tissue.
Seven to eight week
old Nu/Nu female mice were subcutaneously implanted with 3 x 106 of H460 human
lung cancer
cells and monitored until the tumors reached average size of ¨300 mm3 (10-14
days post-
implantation of tumor cells). Mice bearing 200-350 mm3 xenograft tumors were
injected i.v.
with bolus vehicle (formulation buffer: 50 mM succinate, 50 mM NaC1, 3.4 mM
EDTA, and 10
mM reduced glutathione at pH 7) or formulation buffer containing 650mg/kg of
PEGylated
trimer H-NOX (L144F). To measure tumor hypoxia, prior to euthanasia, mice were
injected with
the exogenous hypoxia marker pimonidazole at 60mg/kg. Tumors were harvested
and
homogenized in an extraction buffer (Abcam kit # ab117996) supplemented with
anti-proteases.
Protein concentration was quantified in each tumor using a Bradford assay.
Samples were
assayed for pimonidazole (Hypoxyprobe-1) amount using a competitive ELISA
assay developed
by Omniox and for HIF-la using the Abcam ELISA kit (ab117996).
[00229] In H460 lung carcinoma mouse model maximum oxygenation was achieved
between
4h and 8h and it correlated with the peak of H-NOX (L144F) tumor accumulation
as assessed by
ELISA (Fig 2C).
66
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[00230] For assessment of the H-NOX (L144F) tumor accumulation, tumors were
harvested at
different timepoints after injection. Tumors were homogenized in an extraction
buffer (Abcam
kit # ab117996) supplemented with anti-proteases and protein concentration was
quantified in
each tumor using a Bradford assay. PEGylated H-NOX (L144F) concentration was
quantified by
a sandwich ELISA for H-NOX developed by Omniox and normalized to tumor weight.
[00231] While supplemental oxygenation of animals successfully increased
oxygenation of
mouse tumor tissue at 5-10 mmHg oxygen concentration, it had no effect on
regions with lower
oxygen levels (<5 mmHg). By contrast, PEGylated trimer Tt H-NOX L144F is
capable of
increasing oxygenation even in severely hypoxic tumor tissue (<5 mmHg). This
is likely due to
PEGylated trimer Tt H-NOX L144F's superior tissue penetration that enables
oxygen delivery to
areas beyond oxygen gradient diffusion limits. Moreover, while maximum
supplemental
oxygenation of mouse tumors is achieved with exposing animals continuously to
95%-100%
breathing oxygen [increasing risk of hyperoxic and inflammatory damage to the
normal tissues
(Kallet & Matthay, 2013 Respir Care, 58(1):123-141; Thiel et al., 2005 PLoS
Biol, 3(6), e174)1,
single bolus i.v. dose of PEGylated trimer Tt H-NOX L144F can maintain tissue
oxygenation for
more than 7 hours without increasing oxygen levels in normal tissues. A
control Tt H-NOX
protein (wild type variant)¨that is not capable of releasing oxygen at oxygen
concentrations
present in hypoxic tissues¨did not have any effect on tumor oxygenation (Fig.
3C).
[00232] Seven to eight week old Nu/Nu female mice were subcutaneously
implanted with 3 x
106 of H460 human lung cancer cells and monitored until the tumors reached
average size of
-500 mm3 (10-18 days post-implantation of tumor cells). Mice bearing H460
tumors were
anesthetized with isoflurane mixed in 20% of oxygen and the OxyLiteTM probe
(Oxford
Optronix, UK) was implanted into H460 subcutaneous xenograft tumors using a
micromanipulator. The OxyLiteTM consists of the ruthenium chloride dye held in
a polymer
matrix of 230 um in diameter at the tip. After equilibration for -20-30
minutes, p02 was
measured using optical fluorescence sensors attached to a four-channel unit. A
low starting p02
confirmed entry into hypoxic tissue away from neighbouring blood vessels (-0.2
mmHg; except
in Fig. 3D where 5 mmHg). After probe implantation, probe was left for -20-30
mm in order for
p02 measurements to stabilize, and mice were given to respire 100% 02 (Fig.
3B, Fig. 3D) or
were injected with PEGylated H-NOX (L144F in Fig. 3A, wt in Fig. 3C) and
fluorescent
quenching was recorded.
[00233] The superior ability of PEGylated trimer Tt H-NOX L144F to deliver
oxygen to
hypoxic tumor regions relative to the administration of the hyperoxic gas was
further
demonstrated by more efficient radiation tumor cell kill (Fig. 4).
67
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
[00234] Mice bearing H460 subcutaneous xenograft tumors (200-350 mm3) were
treated with
Gy alone or in combination with 650 mg/kg of PEGylated trimer H-NOX (L144F)
injected
i.v. 7 hours prior to irradiation. Tumors were extracted after irradiation and
processed for
clonogenic assay. Cell numbers were counted 10-14 days later in triplicate
samples from each
tumor. Each dot on the graph represents average surviving fraction for one
tumor. Mean values
+/- SEM (n=3 per experiment). Seven to eight week old Nu/Nu female mice were
subcutaneously implanted with 3 x 106 of H460 human lung cancer cells and
monitored until the
tumors reached average size of ¨300 mm3 (10-14 days post-implantation of tumor
cells). Mice
bearing 200-350 mm3 xenograft tumors were irradiated with 10 Gy alone or in
combination with
intravenous delivery of either a bolus vehicle (formulation buffer: 50 mM
succinate, 50 mM
NaC1, 3.4 mM EDTA, and 10 mM reduced glutathione at pH 7) or a formulation
buffer
containing 650 mg/kg of PEGylated H-NOX (L144F). Mice were sacrificed after
irradiation and
tumors were harvested and processed for an ex-vivo clonogenic assay. Briefly,
tumors cells were
minced into fine pieces with a scalpel and digested for ¨30 minutes with an
enzymatic cocktail
containing a mix of collagenase (200 U/ml), hyaluronidase (200 U/ml) and DNAse
(10 ml of
cocktail/g of tumor). Extracted cells were then counted and seeded at
500/125/25 cells per well
for untreated and 2000/500/100 cells per well for irradiated tumor samples in
a 6 well plate in
duplicate. After 10-12 days, cell colonies were fixed with PFA and stained
with crystal violet.
The number of clones (over 50 cells) was counted and the plating efficiency
was calculated in
untreated samples (number of cells counted in well + number of cells plated x
100). Surviving
fraction was calculated in all samples (number of cells counted + plating
efficiency x 100).
[00235] Following PEGylated trimer Tt H-NOX L144F administration, there was
>15-fold
increase in radiation treatment efficacy in all PEGylated trimer Tt H-NOX
L144F-treated tumors
that reduced the surviving fraction of tumor cells from 30% in the 10 Gy
treatment alone group
to <2% in the H-NOX (L144F)-pretreated tumor. In the same experiment,
treatment of mice
bearing tumors with 100% oxygen showed variable increase in radiation
enhancement (-3 fold)
probably resulting from unequal tumor oxygenation between individual tumors
likely due to
uneven vascular density between tumors.
Example 2. H-NOX acts as an immunoactivator enhancing host anti-tumor
responses
[00236] PEGylated trimer Tt H-NOX L144F-induced oxygenation inhibits the HIF-
la pathway
(Fig 2B) and relieves HIF-la-dependent and HIF-la-independent tumor
immunosuppression.
Mice bearing H460 subcutaneous xenograft tumors (200-350 mm3) were either
treated with
vehicle alone or with PEGylated trimer H-NOX (L144F) and harvested 7, 16 or 24
hours after
68
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
injection for qRT-PCR analysis. Mean values +/- SEM. N=5-6 per group, * p<0.05
by t-test.
Treatment with a single dose of H-NOX resulted in significant downregulation
of HIF-1a and its
effectors including direct and indirect modulators of the host's immune
response: PD/PDL-1 and
VEGF signaling, metabolic and growth factor regulators (Fig 5).
[00237] Seven to eight week old Nu/Nu female mice were subcutaneously
implanted with 3 x
106 of H460 human lung cancer cells and monitored until the tumors reached
average size of
¨300 mm3 (10-14 days post-implantation of tumor cells). Mice bearing 200-350
mm3 xenograft
tumors were injected with either a bolus vehicle (formulation buffer: 50 mM
succinate, 50 mM
NaC1, 3.4 mM EDTA, and 10 mM reduced glutathione at pH 7) or a formulation
buffer
containing 650mg/kg of PEGylated trimer H-NOX (L144F). To prepare samples for
qRT-PCR
analysis, mice were sacrificed and tumors excised. Total RNA was extracted
from tumor
samples using the RNeasy kit (QIAGEN) according to the manufacturer
instructions. Reverse
transcription and real-time PCR (RT-PCR) on a StepOnePlusTM Real-Time PCR
System
(Applied Biosystems) were performed as described. 25 pL reaction was prepared
using 2 pL of
cDNA template, 12.5 pL of SYBR Green PCR Master Mix (Applied Biosystems) and
1 pL of
the following sense and antisense primers: VEGF: forward, 5'-
CAATCGAGACCCTGGTGGA
-3 (SEQ ID NO:23); reverse, 5'- GCACACACTCCAGGCCCT-3' (SEQ ID NO:24); Glutl:
forward, 5'- CAACCAGACATGGGTCCAC -3' (SEQ ID NO:25); reverse, 5'-
GTTAACGAAAAGGCCCACAGA-3' (SEQ ID NO:26); PDL1: forward, 5'-
GTTGTGGATCCAGTCACCTCT -3' (SEQ ID NO:27); reverse, 5'-
GATTCTCAGTGTGCTGGTCAC-3'(SEQ ID NO:28); L7: forward, 5'-
CAAGGAGGAAGCTTATCTATGAA-3'(SEQ ID NO:29); reverse, 5'-
ATTTGACGAAGGCGAAGAAGCT-3' (SEQ ID NO:30). Thermocycling conditions were as
follows: initial step was 10 mM at 95 C, then 40 cycles of 15 s denaturation
at 95 C followed by
1 mM annealing and extension at 60 C. Results were analyzed with the StepOne
Software v2.0
using the comparative CT method. Transcripts of gene of interest were
normalized against the
transcripts of the mouse ribosomal protein L7 housekeeping gene, and were
presented as fold
change relative to the L7 transcript content.
[00238] For example, PEGylated trimer Tt H-NOX L144F-mediated downregulation
of the
HIF-la and A2AR adenosinergic signaling may result in activation and
recruitment of effector T
cells to the tumor tissue leading to increased lymphocyte tumor infiltration,
decrease in
metastatic tumor growth and tumor regression. Furthermore, H-NOX-induced
oxygenation of
tumors may reduce immunoevasion of tumor cells by inhibiting multiple hypoxia-
dependent
mechanisms including downregulation of MHC1 and upregulation of PDL-1
expression on
69
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
tumor cell surface, and activation and recruitment of myeloid-derived
suppressor cells (MDSC)
including TAMs that directly suppress immune effector cells as well as promote
angiogenesis
and metastasis (see Fig 1B). H-NOX treatment may inhibit recruitment of
macrophages to TME
by downregulating VEGF, CSF1 and other HIF-1-dependent cytokine signaling
(Chaturvedi et
al., 2014 Proc Natl Acad Sci USA, 111(20):E2120-2129; Lewis & Hughes, 2007
Breast Cancer
Res, 9(3):209) as well as HIF-1- and HIF-2-mediated macrophage activation
(Fang et al., 2009
Blood, 114(4):844-859; Takeda et al., 2010 Genes Dev, 24(5):491-501).
[00239] Finally, in stimulating host's anti-tumor immune response, H-NOX may
act as co-
activator enhancing other targeted cancer immunotherapies such as, but not
limited to, anti-PD1
(programmed cell death protein 1), anti-PDL-1 (programmed cell death protein
ligand 1), anti-
CTLA-4 or therapies targeting other immune checkpoints' regulators, anti-
cancer vaccines,
adoptive immune cell therapies or combinations thereof. For example, H-NOX may
be
administered to cancer patients prior to and in conjunction with dual PD1/CTLA-
4 blockade
therapy or in combination with PDL-1 treatment in patients with PDL1+ tumors.
It may also act
as an adjuvant to other cancer treatments including, but not limited to,
chemotherapy, radiation
therapy or other non-immune targeted or cell-based therapies that may benefit
from active anti-
tumor immune defenses. Indeed, H-NOX may synergize with radiation by
simultaneously
stimulating anti-tumor immune response towards radiation exposed tumor-
specific antigens from
damaged tumor tissue (Demaria et al., 2005 Int J Radiat Oncol Biol Phys,
63(3), 655-666) and
oxygen-dependent tumor cell killing (Brown, 2010 Int J Radiat Biol, 86(11),
907-917). During
radiotherapy, H-NOX may also act as normal tissue radioprotectant by
ameliorating hypoxia
resulting from radiation-induced vascular damage.
Example 3. Measurement of hypoxia and T cells in B16F10 and CT26 subcutaneous
tumors and intracranial GL261-luciferase tumors.
[00240] Generation of Bl6F10 and CT26 subcutaneous tumors and intracranial
GL261-
luciferase tumors. Six to eight week old C57BL/6J female mice were
subcutaneously implanted
with 1 x 106 B 16F10 mouse melanoma cancer cells on the flank (Fig. 7A). Six
to eight week old
BALB/c female mice were subcutanously implanted with 1 x 106 CT26 colon tumor
cells on the
flank (Fig. 7B). Male C57BL/6J weighting 20g were injected with 3 x 105 GL261-
luc cells
intracranially into the right caudate nucleus (+0.5 mm A/P, +2.3 mm M/L and -
3.2 mm D/V)
(Fig. 7C). Intracranial tumors were allowed to grow for 21 days before
sacrifice. Subcutaneous
tumors were measured 3 times a week using calipers and tumor size was
calculated based on the
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
formula: (length x width2) + 0.5. Once the tumors reached an average size of
¨300 mm3 (10-14
days post-implantation of tumor cells), treatment was initiated.
[00241] Treatment. Mice bearing 200-400 mm3 subcutaneous tumors or day 21
intracranial
tumors were injected with the exogenous hypoxia marker pimonidazole ip. (60
mg/kg,
Hypoxyprobe, Burlington Massachusetts) 1-8 hours prior to sacrifice.
[00242] Immunohistochemistry. Rodents were euthanized and tumors resected for
immunohistochemistry (IHC) assay. Tumors were frozen in OCT and sectioned at
12 pM for
IHC processing. Sections were fixed with 4% PFA for 15 minutes at 4 C, then
blocked and
permeabilized with 5% BSA, 5% goat serum, and 0.1% Tween 20 for 1-2 hours at
room
temperature. Sections were then incubated with rabbit anti-pimonidazole
(Hypoxyprobe, 1:100)
(Figs. 7A, 7B, 7C, top panels) and rat anti-CD3, rat anti-CD4 (Biolegend,
1:50) or rat anti-CD8
(Biolegend, 1:50) antibodies overnight at 4 C (Figs. 7A, 7B, 7C, middle
panels), followed by
anti-rabbit or anti-rat secondary antibodies (1:1000, Jackson Immunoresearch
Laboratories,
West Grove, PA, USA) for 2 hours at room temperature. The sections were
mounted in
SlowFade DAPI (Invitrogen). Sections were imaged with an HD AxioImager Zeiss
microscope
equipped with a CCD digital camera. Quantification. In each animal, the number
of CD3+,
CD4+ or CD8+ T cells was counted in pimonidazole-positive and pimonidazole-
negative areas
in 2-4 pictures per section in 5 tumor sections spanning 1-1.5 mm of the tumor
thickness. The
sum of CD4+ and CD8+ cells in each area was divided by the sum of pimonidazole-
postive and
pimonidazole-negative areas to obtain the total number of T cells per mm2 of
tumor tissue (Figs.
7A, 7B, and 7C, bottom panels). Hypoxic regions of tumors (H) showed 2.5 to
over 10-fold less
T cells than normoxic regions (N).
Example 4. H-NOX treatment of hypoxic tumors.
[00243] Generation of Bl6F10 subcutaneous tumors. Six to eight week old
C57BL/6J female
mice were subcutaneously implanted with 1 x 106 of B 16F10 mouse melanoma
cancer cells on
the flank. Tumors were measured 3 times a week using calipers and tumor size
was calculated
based on the formula: (length x width2) + 0.5. Once the tumors reached an
average size of ¨300
mm3 (10-14 days post-implantation of tumor cells), treatment was initiated.
[00244] Treatment. Mice bearing 200-400 mm3 tumors were randomized in each
treatment
group based on tumor size and injected intratumorally with vehicle
(formulation buffer: 50 mM
succinate, 50 mM NaC1, 3.4 mM EDTA, and 10 mM reduced glutathione at pH 7) or
100 pl of
formulation buffer containing 2 mg of PEGylated H-NOX (L144F). One hour prior
to vehicle or
71
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
H-NOX treatment, mice were injected with the exogenous hypoxia marker
pimonidazole ip. (60
mg/kg, Hypoxyprobe, Burlington Massachusetts).
[00245] Immunohistochemistry. 6 hours after H-NOX injection, rodents were
euthanized and
tumors resected for immunohistochemistry (IHC) assay. Tumors were frozen in
OCT and
sectioned at 12 pM for IHC processing. Sections were fixed with 4% PFA for 15
minutes at 4 C,
then blocked and permeabilized with 5% BSA, 5% goat serum, and 0.1% Tween 20
for 1-2
hours at room temperature. Sections were then incubated with rabbit anti-
pimonidazole
(Hypoxyprobe, 1:100) or rabbit anti-carbonic anhydrase IX (CAIX, Novus
Biological 1:1000)
and rat anti-CD4 (Biolegend, 1:50) or rat anti-CD8 (Biolegend, 1:50)
antibodies overnight at
4 C, followed by anti-rabbit or anti-rat secondary antibodies (1:1000, Jackson
Immunoresearch
Laboratories, West Grove, PA, USA) for 2 hours at room temperature. The
sections were
mounted in SlowFade DAPI (Invitrogen). Sections were imaged with an HD
AxioImager Zeiss
microscope equipped with a CCD digital camera (Figs. 8 and 9B).
[00246] Quantification. In each animal, the number of CD4+ and CD8+ T cells
was counted in
pimonidazole-postive, pimonidazole-negative, CAIX-postive and CAIX-negative
areas in 4
pictures per section in 5 tumor sections spanning 1-1.5 mm of the tumor
thickness. The sum of
CD4+ and CD8+ cells in each area was divided by the sum of pimonidazole-
postive,
pimonidazole-negative, CAIX-postive and CAIX-negative areas to obtain the
total number of T
cell per mm2 of tumor tissue. Results shown in Figs. 8 and 9A demonstrate that
OMX treatment
as compared to the vehicle control (formulation buffer) enhances accumulation
of CD4+ and
CD8+ lymphocytes in previously pimondazole-negative (Fig. 8) ro CAIX-negative
(Fig. 9B)
labeled hypoxic regions of the tumors.
Example 5. Measurement of tumor hypoxia and tumor vessels.
[00247] Generation of H460, Bl6F10 and CT26 subcutaneous tumors and
intracranial GL261-
luciferase tumors. Seven to eight week old Nu/Nu female mice were
subcutaneously implanted
with 3 x 106 of H460 human lung cancer cells in the hind limb. Six to eight
week old C57BL/6J
female mice were subcutaneously implanted with 1 x 106 B 16F10 mouse melanoma
cancer cells
on the flank. Six to eight week old BALB/c female mice were subcutanously
implanted with 1 x
106 CT26 colon tumor cells on the flank. Male C57BL/6J weighting 20g were
injected with 3 x
105 GL261-luc cells intracranially into the right caudate nucleus (+0.5 mm
A/P, +2.3 mm M/L
and -3.2 mm D/V). Intracranial tumors were allowed to grow for 21 days before
sacrifice.
Subcutaneous tumors were measured 3 times a week using calipers and tumor size
was
calculated based on the formula: (length x width2) + 0.5. Once the tumors
reached an average
72
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
size of ¨300 mm3 (10-14 days post-implantation of tumor cells), treatment was
initiated.
Treatment. Mice bearing 200-400 mm3 subcutaneous tumors or day 21 intracranial
tumors were
injected with the exogenous hypoxia marker pimonidazole ip. (60 mg/kg,
Hypoxyprobe,
Burlington Massachusetts) 1-8 hours prior to sacrifice.
[00248] Immunohistochemistry and ELISA. Rodents were euthanized and tumors
resected for
immunohistochemistry (IHC) and ELISA assays. For ELISA, Bl6F10, CT26 and H460
tumors
were homogenized in an extraction buffer (Abcam kit # ab117996) supplemented
with anti-
proteases. Protein concentration was quantified in each tumor using a Bradford
assay and
samples were assayed for hypoxia levels using a competitive Pimonidazole
(Hypoxyprobe-1,
Hypoxyprobe, Burlington Massachusetts) ELISA assay. For IHC, GL261 tumors were
frozen in
OCT and sectioned at 12 pM for IHC processing. Sections were fixed with 100%
methanol for
20 minutes at -20 C, then blocked and permeabilized with 5% BSA, 5% goat
serum, and 0.1%
Tween 20 for 1-2 hours at room temperature. Sections were then incubated with
rabbit anti-
pimonidazole (Hypoxyprobe, 1:100) and rat anti-CD31 (BD Bioscience, 1:50)
antibodies
overnight at 4 C, followed by anti-rabbit or anti-rat secondary antibodies
(1:1000, Jackson
Immunoresearch Laboratories, West Grove, PA, USA) for 2 hours at room
temperature. The
sections were mounted in SlowFade DAPI (Invitrogen). Sections were imaged with
an HD
AxioImager Zeiss microscope equipped with a CCD digital camera (Fig. 10).
[00249] Quantification. For the pimonidazole ELISA, quantification of the IC50
values ("Kd")
were performed with a 5-parameter fit of the standard curve and values were
normalized
according to the protein concentration in each sample. For GL261 IHC, in each
animal, the
percent of pimonidazole+ area within the tumor tissue was determined using
ImageJ (1-2
pictures per section in 5 tumor sections spanning 1 mm of the tumor thickness)
(Fig. 10). These
data show that while there is a range in the levels of hypoxia between
individual animals and
between tumor types, its presence is significant in a majority of the tumors
of the examined
sizes.
Example 6. Measurement of H-NOX accumulation in tumors.
[00250] Generation of Bl6F10 and CT26 subcutaneous tumors and intracranial
GL261-
luciferase tumors. Six to eight week old C57BL/6J female mice were
subcutaneously implanted
with 1 x 106 B 16F10 mouse melanoma cancer cells on the flank. Six to eight
week old BALB/c
female mice were subcutanously implanted with 1 x 106 CT26 colon tumor cells
on the flank.
Male C57BL/6J weighting 20g were injected with 3 x 105 GL261-luc cells
intracranially into the
right caudate nucleus (+0.5 mm A/P, +2.3 mm M/L and -3.2 mm D/V). Intracranial
tumors were
73
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
allowed to grow for 21 days before sacrifice. Subcutaneous tumors were
measured 3 times a
week using calipers and tumor size was calculated based on the formula:
(length x width2) 0.5.
Once the tumors reached an average size of ¨300 mm3 (10-14 days post-
implantation of tumor
cells), treatment was initiated.
[00251] Treatment. Mice bearing 200-400 mm3 subcutaneous tumors were
randomized in each
treatment group based on tumor size and injected intravenously (650 mg/kg),
subcutaneously
(650 mg/kg), or intratumorally (2 mg, 100 pl) with vehicle (formulation
buffer: 50 mM
succinate, 50 mM NaC1, 3.4 mM EDTA, and 10 mM reduced glutathione at pH 7) or
formulation buffer containing PEGylated H-NOX (L144F). Mice bearing day 21
intracranial
tumors were randomized in each treatment group based on bioluminescent signal
measured with
the Xenogen IVIS spectrum and injected intravenously with formulation buffer
alone or
containing 750 mg/kg of H-NOX (L144F).
[00252] Measurement of PEGylated H-NOX (L144F) accumulation in subcutaneous
tumor
tissue. Tumors were harvested 6h (B16F10) or 8h (CT26) after H-NOX or vehicle
injection.
Tumors were homogenized in an extraction buffer (Abcam kit # ab117996)
supplemented with
anti-proteases and protein concentration was quantified in each tumor using a
Bradford assay.
PEGylated H-NOX (L144F) concentration was quantified by a sandwich ELISA ELISA
(detection sensitivity at 1 ng/ml) for H-NOX and normalized to tumor weight to
express H-NOX
amount in pg/g tumor tissue. Quantification of H-NOX levels in tumor lysates
was determined
by 5-parameter fit of the standard curve.
[00253] Biodistribution of H-NOX (L144F) in GL261 by IHC. 2h after H-NOX
injection,
rodents were euthanized and tumors resected for immunohistochemistry (IHC)
assay. Tumors
were frozen in OCT and sectioned at 12 pM for IHC processing. Sections were
fixed with 100%
methanol for 20 minutes at -20 C, then blocked and permeabilized with 5% BSA,
5% goat
serum, and 0.1% Tween 20 for 1-2 hours at room temperature. Sections were then
incubated
with rabbit anti-H-NOX (1:500, custom-made rabbit polyclonal produced by
AnaSpec Inc,
Fremont, CA) and rat anti-CD31 (BD Bioscience, 1:50) antibodies overnight at 4
C, followed by
anti-rabbit or anti-rat secondary antibodies (1:1000, Jackson Immunoresearch
Laboratories,
West Grove, PA, USA) for 2 hours at room temperature. The sections were
mounted in
SlowFade DAPI (Invitrogen). Sections were imaged with an HD AxioImager Zeiss
microscope
equipped with a CCD digital camera. In each animal, the percent of H-NOX-
positive area within
the tumor tissue was determined using ImageJ (1-2 pictures per section in 5
tumor sections
spanning 1 mm of the tumor thickness).
74
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
Example 7. Measurement of hypoxia and T cells in canine oral melanoma tumors.
[00254] Canine oral melanoma. Pet dogs with oral melanoma tumors were
recruited for the
study with owners' consent and injected intravenously (slow infusion) with
PEGylated H-NOX
(L144F) 4h prior to surgery. Tissue extracted from surgery was analyzed by
IHC.
[00255] Immunohistochemistry. 4 hours after H-NOX injection, tumors were
resected, frozen in
OCT and sectioned at 12 pM for IHC processing. Sections were fixed with 4% PFA
for 15
minutes at 4 C, then blocked and permeabilized with 5% BSA, 5% goat serum, and
0.1% Tween
20 for 1-2 hours at room temperature. Sections were then incubated with rabbit
anti-carbonic
anhydrase IX (CAIX, Novus Biological 1:1000) or rabbit anti-H-NOX (1:500,
custom-made
rabbit polyclonal produced by AnaSpec Inc, Fremont, CA) and rat anti-CD4 (Abd
Serotech,
1:50) or rat anti-CD8 (Abd Serotech, 1:50) antibodies overnight at 4 C,
followed by anti-rabbit
or anti-rat secondary antibodies (1:1000, Jackson Immunoresearch Laboratories,
West Grove,
PA, USA) for 2 hours at room temperature. The sections were mounted in
SlowFade DAPI
(Invitrogen). Sections were imaged with an HD AxioImager Zeiss microscope
equipped with a
CCD digital camera (Fig. 11). Images revealed presence of high lymphocyte
numbers in tumor
regions that expressed hypoxia marker CAIX indicative of hypoxic state prior
to OMX
administration suggesting that OMX treatment relieved immunosuppressive
microenvironment
and allowed lymphocyte infiltration.
Example 8. Correlation of tumor volume, tumor hypoxia and reduced T cell
infiltration.
[00256] 4T1-Luc Tumor Model. 8 week-old female BALB/c mice were purchased from
Charles
River Labs. Luciferase-expressing 4T1 mouse breast tumor cells (4T1-Fluc-Neo;
Imanis Life
Sciences) were grown in RPMI medium supplemented with 10% fetal bovine serum,
lx
penicilin/streptomycin, and 0.7 mg/ml G-418 (InvivoGen). Cells were
trypsinized and
resuspended in a 50:50 mixture of medium:Matrigel (Corning), and 2 x 105 cells
in 100 1
volume was injected subcutaneously into mice. At day 10 and day 14 post-
implantation, tumors
were measured and volumes calculated (length x width x height x 0.523), mice
were injected
simultaneously with 120 mg/kg pimonidazole i.p. (PIMO, Hypoxyprobe) and 30
mg/kg EF5 i.v.
(Hypoxia Imaging Center), sacrificed 90 min post-PIMO/EF5 injection, and
tumors were
harvested. Harvested tumors were frozen in OCT for immunostaining, as well as
dissociated
into single cells using a gentleMACS dissociator followed by incubation with
0.75 mg/ml
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
collagenase/dispase (Roche) at 37 C with shaking for 45 mm. Dissociated cells
were passed
through 70 um filters.
[00257] Flow Cytometry. Unfixed dissociated cells were stained with antibodies
for T cells
(hamster anti-mouse CD3-AlexaFluor 488, clone 145-2C11, eBioscience; rat anti-
mouse CD4-
APC, clone RM4-5, BD Biosciences; rat anti-mouse CD8-PE, clone 53-6.7, BD
Biosciences),
and flow cytometry was performed using a FACSCalibur. Spleens were used as T
cell positive
controls for gating purposes. Also after filtration of dissociated cells
through 70 um filters, cells
were stained with viability dye 570 (BD Biosciences), fixed with formalin and
methanol, stained
with antibodies for hypoxia markers (rabbit anti-pimonidazole, Hypoxyprobe,
followed by
donkey anti-rabbit AlexaFluor 647; mouse anti-EF5 conjugated to AlexaFluor
488, Hypoxia
Imaging Center), and analyzed on a FACSCalibur. Flow cytometry data were
analyzed using
FlowJo.
[00258] Immunofluorescence Staining. Frozen sections were cut at 10 um, fixed
with 4% PFA,
stained with primary antibodies (rat anti-mouse CD4, rat anti-mouse CD8,
rabbit anti-PIMO),
followed by secondary antibodies (donkey anti-rat AlexaFluor 594, donkey anti-
PIMO
AlexaFluor 488), and counterstained with DAPI.
[00259] As shown in Figs. 13A-13K, larger tumor size correlates with enhanced
hypoxia and
reduced lymphocyte infiltration in subcutaneous 4T1-Luc syngeneic tumors. Fig.
12A shows
tumor volumes on day 10 and day 14 post-implantation. Fig. 12B shows the
fraction of
lymphocytes within the viable cell population and Fig. 12C shows the absolute
lymphocyte cell
numbers within the viable population. Negative correlations between tumor
volume and
percentage lymphocytes (Fig. 12D) and between percentage hypoxia and
percentage
lymphocytes (Fig. 12F) were demonstrated whereas the relationship between
tumor volume and
percentage hypoxia showed a positive correlation (Fig. 12E). Negative
correlations were also
seen between tumor volume and percentage CD3-positive T cells (Fig. 12G),
between tumor
volume and percentage CD4-positive T cells (Fig. 12H), between tumor volume
and percentage
CD8-positive T cells (Fig. 121), between tumor volume and percentage CD3-CD4-
double-
positive T cells (Fig. 12J), and between tumor volume and percentage CD3-CD8-
double-positive
T cells (Fig. 12K).
[00260] Figs. 13A-13F show that hypoxic tumor regions are immunosuppressive
and exhibit
reduced T cell infiltration in subcutaneous 4T1-Luc syngeneic mouse tumors.
76
CA 02979974 2017-09-15
WO 2016/149562 PCT/US2016/022981
SEQUENCES
Tt. WT
ATGAAGGGGACAATCGTCGGGACATGGATAAAGACCCTGAGGGACCTTTACGGGAATGATGTGGTTGATGAATCTTT
AAAAAGTGTGGGTTGGGAACCAGATAGGGTAATTACACCTCTGGAGGATATTGATGACGATGAGGTTAGGAGAATTT
TTGCTAAGGTGAGTGAAAAAACTGGTAAAAATGTCAACGAAATATGGAGAGAGGTAGGAAGGCAGAACATAAAAACT
TTCAGCGAATGGTTTCCCTCCTATTTTGCAGGGAGAAGGCTAGTGAATTTTTTAATGATGATGGATGAGGTACACCT
ACAGCTTACCAAGATGATAAAAGGAGCCACTCCTCCAAGGCTTATTGCAAAGCCTGTTGCAAAAGATGCCATTGAAA
TGGAGTACGTTTCTAAAAGAAAGATGTACGATTACTTTTTAGGGCTTATAGAGGGTAGTTCTAAATTTTTCAAGGAA
GAAATTTCAGTGGAAGAGGTCGAAAGAGGCGAAAAAGATGGCTTTTCAAGGCTAAAAGTCAGGATAAAATTTAAAAA
CCCCGTTTTTGAGTGA
(SEQ ID NO:1)
MKGTIVGTWIKTLRDLYGNDVVDESLKSVGWEPDRVITPLEDIDDDEVRRIFAKVSEKTGKNVNEIWREVGRQNIKT
FSEWFPSYFAGRRLVNFLMMMDEVHLQLTKMIKGATPPRLIAKPVAKDAIEMEYVSKRKMYDYFLGLIEGSSKFFKE
EISVEEVERGEKDGFSRLKVRIKFKNPVFE
(SEQ ID NO:2)
foldon domain
GGTTATATTCCTGAAGCTCCAAGAGATGGGCAAGCTTACGTTCGTAAAGATGGCGAATGGGTATTACTTTCTAC
CTTTTTA (SEQ ID NO:3)
GYIPEAPRDGQAYVRKDGEWVLLSTFL (SEQ ID NO:4)
L2 WT
ATGATGTCTATGAAAGGAATCATATTCAACGAATTTCTCAATTTTGTAGAAAAAAGTGAATCCTACACCCTGGT
AGATCAAATTATTATGGATAGTCATTTGAAGTCCCATGGTGCCTACACGTCTATCGGTACATACTCTCCCAAAG
AATTATTTCAATTGGTTAAAGCGCTTGCTATGAAAAATGGCAAACCAACATCAGTGATTTTACAAGAATATGGT
GAGTATTTGTTTGAGGTTTTTGCAAAAAAATATCCTCAATTTTTCAGGGAAAAAAAGTCGGTGTTTCAATTTTT
GGAAGCGCTTGAAACACATATTCATTTCGAAGTGAAAAAATTGTATGACTATACTGAACTACCCCATTTTGAAT
GCCAATATCACAGTCAAAATCAAATGGAAATGATTTACACTTCTTCGCGTCCTTTGGCCGATTTTGCGGAAGGT
TTAATAAAAGGTTGTATTAAATATCATAAAGAAAACATGACTATTGTTCGTGAAAATCTGCCTGCAAAAACAGG
CTTTAAGGTAAGATTTGTATTAACAAAAGGCGATCCTGATGAGTGA(SEQ ID NO:9)
MMSMKGIIFNEFLNFVEKSESYTLVDQIIMDSHLKSHGAYTSIGTYSPKELFQLVKALAMKNGKPTSVILQEYG
EYLFEVFAKKYPQFFREKKSVFQFLEALETHIHFEVKKLYDYTELPHFECQYHSQNQMEMIYTSSRPLADFAEG
LIKGCIKYHKENMTIVRENLPAKTGFKVRFVLTKGDPDE(SEQ ID NO:10)
Li WT
ATGAAAGGTATCGTTTTTACCTCCTTAAATGACATGATTATAGAACAATTTGGCATAGAAACCTGGGACCAACT
CGTATCCTCACTAGACCTTCCAAGTGGTGGAAGTTATACAGCAGGCGGCACTTACTCGGATACAGAATTTCAGC
AATTGATTAAGGCCATTGCGAAGAGGACCAATCAGCACGCTTCTGTTTTTTTAGAGGCCTTTGGTGAATACATG
TTTCCTATCTTATCGAGTAAGTGCGCAATTTTTTTAAAAAAGGACATGACATTAAAAGAATTTTTAAAAAGCAT
TGATGGAACAATTCATGTGGAAGTAGAAAAGTTATACCCAGATGAAACATTACCTACCATTAGCTATGAAGAGC
CTGCTGCAAACCAATTGGTTATGGTGTATCGATCGCATAGAAGACTCTGTCATTTTGCAATGGGGCTCATCCAG
GGAGCAGCGCAACATTTTAAAAAGAAAATTACCATTAAGCAGACTCACTGCATGTTAAAAAAAGATGATCATTG
TCGTTTGGAGATTACCTTTGAGTGA
(SEQ ID NO:11)
MKGIVFTSLNDMIIEQFGIETWDQLVSSLDLPSGGSYTAGGTYSDTEFQQLIKAIAKRTNQHASVFLEAFGEYM
FPILSSKCAIFLKKDMTLKEFLKSIDGTIHVEVEKLYPDETLPTISYEEPAANQLVMVERSHRRLCHFAMGLIQ
GAAQHFKKKITIKQTHCMLKKDDHCRLEITFE
(SEQ ID NO:12)
Homo sapiens WT (1-385)
ATGTACGGATTTGTGAATCACGCCCTGGAGTTGCTGGTGATCCGCAATTACGGCCCCGAGGTGTGGGAAGACAT
CAAAAAAGAGGCACAGTTAGATGAAGAAGGACAGTTTCTTGTCAGAATAATATATGATGACTCCAAAACTTATG
ATTTGGTTGCTGCTGCAAGCAAAGTCCTCAATCTCAATGCTGGAGAAATCCTCCAAATGTTTGGGAAGATGTTT
TTCGTCTTTTGCCAAGAATCTGGTTATGATACAATCTTGCGTGTCCTGGGCTCTAATGTCAGAGAATTTCTACA
GAACCTTGATGCTCTGCACGACCACCTTGCTACCATCTACCCAGGAATGCGTGCACCTTCCTTTAGGTGCACTG
77
CA 02979974 2017-09-15
WO 2016/149562
PCT/US2016/022981
ATGCAGAAAAGGGCAAAGGACTCATTTTGCACTACTACTCAGAGAGAGAAGGACTTCAGGATATTGTCATTGGA
ATCATCAAAACAGTGGCACAACAAATCCATGGCACTGAAATAGACATGAAGGTTATTCAGCAAAGAAATGAAGA
ATGTGATCATACTCAATTTTTAATTGAAGAAAAAGAGTCAAAAGAAGAGGATTTTTATGAAGATCTTGACAGAT
TTGAAGAAAATGGTACCCAGGAATCACGCATCAGCCCATATACATTCTGCAAAGCTTTTCCTTTTCATATAATA
TTTGACCGGGACCTAGTGGTCACTCAGTGTGGCAATGCTATATACAGAGTTCTCCCCCAGCTCCAGCCTGGGAA
TTGCAGCCTTCTGTCTGTCTTCTCGCTGGTTCGTCCTCATATTGATATTAGTTTCCATGGGATCCTTTCTCACA
TCAATACTGTTTTTGTATTGAGAAGCAAGGAAGGATTGTTGGATGTGGAGAAATTAGAATGTGAGGATGAACTG
ACTGGGACTGAGATCAGCTGCTTACGTCTCAAGGGTCAAATGATCTACTTACCTGAAGCAGATAGCATACTTTT
TCTATGTTCACCAAGTGTCATGAACCTGGACGATTTGACAAGGAGAGGGCTGTATCTAAGTGACATCCCTCTGC
ATGATGCCACGCGCGATCTTGTTCTTTTGGGAGAACAATTTAGAGAGGAATACAAACTCACCCAAGAACTGGAA
ATCCTCACTGACAGGCTACAGCTCACGTTAAGAGCCCTGGAAGATTGA
(SEQ ID NO:13)
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRITYDDSKTYDLVAAASKVLNLNAGEILQMFGKMF
FVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIG
IIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHII
FDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDEL
TGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELE
ILTDRLQLTLRALED
(SEQ ID NO:14)
Homo sapiens 112 (1-217)
ATGTATGGATTCATCAACACCTGCCTGCAGTCTCTTGTGACAGAGAAATTTGGTGAGGAGACATGGGAGAAGCT
GAAGGCTCCTGCAGAAGTGCAAGATGTCTTCATGACCTACACCGTGTATGATGACATCATCACCATTAAGCTCA
TCCAAGAAGCCTGCAAGGTTCTGGATGTGTCCATGGAAGCCATTCTGAAGCTCTTTGGCGAATACTTCTTTAAG
TTCTGTAAGATGTCTGGCTATGACAGGATGCTGCGGACACTTGGAGGAAATCTCACCGAGTTTATTGAAAACCT
AGATGCACTCCACAGTTACCTGGCACTGTCCTATCAGGAAATGAACGCACCATCCTTTCGAGTGGAGGAAGGAG
CTGACGGGGCGATGCTTCTCCACTACTACTCAGACAGACATGGTCTGTGTCACATTGTACCAGGTATCATTGAA
GCTGTGGCCAAGGACTTCTTTGACACTGATGTGGCCATGAGTATCCTGGATATGAACGAAGAGGTGGAAAGGAC
AGGGAAGAAAGAACATGTTGTGTTTCTGGTCGTGCAGAAGGCTCACAGACAGATAAGAGGAGCAAAGGCAAGCC
GGCCACAAGGCAGTGAGGACAGCCAGGCAGACCAGGAGGCTCTCCAGGGAACACTCCTT
(SEQ ID NO:15)
MYGFINTCLQSLVTEKFGEETWEKLKAPAEVQDVFMTYTVYDDIITIKLIQEACKVLDVSMEAILKLFGEYFFK
FCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEEGADGAMLLHYYSDRHGLCHIVPGIIE
AVAKDFFDTDVAMSILDMNEEVERTGKKEHVVFLVVQKAHRQIRGAKASRPQGSEDSQADQEALQGTLL
(SEQ ID NO:16)
Ratios norvezieus 81(1-385)
ATGTACGGTTTTGTGAACCATGCCCTGGAGCTGCTGGTGATCCGCAATTACGGTCCCGAGGTGTGGGAAGACAT
CAAAAAAGAGGCGCAGCTGGATGAAGAAGGCCAGTTTCTTGTGAGAATAATCTACGATGATTCCAAAACCTATG
ACTTGGTGGCTGCTGCGAGCAAAGTCCTCAACCTCAATGCTGGTGAAATCCTGCAGATGTTTGGGAAGATGTTT
TTCGTCTTCTGTCAAGAGTCTGGCTATGATACCATCTTGCGTGTCCTGGGATCTAATGTCAGGGAGTTTTTGCA
GAACCTCGACGCCCTGCACGACCACCTCGCCACCATCTACCCAGGGATGCGCGCACCTTCCTTCCGGTGCACCG
ATGCAGAAAAAGGCAAAGGGCTCATTCTGCACTACTACTCGGAAAGAGAGGGGCTTCAGGACATTGTGATCGGG
ATTATCAAGACTGTAGCTCAACAGATCCATGGCACTGAGATAGACATGAAGGTTATTCAGCAAAGAAGTGAAGA
ATGTGATCATACCCAATTTTTAATTGAAGAAAAAGAATCAAAAGAAGAGGATTTTTATGAAGATCTGGACAGGT
TTGAAGAGAACGGTACCCAGGACTCCCGTATCAGCCCGTACACCTTCTGCAAAGCGTTTCCTTTTCACATCATA
TTTGACCGGGACCTAGTAGTCACGCAGTGTGGAAATGCTATCTACAGAGTGCTCCCCCAGCTCCAGCCTGGGAA
GTGCAGCCTTCTGTCTGTCTTCTCTCTGGTCCGCCCTCATATTGACATCAGTTTCCACGGGATTCTTTCACACA
TCAATACCGTCTTTGTACTGAGAAGCAAGGAAGGGTTGCTGGATGTTGAGAAACTTGAATGTGAGGATGAACTG
ACTGGGGCAGAGATTAGCTGCCTCCGTCTCAAAGGCCAAATGATCTATTTACCGGAAGCAGATAGCATCCTCTT
CCTCTGTTCACCAAGTGTGATGAACTTGGATGACCTAACAAGAAGAGGCCTGTACCTGAGTGACATCCCTCTCC
ATGATGCTACACGAGACCTGGTCCTTTTGGGAGAACAGTTCCGGGAGGAGTACAAACTGACACAAGAGCTGGAA
ATCCTCACAGACAGGCTGCAGCTCACACTGAGGGCTTTGGAGGATTGA(SEQ ID NO:17)
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRITYDDSKTYDLVAAASKVLNLNAGEILQMFGKMF
FVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIG
IIKTVAQQIHGTEIDMKVIQQRSEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQDSRISPYTFCKAFPFHII
FDRDLVVTQCGNAIYRVLPQLQPGKCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDEL
TGAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELE
78
CA 02979974 2017-09-15
WO 2016/149562
PCT/US2016/022981
ILTDRLQLTLRALED (SEQ ID NO:18)
Rattus norvegicus 01(1-385)
ATGTACGGTTTTGTGAACCATGCCCTGGAGCTGCTGGTGATCCGCAATTACGGTCCCGAGGTGTGGGAAGACAT
CAAAAAAGAGGCGCAGCTGGATGAAGAAGGCCAGTTTCTTGTGAGAATAATCTACGATGATTCCAAAACCTATG
ACTTGGTGGCTGCTGCGAGCAAAGTCCTCAACCTCAATGCTGGTGAAATCCTGCAGATGTTTGGGAAGATGTTT
TTCGTCTTCTGTCAAGAGTCTGGCTATGATACCATCTTGCGTGTCCTGGGATCTAATGTCAGGGAGTTTTTGCA
GAACCTCGACGCCCTGCACGACCACCTCGCCACCATCTACCCAGGGATGCGCGCACCTTCCTTCCGGTGCACCG
ATGCAGAAAAAGGCAAAGGGCTCATTCTGCACTACTACTCGGAAAGAGAGGGGCTTCAGGACATTGTGATCGGG
ATTATCAAGACTGTAGCTCAACAGATCCATGGCACTGAGATAGACATGAAGGTTATTCAGCAAAGAAGTGAAGA
ATGTGATCATACCCAATTTTTAATTGAAGAAAAAGAATCAAAAGAAGAGGATTTTTATGAAGATCTGGACAGGT
TTGAAGAGAACGGTACCCAGGACTCCCGTATCAGCCCGTACACCTTCTGCAAAGCGTTTCCTTTTCACATCATA
TTTGACCGGGACCTAGTAGTCACGCAGTGTGGAAATGCTATCTACAGAGTGCTCCCCCAGCTCCAGCCTGGGAA
GTGCAGCCTTCTGTCTGTCTTCTCTCTGGTCCGCCCTCATATTGACATCAGTTTCCACGGGATTCTTTCACACA
TCAATACCGTCTTTGTACTGAGAAGCAAGGAAGGGTTGCTGGATGTTGAGAAACTTGAATGTGAGGATGAACTG
ACTGGGGCAGAGATTAGCTGCCTCCGTCTCAAAGGCCAAATGATCTATTTACCGGAAGCAGATAGCATCCTCTT
CCTCTGTTCACCAAGTGTGATGAACTTGGATGACCTAACAAGAAGAGGCCTGTACCTGAGTGACATCCCTCTCC
ATGATGCTACACGAGACCTGGTCCTTTTGGGAGAACAGTTCCGGGAGGAGTACAAACTGACACAAGAGCTGGAA
ATCCTCACAGACAGGCTGCAGCTCACACTGAGGGCTTTGGAGGATTGA (SEQ ID NO :19)
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRITYDDSKTYDLVAAASKVLNLNAGEILQMFGKMF
FVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIG
IIKTVAQQIHGTEIDMKVIQQRSEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQDSRISPYTFCKAFPFHII
FDRDLVVTQCGNAIYRVLPQLQPGKCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDEL
TGAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELE
ILTDRLQLTLRALED (SEQ ID NO:20)
Rattus norvegicus 02
ATGTATGGATTCATCAACACCTGCCTGCAGTCTCTTGTGACAGAGAAATTTGGTGAGGAGACATGGGAGAAGCT
GAAGGCTCCTGCAGAAGTGCAAGATGTCTTCATGACCTACACCGTGTATGATGACATCATCACCATTAAGCTCA
TCCAAGAAGCCTGCAAGGTTCTGGATGTGTCCATGGAAGCCATTCTGAAGCTCTTTGGCGAATACTTCTTTAAG
TTCTGTAAGATGTCTGGCTATGACAGGATGCTGCGGACACTTGGAGGAAATCTCACCGAGTTTATTGAAAACCT
AGATGCACTCCACAGTTACCTGGCACTGTCCTATCAGGAAATGAACGCACCATCCTTTCGAGTGGAGGAAGGAG
CTGACGGGGCGATGCTTCTCCACTACTACTCAGACAGACATGGTCTGTGTCACATTGTACCAGGTATCATTGAA
GCTGTGGCCAAGGACTTCTTTGACACTGATGTGGCCATGAGTATCCTGGATATGAACGAAGAGGTGGAAAGGAC
AGGGAAGAAAGAACATGTTGTGTTTCTGGTCGTGCAGAAGGCTCACAGACAGATAAGAGGAGCAAAGGCAAGCC
GGCCACAAGGCAGTGAGGACAGCCAGGCAGACCAGGAGGCTCTCCAGGGAACACTCCTTCGGATGAAGGAGAGA
TATTTAAACATCCCTGTTTGCCCTGGGGAGAAATCTCACTCAACTGCTGTGAGGGCATCGGTCCTTTTTGGAAA
AGGGCCCCTCAGGGACACCTTCCAGCCCGTCTATCCTGAGAGACTATGGGTCGAAGAGGAGGTGTTCTGTGATG
CTTTTCCTTTCCACATTGTCTTTGATGAAGCACTAAGGGTCAAGCAAGCTGGAGTGAATATTCAGAAGTATGTC
CCTGGAATCTTAACCCAGAAGTTTGCACTAGATGAGTATTTTTCCATCATCCACCCTCAAGTTACTTTCAACAT
CTCCAGCATCTGCAAGTTCATTAACAGTCAGTTTGTCTTGAAGACAAGAAAAGAAATGATGCCCAAAGCAAGGA
AGAGCCAGCCGATGCTCAAACTCCGGGGTCAGATGATCTGGATGGAGTCTCTGAGGTGCATGATCTTCATGTGT
TCCCCAAACGTCCGCAGCCTGCAAGAGCTGGAAGAGAGCAAGATGCATCTTTCTGATATCGCTCCGCACGACAC
GACCAGGGATCTCATCCTCCTCAACCAGCAGAGGCTGGCAGAGATGGAGCTGTCCTGCCAACTGGAAAAGAAGA
AGGAGGAGTTGCGTGTCCTTTCCAATCACCTGGCCATCGAGAAGAAGAAGACAGAGACCTTGCTGTATGCCATG
CTGCCTGAACATGTGGCCAACCAACTCAAGGAGGGCAGAAAGGTGGCTGCAGGAGAATTTGAAACATGTACAAT
CCTTTTCAGCGATGTTGTGACATTTACCAACATCTGTGCAGCCTGTGAACCTATCCAAATCGTGAACATGCTGA
ATTCAATGTACTCCAAGTTTGACAGGTTAACCAGTGTCCATGATGTCTACAAAGTAGAAACAATAGGGGATGCT
TACATGGTGGTGGGTGGAGTACCAGTACCCGTTGAAAGCCATGCTCAAAGAGTCGCCAATTTTGCTCTGGGGAT
GAGAATTTCTGCAAAAGAAGTGATGAATCCTGTCACTGGGGAACCTATCCAGATCAGAGTGGGAATCCACACTG
GACCAGTCTTAGCAGGTGTTGTGGGAGACAAGATGCCTCGGTACTGCTTGTTTGGTGACACTGTAAACACAGCC
TCTAGGATGGAAAGTCACGGGCTTCCCAGCAAAGTGCATCTGAGCCCCACAGCCCACAGAGCCCTGAAAAACAA
AGGGTTTGAAATTGTCAGGAGAGGCGAGATCGAAGTGAAGGGGAAAGGAAAGATGACCACATACTTTCTGATCC
AGAACCTGAATGCCACCGAGGATGAGATAATGGGGCGACCTTCAGCCCCCGCTGATGGGAAGGAAGTATGTACT
CCCGGAAACCAAGTCAGGAAGTCCCCTGCTGTCCCGAGGAACACAGACCATCAGCAACAAGTCTACAAAGGAGA
CCCAGCAGACGCTTCTAATGAAGTCACACTTGCTGGGAGCCCAGTGGCAGGGCGAAACTCCACAGATGCAGTCA
ATAACCAGCCATCACCAGATGAGACCAAGACAAGTGTCGTTGCTAGTGGCCCTGTGCTGTCTGCTTTCTGTGTT
GTGCTGTGA (SEQ ID NO:21)
MYGFINTCLQSLVTEKFGEETWEKLKAPAEVQDVFMTYTVYDDIITIKLIQEACKVLDVSMEAILKLFGEYFFK
FCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEEGADGAMLLHYYSDRHGLCHIVPGIIE
79
CA 02979974 2017-09-15
WO 2016/149562
PCT/US2016/022981
AVAKDFFDTDVAMSILDMNEEVERTGKKEHVVFLVVQKAHRQIRGAKASRPQGSEDSQADQEALQGTLLRMKER
YLNIPVCPGEKSHSTAVRASVLFGKGPLRDTFQPVYPERLWVEEEVFCDAFPFHIVFDEALRVKQAGVNIQKYV
PGILTQKFALDEYFSIIHPQVTFNISSICKFINSQFVLKTRKEMMPKARKSQPMLKLRGQMIWMESLRCMIFMC
SPNVRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEKKKTETLLYAM
LPEHVANQLKEGRKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTSVHDVYKVETIGDA
YMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVTGEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTA
SRMESHGLPSKVHLSPTAHRALKNKGFEIVRRGEIEVKGKGKMTTYFLIQNLNATEDEIMGRPSAPADGKEVCT
PGNQVRKSPAVPRNTDHQQQVYKGDPADASNEVTLAGSPVAGRNSTDAVNNQPSPDETKTSVVASGPVLSAFCV
VL(SEQ ID NO:22)
