CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
Title: Binding molecules that modulate a biological activity expressed
by a
cell.
The invention relates to the field of binding molecules. In particular it
relates to the field of therapeutic binding molecules for the treatment of
diseases
involving aberrant cells. More in particular it relates to binding molecules
that
bind an extracellular part of two or more different membrane associated
proteins
and thereby modulates a biological activity expressed by a cell.
Cancer is still a major cause of morbidity and death in the world, in spite of
the many advances that have been made in the treatment of the disease and the
increased knowledge of the molecular events that lead to cancer. It is the
second
leading cause of death worldwide. According to the World Health Organization,
cancer was responsible for 8.8 million deaths in 2015. Globally, nearly 1 in 6
deaths
is due to cancer. Colorectal cancer (CRC), for instance, is the third most
common
cancer worldwide. In 2008, 1.23 million people were diagnosed with the
disease. It
is the second most common cancer in Europe, with around 447,000 new cases
diagnosed in 2012 (13% of the total). Colorectal cancer is the fourth most
common
cause of cancer death, estimated to be responsible for 608,000 (EU 148,000)
deaths
per annum. While some new treatments have been advanced in CRC many have
failed clinical testing; metastatic CRC is still largely incurable.
Traditionally, most cancer drug discovery has focused on agents that block
essential cell functions and kill dividing cells. However, in cases of
advanced
cancer, no matter how aggressively applied, even to the point where patients
suffer
life-threatening side-effects from the treatment, chemotherapy rarely results
in a
complete cure. In most cases, the tumors in the patients stop growing or
temporarily shrink (referred to as remission) only to start proliferating
again, some
times more rapidly (referred to as relapse), and become increasingly more
difficult
to treat. More recently the focus of cancer drug development has moved away
from
broadly eytotoxic chemotherapy to targeted cytostatic therapies with less
toxicity.
Treatment of advanced cancer has been validated clinically in leukemia and
some
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
2
other cancers. However, in a majority of carcinomas, targeted approaches are
still
proving not effective enough to completely abolish cancer in the majority of
the
patients. Melanoma is another example of a cancer that occurs very frequently.
When detection is not early enough the cancer is likely to metastasize at
which
stage it is very hard to treat. Immune-intervention treatments have been shown
to
be effective to at least some of the patients with metastasized melanoma. Non-
small cell lung cancer is a cancer type that is rarely discovered at an early
enough
stage for surgery. Also these types of cancers have been successfully
treatment
with immune-intervention treatments.
Targeting of cancers has been achieved using a variety of different methods
including for instance small molecules directed towards signaling proteins on
which the cancer depends for survival and/or growth; vaccines with tumor
specific
proteins; cell therapies with immune cells that actively kill tumor cells and
antibodies that target cytotoxic molecules to the tumor; interfere with
signaling
and/or that (re)direct the immune system of the host to the tumor cells.
Monoclonal
antibodies blocking CTLA-4 or PD-1 axis have been shown to induce durable
clinical responses in a subset of melanoma, NSCLC, renal cell carcinoma and
urothelial carcinoma patients.
The present invention provides novel means and methods for (re)directing
immune system components. The invention also relates to means and methods for
modulating a biological activity expressed by cells.
SUMMARY OF THE INVENTION
The invention provides a method of stimulating activity of a member of the
TNF receptor superfamily on a cell comprising providing a first and a second
cell of
which the first cell has said member on the cell membrane and said second cell
has
a second membrane protein on the cell membrane, the method comprising
contacting said cells with a binding molecule that comprises two antigen
binding
sites, wherein a first antigen binding site can bind an extracellular part of
said
member (first membrane protein) and a second antigen binding site can bind an
extracellular part of said second membrane protein, thereby stimulating
activity of
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
3
said member on said first cell. In some embodiments, said method is an in
vitro
method. In some embodiments said member of the TNF receptor superfamily is
CD137 or 0X40, preferably CD137. In some embodiments said second membrane
protein is not a member of the TNF receptor superfamily. In some embodiments
said second membrane protein is a member of the B7 family. In some
embodiments, said second membrane protein is PD-L1.
In a preferred embodiment the method further comprises providing a further
binding molecule (second binding molecule) comprising an antigen binding site
that
can bind an extracellular part of said member of the TNF receptor superfamily
and
an antigen binding site that can bind an extracellular part of said second
membrane protein, wherein said first and second binding molecule bind:
- different epitopes on said first membrane protein;
- different epitopes on said second membrane protein; or
- different epitopes on said first membrane protein and different epitopes on
said second membrane protein;
the method further comprising incubating said first cell and second cell with
said first and second binding molecule, thereby stimulating or enhancing
activation
of said member of the TNF receptor superfamily on said first cell.
The invention also provides a binding molecule that comprises an antigen
binding site that can bind an extracellular part of a member of the TNF
receptor
superfamily (first membrane protein) and an antigen binding site that can bind
an
extracellular part of a second membrane protein. The TNF receptor superfamily
member is preferably CD137 or 0X40, preferably CD137. In some embodiments
said second membrane protein is not a member of the TNF receptor superfamily.
Said second membrane protein is preferably a member of the B7 family. In some
embodiments, said second membrane protein is PD-Li.
The invention further provides a composition or kit of parts comprising one or
more binding molecules that comprises an antigen binding site that can bind an
extracellular part of a member of the TNF receptor superfamily (first membrane
protein) and an antigen binding site that can bind an extracellular part of a
second
membrane protein. In a preferred embodiment the invention provides a
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
4
composition or kit of parts comprising two or more of such binding molecules;
wherein at least two of said binding molecules can bind:
- different epitopes on said first membrane protein;
- different epitopes on said second membrane protein; or
- different epitopes on said first membrane protein and different epitopes on
said second membrane protein. It is preferred that at least two of the binding
molecules bind the same epitope on said first membrane protein and bind
different
epitopes on said second membrane protein.
The invention further provides a method of stimulating activity of CD137
or 0X40 on a cell, the method comprising providing a first cell and a second
cell,
wherein said first cell has CD137 or 0X40 on the cell membrane and said second
cell has a second membrane protein on the cell membrane and contacting said
first
cell and second cell with a binding molecule (first binding molecule) that
comprises
an antigen binding site that can bind to an extracellular part of said CD137
or
0X40 (first membrane protein); and an antigen binding site that can bind to an
extracellular part of a second membrane protein; the method further comprising
incubating said first cell and said second cell with said first binding
molecule,
thereby stimulating activity of said CD137 or 0X40 on said first cell. In some
embodiments said second membrane protein is not a member of the TNF receptor
superfamily. In some embodiments, said method is an in citro method.
In a preferred embodiment the method further comprises providing a further
binding molecule (second binding molecule) comprising an antigen binding site
that
can bind an extracellular part of said first membrane protein; and an antigen
binding site that can bind an extracellular part of said second membrane
protein,
wherein said first and second binding molecule bind:
- different epitopes on said first membrane protein;
- different epitopes on said second membrane protein; or
- different epitopes on said first membrane protein; and different epitopes on
said second membrane protein;
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
the method further comprising incubating said first cell and said second cell
with said first and second binding molecule, thereby stimulating activity of
CD137
or 0X40 on said first cell.
5 In some embodiments a binding molecule according to the invention
comprises an antigen binding site that can bind an extracellular part of a
member
of the TNF receptor superfamily and an antigen binding site that can bind a
member of the B7 family. In some embodiments the antigen binding sites of said
binding molecule according to the invention consist of one antigen binding
site that
can bind an extracellular part of a member of the TNF receptor superfamily and
one antigen binding site that can bind a member of the B7 family. In some
embodiments said binding molecule according to the invention comprises an
antigen binding site that can bind an extracellular part of CD137 and an
antigen
binding site that can bind a member of the B7 family. In some embodiments the
antigen binding sites of said binding molecule according to the invention
consist of
one antigen binding site that can bind an extracellular part of CD137 and one
antigen binding site that can bind a member of the B7 family. In some
embodiments said binding molecule according to the invention comprises an
antigen binding site that can bind CD137 and an antigen binding site that can
bind
PD-Li. In some embodiments the antigen binding sites of said binding molecule
according to the invention consist of one antigen binding site that can bind
CD137
and one antigen binding site that can bind PD-L1. In some embodiments said
binding molecule according to the invention has no more than two antigen
binding
sites.
A binding molecule as described herein is preferably an antibody.
The invention further provides a method of stimulating activity of a member
of the TNF receptor superfamily on a cell comprising providing a first cell
and a
second cell, wherein said first cell has said member on the cell membrane
(first
membrane protein) and said second cell has a second membrane protein on the
cell
membrane, the method comprising contacting said cells with an antibody
according
to the present invention that comprises at least two variable domains, wherein
one
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
6
variable domain comprises a first antigen binding site that can bind an
extracellular part of said first membrane protein and another variable domain
comprises a second antigen binding site that can bind an extracellular part of
said
second membrane protein, thereby stimulating activity of said member on said
first
cell. In some embodiments, said method is an in uitto method.
The invention further provides an antibody or a functional part, derivative
and/or analogue thereof that comprises
- a variable domain that can bind to an extracellular part of a member of the
TNF receptor superfamily (first membrane protein); and
- a variable domain that can bind to an extracellular part of a second
membrane protein. The first membrane protein is preferably CD137 or 0X40,
preferably CD137. In some embodiments said second membrane protein is not a
member of the TNF receptor superfamily.
The binding molecule is preferably a bispecific antibody. The invention
further provides a method of stimulating activity of a member of the TNF
receptor
superfamily on a cell comprising providing a first cell and a second cell,
wherein
said first cell has said member on the cell membrane (first membrane protein)
and
said second cell has a second membrane protein on the cell membrane, the
method
comprising contacting said cells with a bispecific antibody that comprises two
variable domains, wherein one variable domain comprises a first antigen
binding
site that can bind an extracellular part of said first membrane protein and
another
variable domain comprises a second antigen binding site that can bind an
extracellular part of said second membrane protein, thereby stimulating
activity of
said member on said first cell. In some embodiments, said method is an in
uitro
method. Also provided is a bispecific antibody that comprises a variable
domain
with an antigen binding site that can bind an extracellular part of a member
of the
TNF receptor superfamily (first membrane protein) and a variable domain with
an
antigen binding site that can bind an extracellular part of a second membrane
protein. The first membrane protein is preferably CD137 or 0X40, preferably
CD137. The second membrane protein is preferably not a member of the TNF
receptor superfamily.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
7
In some embodiments an antibody according to the invention comprises a
variable domain that comprises an antigen binding site that can bind an
extracellular part of a member of the TNF receptor superfamily and an antigen
binding site that can bind a member of the B7 family. In some embodiments the
antigen binding sites of said antibody according to the invention consist of
one
antigen binding site that can bind an extracellular part of a member of the
TNF
receptor superfamily and one antigen binding site that can bind a member of
the
B7 family. In some embodiments said antibody according to the invention
comprises an antigen binding site that can bind an extracellular part of CD137
and
an antigen binding site that can bind a member of the B7 family. In some
embodiments the antigen binding sites of said antibody according to the
invention
consist of one antigen binding site that can bind an extracellular part of
CD137 and
one antigen binding site that can bind a member of the B7 family. In some
embodiments said antibody according to the invention comprises an antigen
binding site that can bind CD137 and an antigen binding site that can bind PD-
Li.
In some embodiments the antigen binding sites of said antibody according to
the
invention consist of one antigen binding site that can bind CD137 and one
antigen
binding site that can bind PD-Li. In some embodiments said antibody according
to
.. the invention has no more than two antigen binding sites.
Further provided is a pharmaceutical composition that comprises one or more
binding molecules preferably antibodies or variants thereof of the invention.
Also provided is a nucleic acid molecule or a collection of nucleic acid
molecules that codes for a heavy chain(s) or a heavy chain variable region(s)
of an
antibody of the invention or a variant thereof.
Also provided is a nucleic acid molecule or collection of nucleic acid
.. molecules that codes for an antibody of the invention.
An antibody of the invention preferably comprises a heavy chain variable
region comprising an amino acid sequence of an MF as depicted in figure 3. In
a
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
8
preferred embodiment the antibody further comprises a light chain variable
region
that comprises an amino acid sequence of a light chain variable region
depicted in
figure 1. In a preferred embodiment the light chain comprises an amino acid
sequence as depicted in figure 1A. In a preferred embodiment the heavy chain
comprises a constant region of an IgG1 antibody, preferably a human IgG1
antibody. In a preferred embodiment the CH2 region of said IgG1 constant
region
is engineered to reduce ADCC and/or CDC activity of the antibody. In a
preferred
embodiment the CH2 region comprises a sequence as depicted in figure 2E. In a
preferred embodiment the CH3-region of the antibody is engineered to
facilitate
heterodimerization of the heavy chains. In a preferred embodiment one heavy
chain comprises a sequence as depicted in figure 2F and another heavy chain
comprises a sequence as depicted in figure 2G.
Also provided is a cell comprising one or more nucleic acid molecules that
alone or together code for an antibody or a variant thereof of the invention.
Also
provided are methods of producing an antibody or a variant thereof of the
invention
using a cell as described, preferably together with the harvesting of the
antibody or
variant thereof from a culture of the cells.
Further provided is a cell system that comprises an antibody or variant
thereof of the invention.
Also provided is a method for the treatment of an individual that has a
disease involving aberrant cells such as cancer or has a chronic infection
with a
virus or parasite, the method comprising administering a binding molecule,
.. preferably an antibody or a variant thereof of the invention to the
individual in
need thereof.
The invention further provides a binding molecule, preferably an antibody
or variant thereof of the invention; preferably a bispecific antibody or
variant
thereof of the invention, for use in the treatment of an individual that has
disease
involving aberrant cells such as cancer, or a chronic infection with a virus
or
parasite.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
9
In a preferred embodiment the parasite is an intracellular parasite.
Further provided is a method of stimulating an immune response in an
individual against an aberrant cell in said individual, the method comprising
providing (administering to) said individual with a binding molecule,
preferably an
antibody or a variant thereof, preferably a bispeeifie antibody or a variant
thereof
of the invention. The aberrant cell is preferably a cancer cell, a virus-
infected cell, a
parasite or a parasite infected cell. In a preferred embodiment the cell is a
cancer
cell or a neoplastic cell.
DETAILED DESCRIPTION OF THE INVENTION
The tumor necrosis factor receptor superfamily (TNFRSF) is a group of
receptors. They are typically characterized by the ability to bind tumor
necrosis
factors (TNFs) via an extracellular cysteine-rich domain. With the exception
of
nerve growth factor (NGF), all TNFs are homologous to the archetypal TNF-
alpha.
In their active form, the majority of TNF receptors form trimeric complexes in
the
plasma membrane. Accordingly, most TNF receptors contain transmembrane
domains (TMDs) and are located on the cell membrane. However, some can be
cleaved into soluble forms (e.g. TNFR1), and some lack a TMD entirely (e.g.
DcR3).
An antibody of the invention that binds to a member of the TNF receptor
superfamily binds to a membrane bound member of the superfamily. Members that
exist only in forms that are not associated with the cell membrane are not
within
the scope of the present invention.
TNF receptors are involved in signaling to the inside of the cell upon binding
of the ligand of the receptor. Some receptors require specific adaptor protein
such
as TRADD, TRAF, RIP and FADD for downstream signaling. In the context of the
present invention various members of the TNF superfamily are preferred. These
include Tumor necrosis factor receptor 1; Tumor necrosis factor receptor 2;
Lymphotoxin beta receptor; 0X40; CD40; Fas receptor; CD27; CD30; CD137; Death
receptor 3; Death receptor 4; Death receptor 5; Death receptor 6; RANK; TROY;
BAFF receptor; B-cell maturation antigen (BCMA) and a trans-membrane
activator and calcium-modulating eyclophilin ligand-interacting protein
(TACT).
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
Tumor necrosis factor receptor 1 is one of the major receptors for the tumor
necrosis factor-alpha. The receptor has a large number of alternative names
some
of which are Tumor Necrosis Factor Receptor Superfamily Member 1A;
5 TNFRSF1A; TNF-R1; TNF-RI; TNFR-I; TNFR1; TNFAR; P60; P55; Tumor
Necrosis Factor Receptor 1A Isoform Beta; Tumor Necrosis Factor Binding
Protein
1; Tumor Necrosis Factor Receptor Type 1; Tumor Necrosis Factor Receptor Type
I;
Tumor Necrosis Factor-Alpha Receptor; Tumor Necrosis Factor Receptor 1;
CD120a Antigen; TNFR1-D2; TNF-R-I; TNF-R55; CD120a; TNFR55; TNFR60;
10 TNF-R; P55-R; Tbpl; FPF; and M55. External Ids for Tumor necrosis factor
receptor 1 are HGNC: 11916; Entrez Gene: 7132; Ensembl: ENSG00000067182;
OMIM: 191190 and UniProtKB: P19438.
Tumor necrosis factor receptor 2 is a membrane receptor that binds tumor
necrosis factor-alpha (TNFa). The receptor has a large number of alternative
names some of which are: Tumor Necrosis Factor Receptor Superfamily Member
1B; TNFRSF1B; Tumor Necrosis Factor Receptor Type II; Tumor Necrosis Factor
Receptor 2; P80 TNF-Alpha Receptor; TNF-RII; TNF-R2; TNFR2; TNFBR; P75;
Tumor Necrosis Factor Binding Protein 2; Tumor Necrosis Factor Beta Receptor;
P75 TNF Receptor; CD120b Antigen; Etanercept; TNF-R-II; TNF-R75; P75TNFR;
TNFR-II; CD120b; TNFR1B; TNFR80; TBPII. External Ids thr Tumor necrosis
factor receptor 2 are: HGNC: 11917; Entrez Gene: 7133; Ensembl:
ENSG00000028137; OMIM: 191191; and UniProtKB: P20333.
Lymphotoxin beta receptor is expressed on the surface of most cell types,
including cells of epithelial and myeloid lineages, but typically not on
normal T and
B lymphocytes. The protein binds the lymphotoxin membrane form (a complex of
lymphotoxin-alpha and lymphotoxin-beta). The encoded protein and its ligand
play
a role in the development and organization of lymphoid tissue and transformed
cells. Activation of the protein can in instances trigger apoptosis. The
protein is
known under a large number of aliases among which there are: LTBR; Tumor
Necrosis Factor Receptor 2-Related Protein; Tumor Necrosis Factor Receptor
Type
III; Tumor Necrosis Factor C Receptor; D125370; TNFRSF3; TNFCR; TNFR3;
Lymphotoxin Beta Receptor (TNFR Superfamily, Member 3); Lymphotoxin B
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
11
Receptor; LT-BETA-R; TNF-R-III; TNFR.2-RP; TNF-RIII;
TNFR-RP; and
CD18. External Ids for Lymphotoxin beta receptor are HGNC: 6718; Entrez Gene:
4055; Ensembl: ENSG00000111321; OMIM: 600979 and UniProtKB: P36941.
0X40 is not constitutively expressed on resting naïve T cells, unlike CD28,
0X40 is a secondary co-stimulatory immune checkpoint molecule, expressed after
24 to 72 hours following activation; its ligand, OX4OL, is also not expressed
on
resting antigen presenting cells, but is following their activation.
Expression of
0X40 is dependent on activation of the T cell. Without CD28, expression of
0X40 is
typically delayed and present at lower levels. The protein is known under a
large
number of aliases among which there are: TNFRSF4; Tumor Necrosis Factor
Receptor Superfamily Member 4; TAX Transcriptionally-Activated Glycoprotein 1
Receptor; OX4OL Receptor; ACT35 Antigen; CD134 Antigen; TXGP1L ; Tax-
Transcriptionally Activated Glycoprotein 1 Receptor; Lymphoid Activation
.. Antigone ACT35; 0X40 Cell Surface Antigen; ATC35 Antigen; 0X40 Antigen;
ACT35; CD134; and IMD16. External Ids for 0X40 are HGNC: 11918; Entrez
Gene: 7293; Ensembl: ENSG00000186827; OMIM: 600315 and UniProtKB:
P43489.
CD40 is a costimulatory protein found on antigen presenting cells and is
involved in their activation. The binding of CD154 (CD4OL) on T-helper cells
to
CD40 activates antigen presenting cells and induces intracellular signaling by
C,D40 and a variety of downstream effects. The protein is known under a number
of
different aliases among which there are: CD40 Molecule; CD40 Molecule TNF
.. Receptor Superfamily Member 5; CD4OL Receptor; TNFRSF5; CDW40; Bp50;
Tumor Necrosis Factor Receptor Superfamily, Member 5; B Cell Surface Antigen
CD40; B-Cell Surface Antigen CD40; B Cell-Associated Molecule; CD40 Antigen;
and P50. External Ids for CD40 are HGNC: 11919; Entrez Gene: 958; Ensembl:
ENSG00000101017; OMIM: 109535; and UniProtKB: P25942.
Fas receptor is a death receptor on the surface of cells that leads to
programmed cell death (apoptosis). It forms part of one of the more prominent
apoptosis pathways. It is known under a number of alternatives such as: Fas
Cell
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
12
Surface Death Receptor; Tumor Necrosis Factor Receptor Superfamily, Member 6;
Apoptosis-Mediating Surface Antigen FAS; TNF Receptor Superfamily Member 6;
FASLG Receptor; CD95 Antigen; TNFRSF6; APT1; FAS1; APO-1 Cell Surface
Antigen; Apoptosis Antigen 1; Apo-1 Antigen; Fas AMA; ALPS1A; AP(L)-1; FASTM;
and CD95. External Ids for FAS are HGNC: 11920; Entrez Gene: 355; Ensembl:
ENSG00000026103; OMIM: 134637; and UniProtKB: P25445.
CD27 is thought to be important for generation and long-term maintenance of
T cell immunity. It binds to ligand CD 70, and plays a role in regulating B-
cell
activation and immunoglobulin synthesis. CD27 transduces signals that lead to
the
activation of NF-KB and MAPK8aNK. CD27-binding protein (SIVA), a
proapoptotic protein, can bind to this receptor and is thought to play a role
in the
apoptosis induced by this receptor. Alternative names for this protein are
among
others: CD27 Molecule; Tumor Necrosis Factor Receptor Superfamily, Member 7;
T-Cell Activation Antigen CD27; CD27L Receptor; TNFRSF7; T14; T Cell
Activation Antigen S152; CD27 Antigen; s152. LPFS2; S152 and Tp55. External
Ids for CD27 are: HGNC: 11922; Entrez Gene: 939; Ensembl: EN5G00000139193;
OMIM: 186711; and UniProtKB: P26842.
CD30 is expressed by activated T and B cells. TRAF2 and TRAF5 are thought
to interact with this receptor, and mediate the signal transduction that leads
to the
activation of NF-kappaB. It is a positive regulator of apoptosis, and also has
been
shown to limit the proliferative potential of autoreactive CD8 effector T
cells and
protect the body against autoimmunity. It is known under a number of different
names such as: TNFRSF8; Tumor Necrosis Factor Receptor Superfamily Member
8; Lymphocyte Activation Antigen C,D30; CD3OL Receptor; Ki-1 Antigen; D1S166E;
CD30; Cytokine Receptor CD30; CD30 Antigen; and Ki-1. External Ids for CD30
are: HGNC: 11923; Entrez Gene: 943; Ensembl: ENSG00000120949; OMIM:
153243; and UniProtKB: P28908.
CD137 can be expressed by activated T-cells. It is also found on other cells
such as dendritic cells, natural killer cells, granulocytes and cells of the
blood
vessel wall at sites of inflammation. The protein is known for its
costimulatory
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
13
activity for activation of T-cells. CD137 is known under a number of different
names such as: TNFRSF9; TNF Receptor Superfamily Member 9; Tumor Necrosis
Factor Receptor Superfamily Member 9; T-Cell Antigen 4-1BB Homolog; 4-1BB
Ligand Receptor; T-Cell Antigen ILA; CD137 Antigen; CDw137; ILA; Interleukin-
Activated Receptor, Homolog Of Mouse Ly63; Induced By Lymphocyte Activation
(ILA); Homolog Of Mouse 4-1BB; Receptor Protein 4-1BB; T Cell Antigen ILA; and
4-1BB. External Ids for CD137 are HGNC: 11924; Entrez Gene: 3604; Ensembl:
EN5G00000049249; OMIM: 602250; and UniProtKB: Q07011. CD137 is an
inducible receptor most commonly upregulated on activated CD8+ T cells. CD137
signaling enhances T cell function by activating NF-KB [Arch et al, 1998].
Other
cell immune cell types including CD4+ T cells, monocytes, B cells, dendritic
cell
(DC) subpopulations and granulocytes and NK cells can express CD137 at various
levels [Shao et al, 20111. In monocytes, CD137 is inducible by activation with
lipopolysaccharide (LPS) and IL-1(3. In B lymphocytes, CD137 expression is
induced by antibodies against cell-surface immunoglobulin and by
transthrmation
with EBV. In DCs, CD137 ligation induces their maturation through upregulation
of B7 co-stimulatory molecules (CD80 and CD86), in addition to enhancing their
production of inflammatory eytokines (IL-6 and IL-12) and their survival
[Makkouk
et al, 2015]. The natural function of CD137 ligation on neutrophils is the
increment
of phagocytosis of bacterial and parasitic infections. In addition ligation of
CD137
blocks the anti-apoptosis signals mediated by the IL-3/IL-5/GM-CSF receptors
in
neutrophils and eosinophils in vitro, thereby preventing granulocyte
accumulation
[Simon, 2001; Vinay et al, 20111. In non-lymphoid cells such as chondrocytes,
endothelial cells and tumor cells CD137 expression is driven by cytokine
stimulation such as IL-113 for chondrocytes, the inflammatory cytokines
TNFalpha/
IFNy/ IL-1[3 for endothelial cells and IFNy for tumor cells. The ligand that
stimulates CD137 (CD137L) is expressed on activated antigen presenting cells.
CD137 exists in the membrane as monomers and dimers [Pollok et al, 19931.
Death receptor 3 is expressed by activated and antigen-experienced T
lymphocytes. The receptor is also expressed by FoxP3 positive regulatory T
lymphocytes. The ligand for the receptor is TL1A (TNF5F15), which is
upregulated
in antigen presenting cells and some endothelial cells following Toll-Like
Receptor
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
14
or Fc receptor activation. Various alternatively spliced transcript variants
that
code for distinct isoforms have been reported, most of which are potentially
secreted molecules. The receptor is thought to be involved in controlling
lymphocyte proliferation induced by T-cell activation. Activation is thought
to be
dependent on previous engagement of the T cell receptor. Binding of the ligand
increases the sensitivity of T cells to endogenous IL-2 via the IL-2 receptor
and
enhances T cell proliferation. In riuo activation is likely specific to those
T cells
that are encountering cognate antigen. At rest, and for individuals without
underlying autoimmunity, the majority of T cells that regularly encounter
cognate
antigen are FoxP3+ regulatory T cells. Stimulation of death receptor 3 in the
absence of any other exogenous signals stimulates profound and specific
proliferation of FoxP3+ regulatory (CD4 positive) T cells. Therapeutic
agonists of
death receptor 3 can be used to stimulate Treg expansion, which can reduce
inflammation in experimental models of asthma, allogeneic solid organ
transplantation and ocular keratitis. On the other hand costimulation of the
receptor together with an autoantigen or with a vaccine antigen can lead to
exacerbation of immunopathology or enhanced vaccine-stimulated immunity,
respectively. Receptor stimulation is specific to T cell mediated immunity,
which
can be used to enhance or dampen inflammation depending on the temporal
context and quality of foreign versus self-antigen availability. Stimulation
of
TNFRSF25 in humans may lead to similar, but more controllable, effects as
costimulatory blockade targeting molecules such as CTLA-4 and PD-1. Death
receptor 3 is also known under a number of other names such as TNFRSF25;
Tumor Necrosis Factor Receptor Superfamily Member 25; Tumor Necrosis Factor
Receptor Superfamily, Member 12 (Translocating Chain-Association Membrane
Protein); Lymphocyte-Associated Receptor Of Death; Apoptosis-Mediating
Receptor
TRAMP; Apoptosis-Mediating Receptor DR3; Apoptosis-Inducing Receptor AIR;
Protein WSL-1; TNFRSF12; APO-3; DDR3; LARD; DR3; Apoptosis Inducing
Receptor; Death Receptor Beta; Protein WSL; WSL-LR; TRAMP; WSL-1; AP03;
WSL1; TR3; and WSL. External Ids for death receptor 3 are HGNC: 11910; Entrez
Gene: 8718; Ensembl: ENSG00000215788; OMIM: 603366; and UniProtKB:
Q93038.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
Death receptor 4 is a cell surface receptor of the TNF-receptor superfamily
that binds TRAIL and thought to transduce a cell death signal and induce cell
apoptosis. It is known under a number of names such as: TNFRSF10A; Tumor
Necrosis Factor Receptor Superfamily Member 10a; TNF-Related Apoptosis-
5 Inducing Ligand Receptor 1; Death Receptor 4; TRAIL Receptor 1; TRAIL-R1;
TRAILR1; AP02; 1I)R4; Tumor Necrosis Factor Receptor Superfamily Member 10a
Variant 2; Cytotoxic TRAIL Receptor; CD261 Antigen; TRAILR-1 and CD261.
External Ids for Death receptor 4 are HGNC: 11904; Entrez Gene: 8797; Ensembl:
ENSG00000104689; OMIM: 603611; and UniProtKB: 000220
Death receptor 5 is a cell surface receptor of the TNF-receptor superfamily
that binds TRAIL and mediates apoptosis. The receptor can be activated by
tumor
necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/AP0-2L), and
transduces apoptosis signal. The receptor is known under a number of different
names among which there are: TNFRSF10B; Tumor Necrosis Factor Receptor
Superfamily Member 10b; TNF-Related Apoptosis-Inducing Ligand Receptor 2;
Death Receptor 5; TRAIL-R2; TRAILR2; KILLER; TRICK2; ZTNFR9; DRS; P53-
Regulated DNA Damage-Inducible Cell Death Receptor(Killer); Tumor Necrosis
Factor Receptor-Like Protein ZTNFR9; Death Domain Containing Receptor For
TRAIL/Apo-2L; Apoptosis Inducing Protein TRICK2A/2B; Apoptosis Inducing
Receptor TRAIL-R2; TNF Receptor Superfamily Member 10b; Cytotoxic TRAIL
Receptor-2; Fas-Like Protein; TRAIL Receptor 2; CD262 Antigen; KILLER/DRS;
TRICK2A; TRICK2B; TRICKB; and CD262. External Ids for Death receptor 5 are:
HGNC: 11905; Entrez Gene: 8795; Ensembl: EN5G00000120889; OMIM: 603612;
and UniProtKB: 014763.
Death receptor 6 can induce cell apoptosis upon activation. Knockout studies
in mice suggest that the receptor plays a role in T helper cell activation,
and may
be involved in inflammation and immune regulation. The receptor is also
thought
to be involved in neurodegeneration in the brain that causes Alzheimer's
disease as
well as signal transduction in stress response and cellular survival. Over-
expression induces apoptosis of the expressing cell. APP (amyloid precursor
protein) is the natural ligand of the receptor and is first cleaved into A6
and N-
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
16
APP. N-APP is the fragment that interacts with DR6 to trigger axonal
degradation
in Alzheimer's patients. Death receptor 6 is also known under a number of
other
names such as TNFRSF21; Tumor Necrosis Factor Receptor Superfamily Member
21; DR6; TNFR-Related Death Receptor 6; CD358 Antigen; BM-018; and CD358.
External Ids for death receptor 6 are HGNC: 13469; Entrez Gene: 27242;
Ensembl:
ENSG00000146072; OMIM: 605732; UniProtKB: 075509.
RANK is a receptor for RANK-Ligand (RANKL) and part of the
RANK/RANKL/OPG signaling pathway that regulates osteoclast differentiation
and activation. It is associated with bone remodeling and repair, immune cell
function, lymph node development, thermal regulation, and mammary gland
development. Osteoprotegerin (OPG) is a decoy receptor for RANK, and regulates
the stimulation of the RANK signaling pathway by competing for RANKL. The
cytoplasmic domain of RANK transmits signals to downstream targets such as NF-
KB and JNK. RANK is expressed in skeletal muscle, thymus, liver, colon, small
intestine, adrenal gland, osteoclast, mammary gland epithelial cells,
prostate,
vascular cell, and pancreas. Often activation of NF-KB is mediated by RANKL,
but
over-expression of RANK alone is can also activate the NF-KB pathway. RANK is
known under a number of different names such as: TNFRSF11A; Tumor Necrosis
Factor Receptor Superfamily Member ha NFKB Activator; Loss Of
Heterozygosity, 18, Chromosomal Region 1; ()stemlast Differentiation Factor
Receptor; Receptor Activator Of NF-KB; Paget Disease Of Bone 2; ODFR; Tumor
Necrosis Factor Receptor Superfamily, Member 11a, Activator Of NFKB; Tumor
Necrosis Factor Receptor Superfamily Member 11a, NFKB Activator; Receptor
Activator Of Nuclear Factor-Kappa B; CD265 Antigen; LOH18CR1; TRANCER;
CD265; OPTB7; OSTS; PDB2; FE0 and OFE. External Ids for RANK are: HGNC:
11908; Entrez Gene: 8792; Ensembl: EN5G00000141655; OMIM: 603499 and
UniProtKB: Q9Y6Q6.
The BAFF receptor is a membrane protein of the TNF receptor superfamily
which recognizes BAFF. B-cell activating factor (BAFF) enhances B-cell
survival in
vitro and is a regulator of the peripheral B-cell population. The BAFF
receptor is a
receptor for BAFF and is a type III transmembrane protein containing a single
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
17
extracellular phenylalanine -rich domain. It is thought that this receptor is
the
principal receptor required for BAFF-mediated mature B-cell survival. BAFF is
also bound by the TNF receptors B-cell maturation antigen (BCMA) and a trans-
membrane activator and calcium-modulating cyclophilin ligand-interacting
protein
(TACT). The BAFF-receptor is known under a number of different names such as
TNFRSF13C; Tumor Necrosis Factor Receptor Superfamily Member 13C; B-Cell-
Activating Factor Receptor; BLyS Receptor 3; BAFF-R; BAFFR; B Cell-Activating
Factor Receptor; CD268 Antigen; Prolixin; BROMIX; CD268; CVID4; and BR3.
External Ids for the BAFF-receptor are HGNC: 17755; Entrez Gene: 115650;
Ensembl: ENSG00000159958; OMIM: 606269; and UniProtKB: Q96RJ3.
B-cell maturation antigen (BCMA) is a cell surface receptor of the TNF
receptor superfamily which recognizes B-cell activating factor (BAFF). The
receptor
is preferentially expressed in mature B lymphocytes, and is thought to be
important for B cell development and autoimmune response. The receptor has
been
shown to specifically bind to the tumor necrosis factor (ligand) superfamily,
member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and
MAPK8aNK activation. B-cell maturation antigen is also known under a number
of aliases such as TNFRSF17; Tumor Necrosis Factor Receptor Superfamily
Member 17; B-Cell Maturation Protein; BCM; B-Cell Maturation Factor; CD269
Antigen; TNFRSF13A; and CD269. External Ids for BCMA are HGNC: 11913;
Entrez Gene: 608; Ensembl: ENSG00000048462; OMIM: 109545; and UniProtKB:
Q02223.
Trans-membrane activator and calcium-modulating cyclophilin ligand-
interacting protein (TACT). The protein encoded by this gene is a lymphocyte-
specific member of the tumor necrosis factor (TNF) receptor superfamily. It
interacts with calcium-modulator and cyclophilin ligand (CAML). The protein
can
also bind BAFF and APRIL (TNSF13 or CD256). TACT induces activation of the
transcription factors NFAT, AP1, and NF-kappa-B and plays a role in humoral
immunity by interacting with a TNF ligand. Mice deficient for TACT have
increased splenic B cells and serum Igs, which was suggested to mean a
potential
negative regulatory role for TACT in B cell survival. However, a simpler
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
18
explanation might be that the lack of TACT allows more circulating BAFF to
become available, which can bind to BR3 and increase B cell numbers. Diseases
associated with TACT include immunodeficiency, common variable, 2 and
immunoglobulin a deficiency 2. The gene coding for TACT is located within the
Smith-Magenis syndrome region on chromosome 17. TACT is also known under
number of other names such as TNFRSF13B, Tumor Necrosis Factor Receptor
Superfamily Member 13B; Transmembrane Activator And C,AML Interactor;
Tumor Necrosis Factor Receptor 13B; CD267 Antigen; TNFRSF14B; CD267;
CVID2; IGAD2; CVID; and RYZN 3. External Ids for TACT are HGNC: 18153;
Entrez Gene: 23495; Ensembl: EN5G00000240505; OMIM: 604907; and
UniProtKB: 014836.
TROY is expressed during embryonic development. It has been shown
activate JNK signaling pathway when overexpressed in cells. Activation of the
receptor can induce apoptosis. The receptor is believed to play a role in
embryonic
development. Alternatively spliced transcript variants encoding distinct
isoforms
have been described. TROY is also known under a number of other names such as
TNFRSF19; Tumor Necrosis Factor Receptor Superfamily Member 19; Toxicity
And JNK Inducer; TRADE; TAJ; and TAJ-Alpha. External Ids for TROY are
HGNC: 11915; Entrez Gene: 55504; Ensembl: EN5G00000127863; OMIM: 606122;
and UniProtKB: Q9N568.
The B7 family comprises a number of structurally related, cell-surface
proteins, which bind to receptors on lymphocytes that regulate immune
responses.
Activation of lymphocytes is initiated by engagement of cell-surface, antigen-
specific T-cell receptors or B-cell receptors. Additional signals delivered
simultaneously by B7 ligands further determine the immune response of these
cells. These so-called 'costimulatory' or 'coinhibitory' signals are delivered
by B7
family members through the CD28 family of receptors on lymphocytes. Binding of
B7-family members with costimulatory receptors augments immune responses, and
binding with coinhibitory receptors attenuates immune responses. Presently the
following members are believed to be part of this family: B7.1 (CD80), B7.2
(CD86), inducible costimulator ligand (ICOS-L), programmed death-1 ligand (PD-
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
19
L1), programmed death-2 ligand (PD-L2), B7-H3 (CD276), B7-H4, B7-H5, B7-H6
and B7-H7. B7 family members are expressed in lymphoid and non-lymphoid
tissues. Effects of members on regulating immune responses are shown in the
development of immunodeficiency and autoimmune diseases in mice with
mutations in B7-family genes. Manipulation of the signals delivered by B7
ligands
has shown potential in the treatment of autoimmunity, inflammatory diseases
and
cancer.
A binding molecule or antibody or variant thereof according to the invention
that binds an extracellular part of a member of the TNF receptor superfamily
and
an extracellular part of a member of the B7 family provides the advantage that
a
desired immune response can be particularly well promoted, since B7 family
members deliver 'costimulatory or 'coinhibitory' signals to lymphocytes,
thereby
augmenting or attenuating an immune response. Hence, by targeting a member of
the B7 family it is possible to enhance stimulatory signals and/or to
counteract
inhibitory signals, thereby inducing or enhancing a desired immune response,
for
instance against aberrant cells.
CD80 is a protein found on activated B cells and monocytes that provides a
costimulatory signal necessary for T cell activation and survival. It is the
ligand for
two different proteins on the T cell surface: CD28 and CTLA-4. When bound to
CD28 it is associated with co-stimulation whereas binding to CTLA4 is
associated
with attenuation of an immune response. CD80 works in tandem with CD86 to
activate T cells. CD80 is reported to also bind PD-L1. CD80 is known under a
number of other names such as CD80 Molecule; CD80 Antigen; CD28 Antigen
Ligand 1; B7-1 Antigen; B-Lymphocyte Activation Antigen B7; CTLA-4 Counter-
Receptor B7.1; Activation B7-1 Antigen; CD28LG1; CD28LG; LAB7; BB1; B7;
Costimulatory Factor CD80; CD80 Antigen; and B7-1. External Ids for CD80 are
HGNC: 1700; Entrez Gene: 941; Ensembl: ENSG00000121594; OMIM: 112203; and
UniProtKB: P33681.
CD86 is a protein expressed on antigen-presenting cells. It can provide
costimulatory signals for T cell activation and survival. It is the ligand for
two
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
different proteins on the T cell surface: CD28 and CTLA-4. When bound to CD28
it
is associated with co-stimulation whereas binding to CTLA4 is associated with
attenuation of an immune response. CD86 works in tandem with CD80 to activate
T cells. It is known under a number of different names such as CD86 Molecule;
5 CD86 Antigen; CD28 Antigen Ligand 2; B7-2 Antigen; CTLA-4 Counter-
Receptor
B7.2; CD28LG2; FUN-1; BU63; B70; B-Lymphocyte Activation Antigen B7-2; B-
Lymphocyte Antigen B7-2; Activation B7-2 Antigen; CD8(3 Antigen; LAB72; and
B7-2. External Ids for CD86 are HGNC: 1705; Entrez Gene: 942; Ensembl:
ENSG00000114013; OMIM: 601020; and UniProtKB: P42081.
Inducible T-Cell Co-Stimulator Ligand (ICOSL or CD275) is constitutively
expressed by APCs as well as a number of non-hematologic tissues. Expression
can
be down-regulated with ongoing inflammation. ICOSL is presently known to
interact with ICOS, CD28 and CTLA-4 in humans. ICOSL/CD28 interaction
appears to co-stimulate human T cells' primary responses to allogeneic
antigens
and memory recall responses. ICOSL/CTLA-4 is thought to result coinhibitory
signals. ICOSL is also known as ICOSLG; B7-Related Protein 1; B7 Homolog 2; B7-
Like Protein G150; B7 Homologue 2; B7RP-1; B7-H2; B7RP1; B7H2;
Transmembrane Protein B7-H2 ICOS Ligand; CD275 Antigen; KIAA0653; ICOS-L;
LICOS; and GL50. External Ids for ICOSL are HGNC: 17087; Entrez Gene: 23308;
Ensembl: ENSG00000160223; OMIM: 605717; and UniProtKB: 075144.
PD-L1 is a type 1 transmembrane protein that plays a role in suppressing an
immune response during particular events such as pregnancy, tissue allografts,
autoimmune disease and other disease states such as hepatitis. PD-Li is
expressed in various types of cancers, especially in NSCLC (Boland et al.,
2013;
Velcheti et al., 2014), melanoma, renal cell carcinoma, gastric cancer,
hepatocellular as well as various leukemias and multiple myeloma (Bernstein et
al., 2014; Thompson et al., 2005). PD-Li is present in the cytoplasm and
plasma
membrane of cancer cells, but not all cancers or all cells within a tumor
express
PD-L1 (Dong et al., 2002). Multiple tumor microenvironment cells contribute to
immune suppression by upregulating PD-L1 expression. This effect is called
"adaptive immune resistance", because the tumor protects itself by inducing PD-
Li
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
21
in response to IFN-y produced by activated T cells (Sharma et al., 2017). PD-
Li can
also be regulated by oncogenes, this mechanism is known as inherent immune
resistance (Akbay et al., 2013). Within the tumor microenvironment, PD-L1 is
also
expressed on myeloid cells and activated T cells (Tumeh et al., 2014). The
expression of PD-Li is induced by multiple proinfiammatory molecules,
including
types I and II IFN-y, TNF-a, LPS, GM-CSF and VEGF, as well as the cytokines IL-
and IL-4, with IFN-y being the most potent inducer (Kondo et al., 2010; Sznol
and Chen, 2013).
The binding of PD-Li to PD-1 or B7.1 (CD80) transmits an inhibitory signal
10 which reduces the proliferation of the PD-1 expressing T cells. PD-1 is
thought to
be able to control the accumulation of foreign antigen specific T cells
through
apoptosis. PD-Li is expressed by a variety of cancer cells and the expression
thereof is thought to be at least in part responsible for a dampening of an
immune
response against the cancer cell. PD-Li is a member of the B7-family of
protein and
is known under a variety of other names such as CD274 Molecule; C11)274
Antigen;
B7 Homolog 1; PDCDI Ligand 1; PDCD ILGI; PDCD1L1; B7H1; PDLI;
Programmed Cell Death 1 Ligand 1; Programmed Death Ligand 1; B7-H1; and B7-
H. External Ids for C11)274 are HGNC: 17635; Entrez Gene: 29126; Ensembl:
ENSG00000120217; OMIM: 605402; UniProtKB: Q9NZQ7.
P11)-L2 is a second ligand for P11)-i. Engagement of P11)-1 by PD-L2 inhibits
T
cell receptor (TCR)-mediated proliferation and eytokine production by CD4+ T
cells. At low antigen concentrations, PD-L2/PD-1 binding inhibits B7-CD28
signals.
At high antigen concentrations, PD-L2/PD-1 binding reduces cytokine
production.
PD-L expression is up-regulated on antigen-presenting cells by interferon
gamma
treatment. It is expressed in some normal tissues and a variety of tumors. PD-
Li
and PD-L2 are thought to have overlapping functions and regulate T cell
responses. The protein is known under a number of other names such as
Programmed Cell Death 1 Ligand 2; B7 Dendritic Cell Molecule; Programmed
Death Ligand 2; Butyrophilin B7-DC; PDCDI Ligand 2; PD-1 Ligand 2; PDCD1L2;
B7-DC; CD273; B7DC; PDL2; PD-1-Ligand 2; CD273 Antigen; BA574F11.2; and
Btdc. External Ids for PD-L2 are HGNC: 18731; Entrez Gene: 80380; Ensembl:
ENSG00000197646; OMIM: 605723; and UniProtKB: Q9E1Q51.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
22
B7-H3 (CD276) expression is increased in various malignancies and can
distinguish between normal and tumor-derived circulating endothelial cells
(Kraan
et al British Journal of Cancer (2014) 111,149-156). Stimulation of the
receptor
directs the differentiation of human marrow stromal cells to osteoblasts (Xu
et al
2011; Immunobiology 216 (2011) 1311-1317). The protein contains 4 Ig-like
domains in humans whereas the mouse protein appears to have 2 of such domains.
The protein is thought to be the first identified ligand for the triggering
receptor
expressed on myeloid cells (TREM)-like transcript 2 (TLT-2 or TREMML2). The
.. latter protein binds B7-H3 (41g-B7-H3) and costimulates activation of CD8 T-
cells
(Hofmeyer et al 2009 PNAS 105; 10277-10278). CD276 is broadly expressed. It
acts
as a T cell costimulator. CD276 is also known under a number of other names
such
as CD276 Molecule; Costimulatory Molecule; CD276 Antigen; B7 Homolog 3; 41g-
B7-H3; B7-H3; B7H3; and B7RP-2. External Ids thr CD276 are HGNC: 19137;
Entrez Gene: 80381; Ensembl: ENSG00000103855; OMIM: 605715; and
UniProtKB: Q5ZPR3.
B7-H4 (VTCN1) mRNA appears to be broadly expressed but only few cells
actively express the protein on the membrane. B7-H4 expression and binding to
activated T cells inhibits T-cell effector function via cell cycle arrest,
decreased
proliferation, and reduced IL-2 production. B7-H4 is up-regulated on the
surface of
cancer cells and immunosuppressive tumor-associated macrophages (TAMs) in a
variety of human cancers. Signaling through B7-H4 pathway leads to the
inhibition
of TCR-mediated CD4+ and CD8+ T cell proliferation, cell-cycle progression,
and
IL-2 production. B7-H4 is also known under a number of other names such as V-
Set Domain Containing T Cell Activation Inhibitor 1; Immune Costimulatory
Protein B7-H4; T-Cell Costimulatory Molecule B7x; B7 Superfamily Member 1; B7
Homolog 4; B7h.5; B7H4; T Cell Costimulatory Molecule B7x; B7 Family Member,
H4; Protein B751; PRO1291; VCTN1; B7S1; B7X; and H4 2. External Ids for B7-H4
are HGNC: 28873; Entrez Gene: 79679; Ensembl: EN5G00000134258; OMIM:
608162 and UniProtKB: Q7Z7D3.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
23
B7-H5 (VISTA) is a 55-65 kDa member of the B7 family. It is a
transmembrane molecule expressed in bone, on embryonic stem cells (ES Cs), and
on tumor cell surfaces. On tumor cells, the protein both promotes MT1-MMP
expression and activity and serves as a substrate for MT1-MMP. This increases
the
potential for cell motility. The protein is known under a number of other
names
such as Chromosome 10 Open Reading Frame 54; V-Set Domain-Containing
Immunoregulatory Receptor; V-Domain Ig Suppressor Of T Cell Activation; Stress-
Induced Secreted Protein-1; Sisp-1; SISP1; Stress Induced Secreted Protein 1;
Platelet Receptor GI24; Platelet Receptor Cii24; Death Domainlalpha; DD
lalpha;
B7H5; and GI24. External IDs for the protein are: HGNC: 30085; Entrez Gene:
64115; Ensembl: EN5G00000107738; OMIM: 615608; and UniProtKB: Q9H7M9.
B7-H6 belongs to the B7 family (see MIM 605402) and is selectively
expressed on tumor cells. Binding of B7-H6 with NKp30 (NCR3; MIM 611550)
results in natural killer (NK) cell activation and cytotoxicity (Brandt et
al., 2009 J
Exp Med. 2009 Jul 6;206(7):1495-503). Natural killer (NK) cells are
lymphocytes of
the innate immune system that participate in the elimination of tumors. B7-H6
is a
tumor cell surface molecule that binds NKp30, a human receptor which triggers
antitumor NK cell cytotoxicity and cytokine secretion. Other names for B7-H6
are
NCR3LG1; Natural Killer Cell Cytotoxicity Receptor 3 Ligand 1; B7 Homolog 6;
B7H6; Putative Ig-Like Domain-Containing Protein
DKFZp686024166/DKFZp686I21167; and DKFZp686024166. External Ids thr B7-
H6 are HeiNC: 42400; Entrez Gene: 374383; Ensembl: EN5G00000188211; OMIM:
613714; and UniProtKB: Q68D85.
B7-H7 (HHLA2) protein was detected in trophoblastic cells of the placenta
and the epithelium of gut, kidney, gallbladder, and breast, but not in most
other
organs. HHLA2 protein is widely expressed in human cancers from the breast,
lung, thyroid, melanoma, pancreas, ovary, liver, bladder, colon, prostate,
kidney,
and esophagus. High HHLA2 expression is associated with regional lymph node
metastasis and stage (Janakiram et al. Clin Cancer Res; 21(10): 2359-66; May
15,
2015). TMIGD2 is identified as one of the receptors for HHLA2. B7-H7 is known
under a number of different names such as HERV-H LTR-Associating 2; Human
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
24
Endogenous Retrovirus-H Long Terminal Repeat-Associating Protein 2; B7H7 and
B7y. External Ids for B7-H7 are HGNC: 4905; Entrez Gene: 11148; Ensembl:
ENSG00000114455; OMIM: 604371 and UniProtKB: Q9UM44.
Programmed Cell Death 1 protein (PD-1) is a cell surface receptor that
belongs to the CD28 family of receptors and is expressed on T cells and pro-B
cells.
PD-1 is presently known to bind two ligands, PD-Li and PD-L2. PD-1,
functioning
as an immune checkpoint, plays an important role in down regulating the immune
system by inhibiting the activation of T-cells, which in turn reduces
autoimmunity
and promotes self-tolerance. The inhibitory effect of PD-1 is thought to be
accomplished through a dual mechanism of promoting apoptosis (programmed cell
death) in antigen specific T-cells in lymph nodes while simultaneously
reducing
apoptosis in regulatory T cells (suppressor T cells). PD-1 is also known under
a
number of different aliases such as PDCD1; Programmed Cell Death 1; Systemic
Lupus Erythematosus Susceptibility 2; Protein PD-1; HPD-1; P1)1; Programmed
Cell Death 1 Protein; CD279 Antigen; CD279; HPD-L; HSLE1; SLEB2; and PD-i.
External Ids for PD-1 are HGNC: 8760; Entrez Gene: 5133; Ensembl:
ENSG00000188389; OMIM: 600244; and UniProtKB: Q15116. New classes of
drugs that block the activity of PD-1, the PD-1 inhibitors, activate the
immune
system to attack tumors and are therefore used with success to treat some
types of
cancer.
CLEC12A is also referred to as C-Type Lectin Domain Family 12, Member A;
C-Type Lectin Protein CLL-1; MICL; Dendritic Cell-Associated Lectin 2; C-Type
Lectin Superfamily; Myeloid Inhibitory C-Type Lectin-Like Receptor; C-Type
Lectin-Like Molecule-1; CLL-1; DCAL2; CLL1; C-Type Lectin-Like Molecule 1;
DCAL-2; Killer cell lectin like receptor subfamily L, member 1 (KLRL1); CD371
(Bakker A. et al. Cancer Res. 2004, 64, p8843 50; GenBankTM access.no:
AY547296; Zhang W. et al. GenBankTM access.no: AF247788; A.S. Marshall, et al.
J Biol Chem 2004, 279, p14792-802; GenBankTM access.no: AY498550; Y.Han et
al. Blood 2004, 104, p2858 66; H.Floyd, et al. GenBankTM access.no: AY426759;
C.H.Chen, et al. Blood 2006, 107, p1459 67). Ids: HGNC: 31713; Entrez Gene:
160364; Ensembl: ENSG00000172322; OMIM: 612088; UniProtKB: Q5QGZ9.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
CLEC12A is an antigen that is expressed on leukemic blast cells and on
leukemic
stern cells in acute myeloid leukemia (AML), including the CD34 negative or
CD34
low expressing leukemic stern cells (side population) (A.B. Bakker et al.
Cancer Res
2004, 64, p8443 50; Van Rhenen et al. 2007 Blood 110:2659; Moshaver et al.
2008
5 Stern Cells 26:3059). Expression of CLEC12A is otherwise thought to be
restricted
to the hematopoietic lineage, particularly to myeloid cells in peripheral
blood and
bone marrow, i.e., granulocytes, monocytes and dendritic cell precursors. More
importantly, CLEC12A is absent on hematopoietic stern cells. This expression
profile makes CLEC12A a particularly favorable target in AML. The full length
10 form of CLEC12A comprises 275 amino acid residues, including an
additional
intracellular stretch of 10 amino acids which is absent in most other
isoforms, and
shows the strictly myeloid expression profile (surface expression and mRNA
The term 'CLEC12A or functional equivalent thereof means all (such as splice
and
mutation) variants that are referenced above and isoforms thereof that retain
the
15 strict myeloid expression profile (both at surface expression level and
mRNA level)
as described in Bakker et al. Cancer Res 2004, 64, p8443-50 and Marshall 2004 -
Biol Chem 279(15), p14792-802. A CLEC12A binding antibody of the invention
binds human CLEC12A. Where herein reference is made to CLEC12A, the
reference is to human CLEC12A, unless specifically stated otherwise.
'ErbB1' or `EGFR' is a member of a family of four receptor tyrosine kinases
(RTKs), named Her- or cErbB-1, -2, -3 and -4. The EGFR has an extracellular
domain (ECD) that is composed of four sub-domains, two of which are involved
in
ligand binding and one of which is involved in homo-dimerisation and hetero-
dimerisation. The reference numbers used in this section refer to the
numbering of
the references in the list headed "References cited in the specification".
EGFR
integrates extracellular signals from a variety of ligands to yield diverse
intracellular responses. The major signal transduction pathway activated by
EGFR
is composed of the Ras-mitogen-activated protein kinase (MAPK) mitogenic
signalling cascade. Activation of this pathway is initiated by the recruitment
of
Grb2 to tyrosine phosphorylated EGFR. This leads to activation of Ras through
the
Grb2-bound Ras-guanine nucleotide exchange factor Son of Sevenless (SOS). In
addition, the P13-kinase-Akt signal transduction pathway is also activated by
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
26
EGFR, although this activation is much stronger in case there is co-expression
of
Her3. The EGFR is implicated in several human epithelial malignancies, notably
cancers of the breast, bladder, non-small cell lung cancer lung, colon,
ovarian head
and neck and brain. Activating mutations in the gene have been found, as well
as
over-expression of the receptor and of its ligands, giving rise to autocrine
activation
loops. This RTK has therefore been extensively used as target for cancer
therapy.
Both small-molecule inhibitors targeting the RTK and monoclonal antibodies
(mAbs) directed to the extracellular ligand-binding domains have been
developed
and have shown hitherto several clinical successes, albeit mostly for a select
group
of patients. A database accession number for the human EGFR protein and the
gene encoding it is (GenBank NM_005228.3). The accession number is primarily
given to provide a further method of identification of EGFR protein as a
target, the
actual sequence of the EGFR protein bound by an antibody may vary, for
instance
because of a mutation in the encoding gene such as those occurring in some
cancers
or the like. Where reference herein is made to EGFR, the reference refers to
human EGFR unless otherwise stated. The antigen-binding site that binds EGFR,
binds EGFR and a variety of variants thereof such as those expressed on some
EGFR positive tumors.
`ErbB-2' or `HER2' as used herein refers to the protein that in humans is
encoded by the ERBB-2 gene. Alternative names for the gene or protein include
CD340; HER-2; HER-2/neu; MLN 19; NEU; NGL; TKR1. The ERBB-2 gene is
frequently called HER2 (from human epidermal growth factor receptor 2). Where
reference is made herein to ErbB-2, the reference refers to human ErbB-2. An
antibody comprising an antigen-binding site that binds ErbB-2, binds human
ErbB-2. The ErbB-2 antigen-binding site may, due to sequence and tertiary
structure similarity between human and other mammalian orthologs, also bind
such an ortholog but not necessarily so. Database accession numbers for the
human
ErbB-2 protein and the gene encoding it are (NP_001005862.1, NP_004439.2
NC_000017.10 NT_010783.15 NC_018928.2). The accession numbers are
primarily given to provide a further method of identification of ErbB-2 as a
target,
the actual sequence of the ErbB-2 protein bound the antibody may vary, for
instance because of a mutation in the encoding gene such as those occurring in
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
27
some cancers or the like. The ErbB-2 antigen binding site binds ErbB-2 and a
variety of variants thereof, such as those expressed by some ErbB-2 positive
tumor
cells.
rErbB-3' or `HER3' as used herein refers to the protein that in humans is
encoded by the ERBB-3 gene. Alternative names for the gene or protein are
HER3;
LCCS2; MDA-BF-1; c-ErbB-3; c-erbb-3; erbb-3-S; p180-Erbb-3; p45-sErbb-3; and
p85-sErbb-3. Where reference is made herein to ErbB-3, the reference refers to
human ErbB-3. An antibody comprising an antigen-binding site that binds ErbB-
3,
binds human ErbB-3. The ErbB-3 antigen-binding site, may, due to sequence and
tertiary structure similarity between human and other mammalian orthologs,
also
bind such an ortholog but not necessarily so. Database accession numbers for
the
human ErbB-3 protein and the gene encoding it are (NP_001005915.1
NP_001973.2, NC_000012.11 NC_018923.2 NT_029419,12 ), The accession
numbers are primarily given to provide a further method of identification of
ErbB-3
as a target, the actual sequence of the ErbB-3 protein bound by an antibody
may
vary, for instance because of a mutation in the encoding gene such as those
occurring in some cancers or the like. The ErbB-3 antigen binding site binds
ErbB-
3 and a variety of variants thereof, such as those expressed by some ErbB-2
positive tumor cells,
LGR4 is Leucine-Rich Repeat Containing G-Protein-Coupled Receptor 4
Alternative names for the gene or protein are; GPR48; G Protein-Coupled
Receptor
48; BNMD17; Leucine-Rich Repeat-Containing Cr-Protein-Coupled Receptor 4;
Leucine-Rich Repeat-Containing G-Protein Coupled Receptor 4; (I-Protein
Coupled
Receptor 48;
A protein or antibody of the invention that binds LGR4, binds human LGR4.
The LGR4 binding protein or antibody of the invention may, due to sequence and
tertiary structure similarity between human and other mammalian orthologs,
also
bind such an ortholog but not necessarily so. Database accession numbers for
the
human LGR4 protein and the gene encoding it are (NC_000011.10; NC_018922.2;
NT_009237.19; NP_060960.2). The accession numbers are primarily given to
provide a further method of identification of LGR4 as a target, the actual
sequence
of the LGR4 protein bound may vary, for instance because of a mutation in the
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
28
encoding gene such as those occurring in some cancers or the like. The LGR4
antigen binding site binds LGR4 and a variety of variants thereof, such as
those
expressed by some LGR4 positive tumor cells.
LGR5 is Leucine-Rich Repeat Containing G Protein-Coupled Receptor 5
Alternative names for the gene or protein are Leucine-Rich Repeat Containing G
Protein-Coupled Receptor 5; Leucine-Rich Repeat-Containing G Protein-Coupled
Receptor 5; G-Protein Coupled Receptor HG38; G-Protein Coupled Receptor 49; G-
Protein Coupled Receptor 67; GPR67; GPR49; Orphan G Protein-Coupled Receptor
HG38; G Protein-Coupled Receptor 49; GPR49; HG38 and FEX.
A protein or antibody of the invention that binds LGR5, binds human LGR5.
The LGR5 binding protein or antibody of the invention may, due to sequence and
tertiary structure similarity between human and other mammalian orthologues,
also bind such an orthologue but not necessarily so. Database accession
numbers
for the human LGR5 protein and the gene encoding it are (NC_000012.12;
NT_029419.13; NC_018923.2; NP_001264155.1; NP_001264156.1; NP_003658.1).
The accession numbers are primarily given to provide a further method of
identification of LGR5 as a target, the actual sequence of the LGR5 protein
bound
may vary, for instance because of a mutation in the encoding gene such as
those
occurring in some cancers or the like. The LGR5 antigen binding site binds
LGR5
and a variety of variants thereof, such as those expressed by some LGR5
positive
tumor cells.
ZNRF3 is Zinc And Ring Finger 3. Alternative names for the gene or protein
are Zinc And Ring Finger 3; Zinc/RING Finger Protein 3; RING Finger Protein
203;
KIAA1133; RNF203; Novel C3HC4 Type Zinc Finger (Ring Finger); E3 Ubiquitin-
Protein Ligase ZNRF3; CTA-292E10.6; EC 6.3.2.; and BK747E2.3 3.
A protein or antibody of the invention that binds ZNRF3, binds human
ZNRF3. The ZNRF3 binding protein or antibody of the invention may, due to
sequence and tertiary structure similarity between human and other mammalian
orthologues, also bind such an orthologue but not necessarily so. Database
accession numbers for the human ZNRF3 protein and the gene encoding it are
(NC_000022.11; NT_011520.13; NC_018933.2; NP_001193927.1; NP_115549.2).
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
29
The accession numbers are primarily given to provide a further method of
identification of ZNRF3 as a target, the actual sequence of the ZNRF3 protein
bound may vary, for instance because of a mutation in the encoding gene such
as
those occurring in some cancers or the like. The ZNRF3 antigen binding site
binds
ZNRF3 and a variety of variants thereof, such as those expressed by some ZNRF3
positive tumor cells
RNF43 is Ring Finger Protein 43. Alternative names for the gene or protein
are Ring Finger Protein 43; RNF124; E3 Ubiquitin-Protein Ligase RNF43; RING
Finger Protein 43; EC 6.3.2.; URCC.
A protein or antibody of the invention that binds RNF43, binds human
RNF43. The RNF43 binding protein or antibody of the invention may, due to
sequence and tertiary structure similarity between human and other mammalian
orthologues, also bind such an orthologue but not necessarily so. Database
accession numbers for the human RNF43 protein and the gene encoding it are
(NC_000017.11; NT_010783.16; NC_018928.2; NP_001292473.1; NP_001292474.1;
NP_060233.3). The accession numbers are primarily given to provide a further
method of identification of RNF43 as a target, the actual sequence of the
RNF43
protein bound may vary, for instance because of a mutation in the encoding
gene
such as those occurring in some cancers or the like. The RNF43 antigen binding
site binds RNF43 and a variety of variants thereof, such as those expressed by
some RNF43 positive tumor cells.
Reference to sequence identifiers is done to identify which protein is
targeted.
A binding molecule such as an antibody of the invention also recognizes at
least
some variants thereof such as allelic variants, splice variants and mutant
variants
thereof as long as the epitope recognized by the respective variable domain of
the
antibody has not been affected. Some of the alternative names may or may not
have also been used to refer to other proteins. The names are given for
reference
purposes only. A binding molecule such as an antibody of the invention binds
to the
protein as expressed on cells. It can also bind to variants of the protein as
long as
the epitope to which the binding molecule binds is available. Thus splicing
variants
or mutant proteins (if any) will also be bound as long as the epitope is
available.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
The fact that the binding molecule binds to the indicated protein means that
it can
bind to protein as a property and does not imply that the binding molecule is
actually bound to the target, although it can be. It also does not mean that
the
antibody does not bind to other proteins. Such cross-reactivity is at present
not
5 known for a binding molecule such as an antibody of the present
invention;
however, it is not expressly excluded that such cross-reactivity may exist.
The invention discloses a binding molecule that binds an extracellular part of
a member of the TNF receptor superfamily (first membrane protein) and an
10 extracellular part of a second membrane protein. Said second membrane
protein is
preferably not a member of the TNF receptor superfamily. Such a binding
molecule
is further also referred to as "a binding molecule of the invention". The
binding
molecule is preferably a binding protein. In a preferred embodiment the
binding
molecule is an antibody or a variant thereof, preferably a bispecific antibody
or a
15 variant thereof. Also provided are compositions and kits of parts
comprising two or
more binding molecules as described herein.
A binding molecule of the invention is preferably an antibody (or variant
thereof as described elsewhere in the application), an antibody mimetic, a
20 polypeptide, an aptamer or a combination thereof. These proteins or
aptamers
typically bind to one target. The binding molecule of the invention binds to
two or
more targets. The binding molecule preferably binds two targets. A variant of
an
antibody or bispecific antibody maintains this aspect. Binding proteins or
aptamers
have binding sites (antigen binding sites) with which targets are bound. The
25 binding protein or aptamer preferably comprises two or more domains that
preferably have a binding site for the target (antigen), preferably one
binding site
per domain. Such domains are preferably antibody variable domains or variants
thereof. Antibody variable domains have been the subject of a lot of research.
Many
variants are made that resemble variable domains or parts thereof that retain
the
30 binding specificity of a normal variable domain. Non-limiting examples
of such
variants are described elsewhere herein.
It is to be understood that any combination of these antibodies, antibody
mimetics, polypeptides and aptamers can be linked together by methods known in
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
31
the art. For example, in some embodiments the binding molecule of the
invention is
a conjugate or a fusion protein. For antibodies the technology of making multi-
specific antibodies has progressed to also include bispecific antibodies that
have the
same overall structure as a normal mono-specific antibody but wherein the two
arms of the antibody each bind a different target.
An antibody mimetic is a polypeptide that, like antibodies, can specifically
bind an antigen, but that is not structurally related to antibodies. Antibody
mimetics are usually artificial peptides or proteins with a molar mass of
about 3 to
20 kDa. Common advantages over antibodies are better solubility, tissue
penetration, stability towards heat and enzymes, and comparatively low
production
costs. Non-limiting examples of antibody mimetics are affibody molecules
(typically
based on the Z domain of Protein A); affilins (typically based on Gamma-B
crystalline or Ubiquitin); affimers (typically based on Cystatin); affitins
(typically
based on Sac7d from Sulfolobus acidocaldarius); alphabodies (typically based
on
Triple helix coiled coil); anticalins (typically based on Lipocalins); avimers
(typically based on A domains of various membrane receptors); DARPins
(typically
based on ankyrin repeat motif); fynomers (typically based on SH3 domain of Fyn
7); kunitz domain peptides (typically based on Kunitz domains of various
protease
inhibitors); and monobodies (typically based on type III domain of
fibronectin).
Monobodies are synthetic binding proteins that are constructed using a
fibronectin type III domain (FN3) as a molecular scaffold. Monobodies are
simple
and robust alternative to antibodies for creating target-binding proteins. The
term
"monobody" was coined in 1998 by the Koide group who published the first paper
demonstrating the monobody concept using the tenth FN3 domain of human
fibronectin.
Monobodies and other antibody mimetics are typically generated from
combinatorial libraries in which portions of the scaffold are diversified
using
molecular display and directed evolution technologies such as phage display,
mRNA display and yeast surface display. A large number of antibody mimetics
have high affinity and high specificity to their respective targets.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
32
Aptamers are oligonucleotide or peptide molecules that bind to a specific
target molecule. Aptamers are usually created by selecting them from a large
random sequence pool, but natural aptamers also exist in riboswitches.
Aptamers
can be used for both basic research and clinical purposes as macromolecules.
As used herein, the term "conjugate" refers to two or more molecules that
have been covalently joined, optionally by a linking region. For example, in
some
embodiments, a conjugate is a first protein or non-protein moiety joined to a
second
protein or non-protein moiety by a linking region. For example, in some
embodiments of a binding molecule of the invention it comprises or consists of
two
or more antibodies that have been covalently joined. A conjugate is not
limited to a
first and second moiety but in some embodiments may also have a third, fourth
or
more moieties joined by further linking regions. As described elsewhere in
this
application, examples of protein moieties include, but are not limited to: a
polypeptide, a peptidomimetic or an antibody (or antibody part, derivative, or
analogue, as described elsewhere in the application). Examples of non-protein
moieties include, but are not limited to aptamers. Numerous types of linker
can be
used, and the linker will be selected to be appropriate according to the
molecule
types in the conjugate and on the desired properties of the linker (length,
flexibility, resistance to protease activity and other similar
characteristics). Such
linkers may comprise nucleotides, polypeptides, or a suitable synthetic
material.
For example, a linker may be a flexible peptide linker. In certain
embodiments, the
linker may be a cleavable linker, allowing the parts of the conjugate to be
separated from each other. In other embodiments, a peptide linker might be a
helical linker. Various examples and kits for linking proteins and other
molecules
are known in the art. As used herein, the term "fusion protein" refers to a
protein
that comprises two or more polypeptides or proteins that have been joined at
the
DNA level by recombination and are expressed together as a single polypeptide.
A
fusion protein may also comprise a peptide linking region also encoded by the
DNA
and expressed together with the fusion protein. A peptide linker that is part
of a
fusion protein may be designed to have particular characteristics such as
flexibility, hydrophilicity, protease-resistance, cleavability etc. All these
properties
can be designed within the DNA sequence and methods for designing linkers are
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
33
well known in the art. For example, antibodies can be linked together by
methods
well-known in the art, and as described herein, to form bispecific or multi-
targeting
antibodies. Furthermore, bispecific antibodies can be constructed by various
methods known in the art, for example, by using technology such as Biclonics
(see
for instance WO 2013/157954). A bispecific monoclonal antibody (BsMAb, BsAb)
typically comprises binding domains of two different monoclonal antibodies and
consequently binds to two different epitopes. Biclonics molecules, but also
other
full length IgG bispecific antibodies have two different antigen binding
specificities
encoded by two different variable regions of a full length IgG molecule of a
Fab of a
scFv. Biclonics can be produced by co-transfection of individual cells with
genetic
constructs encoding two different common light chain (cLC) antibodies as
detailed
elsewhere herein. CH3 engineering ensures efficient hetero-dimerization and
formation of essentially pure bispecific antibodies.
A binding molecule of the invention is preferably an antibody or variant
thereof. A binding molecule of the invention is preferably a bispecific
antibody or a
variant thereof.
Antibodies typically bind their target via the so-called antigen binding site.
An unmodified antigen-binding site is typically formed by and present in the
variable domain of the antibody. The variable domain contains said antigen-
binding site. A variable domain that binds an antigen is a variable domain
comprising an antigen-binding site that binds the antigen.
In one embodiment an antibody variable domain comprises a heavy chain
variable region (VH) and a light chain variable region (VL). The antigen-
binding
site can be present in the combined VH/VL variable domain, or in only the VH
region or only the VL region. When the antigen-binding site is present in one
of the
two regions of the variable domain, the counterpart variable region can
contribute
to the folding and/or stability of the binding variable region, but does not
significantly contribute to the binding of the antigen itself.
As used herein, antigen-binding refers to the typical binding capacity of an
antibody to its antigen. Binding of an antibody to an antigen can be assessed
in
various ways. One way is to incubate the antibody with the antigen (preferably
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
34
cells expressing the antigen), removing unbound antibody (preferably by a wash
step) and detecting bound antibody by means of a labeled antibody that binds
to
the bound antibody.
Antigen binding by an antibody is typically mediated through the
complementarity determining regions (CDR) of the antibody and the specific
three-
dimensional structure of both the antigen and the variable domain allowing
these
two structures to bind together with precision (an interaction similar to a
lock and
key), as opposed to random, non-specific sticking of proteins. As an antibody
typically recognizes part of an antigen called the epitope of an antigen, and
as such
epitope may be present in other compounds as well, antibodies according to the
present invention may recognize other proteins as well, if such other
compounds
contain the same epitope. Hence, the term "binding" does not exclude binding
of the
antibodies to another protein or protein(s) that contain the same epitope.
Such
other protein(s) is preferably not a human protein.
A protein of the invention such as an antibody typically does not bind to
other
proteins than the specified target protein on the membrane of cells in a post-
natal,
preferably adult human.
The term "antibody" as used herein means a proteinaeeous molecule,
preferably belonging to the immunoglobulin class of proteins, containing one
or
more variable domains that bind an epitope on an antigen, where such domains
are
derived from or share sequence homology with the variable domain of an
antibody.
Antibodies for therapeutic use are preferably as close to natural antibodies
of the
subject to be treated as possible (for instance human antibodies for human
subjects). Antibody binding can be expressed in terms of specificity and
affinity.
The specificity determines which antigen or epitope thereof is specifically
bound by
the binding domain. The affinity is a measure for the strength of binding to a
particular antigen or epitope. Preferably the affinity of the separate arms of
the
antibodies according to the invention is in the nanomolar range. Antibodies
such as
the bispecific antibodies of the present invention typically comprise the
constant
domains (Fe part) of a natural antibody, which may be engineered as described
elsewhere herein, for instance to reduce ADCC and/or CDC activity. An antibody
of
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
the invention is typically a bispecific full length antibody, preferably of
the human
IgG subclass.
The terms 'variable domain', `VHNL pair', `VH/VL' are used herein
5 .. interchangeably. A variable domain is composed of the variable region of
a heavy
chain and a variable region of a light chain. The variable region of a heavy
chain is
typically formed by a rearranged VW region. A variable region of a light chain
is
typically formed by a rearranged VJ region. The VDJ/VJ regions can now also be
artificially produced using for instance the large body of sequence
information that
10 is available of functional antibodies.
In some embodiments a binding molecule or antibody or variant according to
the invention comprises an antigen binding site that can bind an extracellular
part
of a member of the TNF receptor superfamily and an antigen binding site that
can
15 bind a member of the B7 family. In some embodiments a binding molecule
or
antibody or variant according to the invention comprises an antigen binding
site
that can bind an extracellular part of CD137 and an antigen binding site that
can
bind a member of the B7 family. In some embodiments a binding molecule or
antibody or variant according to the invention comprises an antigen binding
site
20 that can bind CD137 and an antigen binding site that can bind PD-Li.
In some embodiments, a binding molecule or antibody or variant according to
the invention has no more than two antigen binding sites. This means that the
antigen binding part of such binding molecule or antibody or variant consists
of two
25 .. antigen binding sites, without the presence of additional antigen
binding sites.
Each of the two antigen binding sites preferably contains an immunoglobulin
VH/VL pair. Preferably, the antigen binding part of a binding molecule or
antibody
or variant of the invention consists of one immunoglobulin variable domain
that
can bind an extracellular part of a member of the TNF receptor superfamily and
30 one immunoglobulin variable domain that can bind a second membrane
protein.
Certain preferred embodiments are immunoglobulins having an IgG format,
providing the advantage that the half-lives of bivalent binding
molecules/antibodies/variants according to the invention are typically longer
as
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
36
compared to multivalent compounds. Moreover, the immunogenicity of bivalent
binding molecules according to the invention is typically lower as compared to
multivalent compounds. Molecules/antibodies/variants according to these
embodiments preferably maintain the structure of natural IgGs and therefore
maintain all benefits associated to that structure of natural IgGs.
As used herein, the term "multivalent" embraces three or more specificities,
which is for instance present in trivalent and tetravalent binding molecules.
Some embodiments provide a binding molecule or antibody or variant
according to the invention wherein the antigen binding sites of said binding
molecule or antibody or variant consist of one antigen binding site that can
bind an
extracellular part of a member of the TNF receptor superfamily and one antigen
binding site that can bind a member of the B7 family. In some embodiments the
.. antigen binding sites of said binding molecule or antibody or variant
according to
the invention consist of one antigen binding site that can bind an
extracellular part
of CD137 and one antigen binding site that can bind a member of the B7 family.
In
some embodiments the antigen binding sites of said binding molecule or
antibody
or variant according to the invention consist of one antigen binding site that
can
bind CD137 and one antigen binding site that can bind PD-Li.
As used herein, the term "antigen binding site" means a site of a binding
molecule or antibody that specifically binds an epitope of an antigen. Such
antigen
binding site is preferably derived from or shares sequence homology with the
variable domain of an antibody, in particular the CDR regions thereof. In some
preferred embodiments, said antigen binding site is an immunoglobulin variable
domain, formed by an immunoglobulin VH/VL pair. In other embodiments, said
antigen binding site is derived from an antibody mimetic, such as for instance
from
an affibody molecule, affilin , affimer, affitin, alphabody, anticalin,
avimer,
DARPin, fynomer, kunitz domain peptide or monobody, which are described herein
before.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
37
An antibody of the invention is preferably a "full length" antibody. The term
Tull length' according to the invention is defined as comprising an
essentially
complete antibody, without one or more artificially added moieties with a size
of
larger than 20 amino acid residues, such as for instance additional antigen
binding
.. sites or additional activation sites or additional ligands or additional
ligand-
binding moieties. A full length antibody however does not necessarily have all
functions of an intact antibody. For the avoidance of doubt, a full length
antibody
contains two heavy and two light chains. Each chain contains constant (C) and
variable (V) regions, which can be broken down into domains designated CH1,
CH2, CH3, VH for the heavy chain, and CL, VL for the light chain. The domains
of
the heavy chains are preferably present in the order of a natural antibody (VH-
CH1-CH2-CH3; meaning that the VH domain is adjacent to the CH1 domain,
followed by a CH2 domain and subsequently followed by a CH3 domain). The
domains of the light chains are also preferably present in the order of a
natural
antibody (VL-CL; meaning that the VL domain is adjacent to the CL domain). An
antibody binds to antigen via the variable domains contained in the Fab
fragment
portion. The antibody can interact with molecules and cells of the immune
system
through the constant domains, mostly through the Fe portion. In some
embodiments, an antibody of the invention is an Igo, preferably a full length
IgG.
Full length IgG antibodies are preferred because of their typically favorable
half-
life and the desire to stay as close to fully autologous (human) molecules for
reasons of immunogenicity. In some embodiments, an antibody of the invention
is a
full length IgGl, a full length IgG2, a full length IgG3 or a full length IgG4
antibody.
Full length antibodies according to the invention encompass antibodies
wherein mutations may be present that provide desired characteristics or are
just
alternatives to the ones in the original chain. Such mutations should not be
deletions of substantial portions of any of the regions. However, antibodies
wherein
one or several amino acid residues are acid inserted, deleted, substituted or
a
combination thereof, without essentially altering the antigen binding
characteristics of the resulting antibody are embraced within the term "full
length
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
38
antibody". For instance, an IgG antibody can have 1-20 amino acid residue
insertions, substitutions, deletions or a combination thereof in the constant
region.
An antibody or a functional part, derivative and/or analogue thereof of the
invention is preferably a bispecific antibody or a functional part, derivative
and/or
analogue thereof. In a preferred embodiment it is a bispecific IgG antibody
with
reduced effector function. In a preferred embodiment an antibody of the
invention
is a bispecific full length antibody. An antibody of the invention is
preferably a
bispecific full length IgG antibody, preferably mutated in the CH2/lower hinge
region to reduce effector function. IgG1 which is mutated in the CH2/lower
hinge
region to reduce effector function is favored based on its long circulatory
half-life in
man. In order to prevent any immunogenicity in humans it is preferred that the
bispecific antibody according to the invention is a human antibody.
The term `bispecific' (bs) means that one part of the antibody (as defined
above) binds to one epitope on an antigen whereas a second part binds to a
different epitope on either the same antigen, or a different antigen. The
different
epitopes are typically present on different antigens. The different epitopes
can,
however, also be present on the same antigen. According to the present
invention,
said first and second antigens are in fact two different proteins. A preferred
bispecific antibody is an antibody that comprises parts of two different
monoclonal
antibodies and consequently can bind to two different epitopes, preferably on
two
different antigens. Dependent on the expression level, (sub-)cellular
localization
and stoichiometry of the two antigens recognized by a bispecific antibody,
both Fab
arms of the antibody may or may not simultaneously bind their epitope. One arm
of
the bispecific antibody typically contains the variable domain of one antibody
and
the other arm contains the variable domain of another antibody (i.e. one arm
of the
bispecific antibody is formed by one heavy chain paired with one light chain
whereas the other arm is formed by a different heavy chain paired with a light
chain). The heavy chain variable regions of the bispecific antibody of the
invention
are typically different from each other, whereas the light chain variable
regions are
preferably the same in the bispecific antibodies of the invention. A
bispecific
antibody wherein the different heavy chain variable regions are associated
with the
same or a common, light chain variable region is also referred to as a
bispecific
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
39
antibody with a common light chain variable region (cLcv). It is preferred
that the
light chain constant region is also the same. Such bispecific antibodies are
referred
to as having a common light chain (cLc). Further provided is therefore a
bispecific
antibody according to the invention, wherein both arms comprise a common light
chain.
Bispecific antibodies as described herein preferably comprise a common
light chain variable domain, preferably a common light chain. The term 'common
light chain' according to the invention refers to light chains which may be
identical
or have some amino acid sequence differences while the binding specificity of
the
full length antibody is not affected. It is for instance possible within the
scope of
the definition of common light chains as used herein, to prepare or find light
chains
that are not identical but still functionally equivalent, e.g., by introducing
and
testing conservative amino acid changes, changes of amino acids in regions
that do
not or only partly contribute to binding specificity when paired with the
heavy
chain, and the like. The terms 'common light chain', 'common LC', 'cLC',
'single
light chain' with or without the addition of the term 'rearranged' are all
used
herein interchangeably. The terms 'common light chain variable region',
'common
VL', 'common LCv', 'eLCv' , 'single VL' with or without the addition of the
term
'rearranged' are all used herein interchangeably. It is a preferred aspect of
the
present invention that a bispecific antibody has a common light chain
(variable
region) that can combine with at least two, and preferably a plurality of
heavy
chains (variable regions) of different binding specificity to form antibodies
with
functional antigen binding domains (W02004/009618, W02009/157771). The
common light chain (variable region) is preferably a human light chain
(variable
region). A common light chain (variable region) preferably has a germline
sequence. A preferred germline sequence is a light chain variable region that
is
frequently used in the human repertoire and has good thermodynamic stability,
yield and solubility. A preferred germline light chain is 012. A common light
chain
is preferably the rearranged germline human kappa light chain IgVx1-
39*01/IGJx1*01 (Figure 1A). The common light chain variable region is
preferably
the variable region of the rearranged germline human kappa light chain IgVx1-
39*01/ICJK1*01. A common light chain preferably comprises a light chain
variable
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
region as depicted in figure 1B, or 111) with 0-5 amino acid insertions,
deletions,
substitutions, additions or a combination thereof. The common light preferably
further comprises a light chain constant region, preferably a kappa light
chain
constant region. A nucleic acid that encodes the common light chain can be
codon
5 optimized for the cell system used to express the common light chain
protein. The
encoding nucleic acid can deviate from a germ-line nucleic acid sequence.
In a preferred embodiment the light chain comprises a light chain region
comprising the amino acid sequence of an 012 / IgVx1-39*01 gene segment as
10 depicted in figure 1A with 0-10, preferably 0-5 amino acid insertions,
deletions,
substitutions, additions or a combination thereof. The phrase "012 light
chain" will
be used throughout the specification as short for "a light chain comprising a
light
chain variable region comprising the amino acid sequence of an 012 / IgVx1-
39*01
gene segment as depicted in figure 1A with 0-10, preferably 0-5 amino acid
15 insertions, deletions, substitutions, additions or a combination
thereof. IgVx1-39 is
short for Immunoglobulin Variable Kappa 1-39 Gene. The gene is also known as
Immunoglobulin Kappa Variable 1-39; IGKV139; IGKV1-39; 012a or 012.
External Ids for the gene are HGNC: 5740; Entrez Gene: 28930; Ensembl:
ENSG00000242371. A preferred amino acid sequence for IgVx1-39 is given in
20 figure 1E. This lists the sequence of the V-region. The V-region can be
combined
with one of five J-regions. Figure 1B and 111) describe two preferred
sequences for
IgVx1-39 in combination with a J-region. The joined sequences are indicated as
IGKV1-39/jkl and IGKV1-39/jk5; alternative names are IgVx1-39*01/IGJx1"01 or
IgVx1-39*01/IGJK5*01 (nomenclature according to the IMGT database worldwide
25 web at imgt.org).
It is preferred that the 012 I IgVx1-39*01 comprising light chain variable
region is a germline sequence. It is further preferred that the IGJK1*01 or
/IGJK5*01 comprising light chain variable region is a germline sequence. In a
preferred embodiment, the IGKV1-39/jk1 or IGKV1-39/jk5 light chain variable
30 regions are germline sequences.
In a preferred embodiment the light chain variable region comprises a
germline 012 I IgVx1-39*01. In a preferred embodiment the light chain variable
region comprises the kappa light chain IgVx1-39*01/IGJK1*01 or Ig
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
41
39*01/I GJK5* 01. In a preferred embodiment a IgVK1-39*01/IGJK1*01. The light
chain variable region preferably comprises a germline kappa light chain IgVK1-
39*01/IGJK1*01 or germline kappa light chain IgVK1-39*01/IGJK5*01, preferably
a
germline IgVK1-39*01/IGTK1*01.
Mature B-cells that produce an antibody with an 012 light chain often
produce a light chain that has undergone one or more mutations with respect to
the germline sequence, i.e. the normal sequence in non-lymphoid cells of the
organism. The process that is responsible for these mutations is often
referred to as
somatic (hyper)mutation. The resulting light chain is referred to as an
affinity
matured light chain. Such light chains, when derived from an 012 germline
sequence are 012-derived light chains. In this specification, the phrase "012
light
chains" will include 012-derived light chains. The mutations that are
introduced by
somatic hypermutation can of course also be introduced artificially in the
lab. In
the lab also other mutations can be introduced without affecting the
properties of
the light chain in kind, not necessarily in amount. Alight chain is at least
an 012
light chain if it comprises a sequence as depicted in figure 1A, figure 1B;
figure 1D
or figure 1E with 0-10, preferably 0-5 amino acid insertions, deletions,
substitutions, additions or a combination thereof. In a preferred embodiment
the
012 light chain is a light chain comprising a sequence as depicted in figure
1A; 1B;
1D or 1E with 0-9, 0-8, 0-7, 0-6, 0-5, 0-4 amino acid insertions, deletions,
substitutions, additions or a combination thereof. In a preferred embodiment
the
012 light chain is a light chain comprising a sequence as depicted in figure
1A,
figure 1B; figure 1D or figure 1E with 0-5, preferably 0-4, more preferably 0-
3
amino acid insertions, deletions, substitutions, additions or a combination
thereof.
In a preferred embodiment the 012 light chain is a light chain comprising a
sequence as depicted in figure 1A, figure 1B; figure 111) or figure 1E with 0-
2, more
preferably 0-1, most preferably 0 amino acid insertions, deletions,
substitutions,
additions or a combination thereof. In a preferred embodiment the 012 light
chain
is a light chain comprising a sequence as depicted in figure 1A or figure 1B
with
the mentioned amino acid insertions, deletions, substitutions, additions or a
combination thereof. In a preferred embodiment the light chain comprises the
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
42
sequence of figure 1A. In a preferred embodiment the light chain variable
region
comprises the sequence of figure 1B.
The common light chain (variable region) can be a lambda light chain and
this is therefore also provided in the context of the invention, however a
kappa
light chain is preferred. The constant part of a common light chain of the
invention
can be a constant region of a kappa or a lambda light chain. It is preferably
a
constant region of a kappa light chain, preferably wherein said common light
chain
is a germline light chain, preferably a rearranged germline human kappa light
chain comprising the IgVK1-39 gene segment, most preferably the rearranged
germline human kappa light chain IgVK1-39*01/IGJK1*01 (Figure 1). The terms
rearranged germline human kappa light chain IgV1[1-39*01/IGTK1*01, RAVI-
39/IGKJ1, huVK1-39 light chain or in short huVK1-39, or simply 1-39 are used
interchangeably throughout the application. Obviously, those of skill in the
art will
recognize that "common" also refers to functional equivalents of the light
chain of
which the amino acid sequence is not identical. Many variants of said light
chain
exist wherein mutations (deletions, substitutions, additions) are present that
do
not influence the formation of functional binding regions.
IgVK1-39 is short for Immunoglobulin Variable Kappa 1-39 Gene. The gene
is also known as Immunoglobulin Kappa Variable 1-39; IGKV139; IGKV1-39; 012a
or 012. External Ids for the gene are HGNC: 5740; Entrez Gene: 28930; Ensembl:
ENSG00000242371. A preferred amino acid sequence for IgVK1-39 is given in
figure 1. This lists the sequence of the V-region. The V-region can be
combined with
one of five J-regions. Figure 1 describes two preferred sequences for IgVK1-39
in
combination with a J-region. The joined sequences are indicated as IGKV1-
39/jkl
and IGKV1-39/jk5; alternative names are IgVK1-39*01/IGJK1*01 or IgVK1-
39*01/IGJK5*01 (nomenclature according to the IMGT database worldwide web at
imgt.org).
A common light chain variable region is preferably linked to a kappa light
chain constant region. In a preferred embodiment the light chain comprises the
kappa light chain IgVK1-39"01/IGJK1*01 or IgVK1-39*01/IGJK5"01. In a preferred
embodiment a IgVK1-39*01/IGJK1*01.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
43
A cell that produces a common light chain can produce for instance
rearranged germline human kappa light chain IgVii1-39*01/IGJK1*01 and a light
chain comprising the variable region of the mentioned light chain fused to a
lambda constant region.
Bispecific antibodies or variants thereof as described herein preferably have
one heavy chain variable region/light chain variable region (VH/VL)
combination
that binds an extracellular part of a member of the TNF receptor superfamily
and
a second VH/VL combination that binds an extracellular part of a second
membrane protein, wherein said second membrane protein is not a member of the
TNF receptor superfamily.
Bispecific antibodies or variants thereof as described herein preferably have
one heavy chain variable region/light chain variable region (VH/VL)
combination
that binds an extracellular part of a member of the TNF receptor superfamily
and
a second VH/VL combination that binds an extracellular part of a member of the
B7 family. As described herein, this provides the advantage that a desired
immune
response can be particularly well promoted, since B7 family members deliver
'costimulatory' or 'coinhibitory' signals to lymphocytes, thereby augmenting
or
attenuating an immune response. Hence, by targeting a member of the B7 family
it
is possible to enhance stimulatory signals and/or to counteract inhibitory
signals,
thereby inducing or enhancing a desired immune response, for instance against
aberrant cells.
In a preferred embodiment the VL in said first VH/VL combination is similar
to the VL in said second VH/VL combination. In a more preferred embodiment,
the
VLs in the first and second VH/VL combinations are identical. In a preferred
embodiment, the bispecific antibody is a full length antibody which has one
heavy/light (H/L) chain combination that binds an extracellular part of a
member
of the TNF receptor superfamily and one H/L chain combination that binds an
extracellular part of a member of the B7 family. In a preferred embodiment the
light chain in said first H/L chain combination is similar to the light chain
in said
second H/L chain combination. In a more preferred embodiment, the light chains
in
the first and second H/L chain combinations are identical.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
44
Several methods have been published to favor the production of the
bispecific antibody or vice versa, the monospecific antibodies. In the present
invention it is preferred that the cell favors the production of the
bispecific
antibody over the production of the respective monospecific antibodies. Such
is
typically achieved by modifying the constant region of the heavy chains such
that
they favor heterodimerization (i.e. dimerization with the heavy chain of the
other
heavy/light chain combination) over homodimerization. In a preferred
embodiment
the bispecific antibody of the invention comprises two different
immunoglobulin
heavy chains with compatible heterodimerization domains. Various compatible
heterodimerization domains have been described in the art. The compatible
heterodimerization domains are preferably compatible immunoglobulin heavy
chain CH3 heterodimerization domains. When wildtype CH3 domains are used, co-
expression of two different heavy chains (A and B) and a common light chain
will
result in three different antibody species, AA, AB and BB. AA and BB are
designations for the two mono-specific, bivalent antibodies, and AB is a
designation
for the bispecific antibody. To increase the percentage of the desired
bispecific
product (AB) CH3 engineering can be employed, or in other words, one can use
heavy chains with compatible hetero-dimerization domains, as defined
hereunder.
The art describes various ways in which such hetero-dimerization of heavy
chains
can be achieved. One way is to generate 'knob into hole' bispecific
antibodies. See
US Patent Application 20030078385 (Arathoon et al.).
The term 'compatible hetero-dimerization domains' as used herein refers to
protein domains that are engineered such that engineered domain A' will
preferentially form heterodimers with engineered domain B' and vice versa,
homo-
dimerization between A'-A' and B'-B' is diminished.
In US13/866,747 (now issued as US 9,248,181), US14/081,848 (now issued
as US 9,358,286) and PCT/NL2013/050294 (published as W02013/157954);
incorporated herein by reference) methods and means are disclosed for
producing
bispecific antibodies using compatible heterodimerization domains. These means
and methods can also be favorably employed in the present invention.
Specifically,
a bispecific antibody of the invention preferably comprises mutations to
produce
essentially only bispecific full length IgG molecules. Preferred mutations are
the
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
amino acid substitutions L351K and T366K (EU numbering) in the first CH3
domain (the 'KK-variant' heavy chain) and the amino acid substitutions L351D
and
L368E in the second domain (the DE-variant' heavy chain), or vice versa. It
was
previously demonstrated in our US 9,248,181 and US 9,358,286 patents as well
as
5 the W02013/157954 PCT application that the DE-variant and KK-variant
preferentially pair to form heterodimers (so-called `DEKK' bispecific
molecules).
Homodimerization of DE-variant heavy chains (DEDE homodimers) hardly occurs
due to repulsion between the charged residues in the CH3-CH3 interface between
identical heavy chains.
Bispecific antibodies can be generated by (transient) transfection of a
plasmid
or plasmids encoding a light chain and two different heavy chains that are CH3
engineered to ensure efficient hetero-dimerization and formation of the
bispecific
antibodies. The production of these chains in a single cell leads to the
favored
formation of bispecific antibodies over the formation of monospecific
antibodies.
Preferred mutations to produce essentially only bispecific full length IgG1
molecules are amino acid substitutions at positions 351 and 366, e.g. L351K
and
T366K (numbering according to EU numbering) in the first CH3 domain (the 'KK-
variant' heavy chain) and amino acid substitutions at positions 351 and 368,
e.g.
L351D and L368E in the second CH3 domain (the 'DE-variant' heavy chain), or
vice versa.
In one embodiment the heavy chain/light chain combination that comprises
the variable domain that binds CD137, comprises a DE variant of the heavy
chain.
In this embodiment the heavy chain/light chain combination that comprises the
variable domain that can bind to an antigen other than CD137 comprises a KK
variant of the heavy chain. It will be recognized that an embodiment of the
invention may also comprise a variable domain that binds CD137, and comprises
a
KK variant of the heavy chain, as well as other variations known to those of
skill in
the art used to facilitate heterodimerization with a variable domain that can
bind
to an antigen other than CD137.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
46
The Fe region mediates effector functions of an antibody, such as
complement-dependent eytotoxicity (CDC), antibody-dependent cellular
cytotoxieity
(ADCC) and antibody-dependent cell phagocytosis (ADCP). Depending on the
therapeutic antibody or Fe fusion protein application, it may be desired to
either
.. reduce or increase the effector function. Reduced effector functions are
preferred in
the present invention. Reduced effector function can be desired when an immune
response is to be activated, enhanced or stimulated as in some of the
embodiments
of the invention. Antibodies with reduced effector functions can be used to
target
cell-surface molecules of immune cells, among others.
Binding of IgG to the FcyRs or C1q was found to require residues located in
the hinge region and the CH2 domain. Two regions of the CH2 domain (Figure
211))
are relevant for FeyRs and C1q binding. Substitutions into human IgG1 of IgG2
residues at positions 233-236 and IgG4 residues at positions 327, 330 and 331
were
shown to greatly reduce ADCC and CDC (Armour et al., 1999. Eur J Immunol.
29(8):2613-24; Shields et al., 2001. J Biol Chem. 276(9):6591-604).
Furthermore,
Idusogie et al. demonstrated that alanine substitution at different positions,
including K322, significantly reduced complement activation (Idusogie et al.,
2000.
Immunol. 164(8):4178-84.
Due to their reduced effector functions, IgG4 antibodies represent an IgG
subclass for receptor blocking without cell depletion. IgG4 molecules can
exchange
half-molecules in a dynamic process termed Fab-arm exchange. This phenomenon
can occur between therapeutic antibodies and endogenous IgG4. The 5228P
mutation is an example of a mutation that ensures reduced capacity to Fab-arm
exchange. (Labrijn. et al., 2009. Nat Biotechnol. 27(8):767-71.
Antibodies with reduced effector functions are preferably IgG antibodies
comprising a modified CH2/lower hinge region, for instance to reduce Fe-
receptor
.. interaction or to reduce Clq binding. In some embodiments the antibody of
the
invention is an IgG antibody with a mutant CH2 and/or lower hinge domain such
that interaction of the bispecific IgG antibody to an Fe-gamma receptor is
reduced.
An antibody comprising a mutant CH2 region is preferably an IgG1 antibody.
Such
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
47
a mutant IgG1 CH2 and/or lower hinge domain preferably comprise an amino
substitution at position 235 and/or 236 (EU numbering), preferably an L235G
and/or G236R substitution (Figure 2E).
A variant of an antibody or bispecific antibody as described herein comprises
a functional part, derivative and/or analogue of the antibody or bispecific
antibody.
The variant maintains the binding specificity of the (bispecific) antibody.
The
functional part, derivative and/or analogue maintains the binding specificity
of the
(bispecific) antibody. Binding specificity is defined by capacity to bind an
extracellular part of a first membrane protein and a second membrane protein
as
described herein.
A functional part of an antibody, or preferably a functional part of a
bispecific
antibody as described herein is a part comprising a variable domain that binds
an
extracellular part of a member of the TNF receptor superfamily and a variable
domain that an extracellular part of said second membrane protein. A suitable
part
is thr instance an F(ab')2 fragment as created by digestion of a bispecific
antibody
with pepsin. Other parts comprising said variable domains are included in the
present invention.
A functional derivative of an antibody, or preferably a functional derivative
of
a bispecific antibody as described herein is a protein comprising a variable
domain
that binds an extracellular part of a member of the TNF receptor superfamily
and
a variable domain that binds an extracellular part of said second membrane
protein that are linked by a linker. The variable domains may be variable
domains
as such, or Fab fragments or variable domain like molecules such as single
chain
Fv fragments comprising a VH and a VL linked together via a linker. Other
examples of variable domain like molecules are so-called single domain
antibody
fragment. A single-domain antibody fragment (sdAb) is an antibody fragment
with
a single monomeric variable antibody region. Like a whole antibody, it is able
to
bind selectively to a specific antigen. With a molecular weight of only 12-15
kDa,
single-domain antibody fragments are much smaller than common antibodies (150-
160 kDa) which are composed of two heavy protein chains and two light chains,
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
48
and even smaller than Fab fragments (-50 kDa, one light chain and half a heavy
chain) and single-chain variable fragments (-25 kDa, two variable regions, one
from a light and one from a heavy chain). Single-domain antibodies by
themselves
are not much smaller than normal antibodies (being typically 90-100kDa).
Single-
domain antibody fragments are mostly engineered from heavy-chain antibodies
found in camelids; these are called VHH fragments (Nanobodies*). Some fishes
also
have heavy-chain only antibodies (IgNAR, 'immunoglobulin new antigen
receptor'),
from which single-domain antibody fragments called VNAR fragments can be
obtained. An alternative approach is to split the dimeric variable domains
from
common immunoglobulin G (IgG) from humans or mice into monomers. Although
most research into single-domain antibodies is currently based on heavy chain
variable domains, nanobodies derived from light chains have also been shown to
bind specifically to target epitopes. Other non-limiting examples of variable
domain-like molecules are VHH, Human Domain Antibodies (dAbs) and Unibodies.
Preferred functional parts are parts that comprise variable domains comprising
a
heavy chain variable region and a light chain variable region. Non-limiting
examples of such variable domains are F(ab)-fragments and Single chain Fv
fragments. Bispecific formats for variable domain(-like) linkage are for
instance
Human Serum Albumine (HSA) bound to two different scFv: bispecific mini-
antibodies comprising two different scFv bound together via a dimerization
motifs
or self-associating secondary structures such as helix bundles or coiled coils
to
bring about dimerization of the scFv fragments (Morrison (2007) Nat.
Biotechnol
25:1233-34). Examples of suitable HSA linkers and method for coupling scFv to
the
linker are described in W02009/126920.
An antibody or functional part, derivative and/or analogue thereof or
preferably a bispecific antibody or functional part, derivative and/or
analogue
thereof of the present invention is preferably used in humans. To this end an
antibody or functional part, derivative and/or analogue thereof of the
invention is
preferably a human or humanized antibody. Tolerance of a human to a
polypeptide
is governed by many different aspects. Immunity, be it T-cell mediated, B-cell
mediated or other is one of the variables that are encompassed in tolerance of
the
human for a polypeptide. The constant region of a bispecific antibody of the
present
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
49
invention preferably comprises a human heavy chain constant region, preferably
comprising a sequence as depicted in figure 2; and a human light chain
constant
region, preferably comprising a sequence as depicted in figure 1C. The
constant
region may contain one or more, preferably not more than 10, preferably not
more
than 5 amino-acid differences with the constant region of a naturally
occurring
human antibody. It is preferred that the constant part is entirely derived
from a
naturally occurring human antibody. Various antibodies produced herein are
derived from common light chain mice immunized with the respective target as
described in W02009/157771. Various antibodies produced herein are derived
from
a human antibody variable domain library. As such these variable domains are
human. The unique CDR regions may be derived from humans, be synthetic or
derived from another organism. The variable region is at least a human
variable
region when it has, with the exception of the CDR regions, an amino acid
sequence
that is identical to an amino acid sequence of the variable region of a
naturally
occurring human antibody. In such embodiments the VH of a variable domain of
an
antibody that binds a member of the TNF receptor superfamily or membrane
associated member of the B7 family, or a light chain in an antibody of the
invention, may contain one or more, preferably not more than 10, preferably
not
more than 5 amino-acid differences with the variable region of a naturally
occurring human antibody, not counting possible differences in the amino acid
sequence of the CDR regions. Such mutations also occur in nature in the
context of
somatic hypermutation.
Antibodies may be derived from various animal species, at least with regard
.. to the heavy chain variable region. It is common practice to humanize such
e.g.
murine heavy chain variable regions. There are various ways in which this can
be
achieved among which there are CDR-grafting into a human heavy chain variable
region with a 3D-structure that matches the 3D-structure of the murine heavy
chain variable region; de-immunization of the murine heavy chain variable
region,
preferably done by removing known or suspected T- or B- cell epitopes from the
murine heavy chain variable region. The removal is typically by substituting
one or
more of the amino acids in the epitope for another (typically conservative)
amino
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
acid, such that the sequence of the epitope is modified such that it is no
longer a T-
or B-cell epitope.
De-immunized murine heavy chain variable regions are less immunogenic in
humans than the original murine heavy chain variable region. Preferably a
5 variable region or domain of the invention is further humanized, such as
for
instance veneered. By using veneering techniques, exterior residues which are
readily encountered by the immune system are selectively replaced with human
residues to provide a hybrid molecule that comprises either a weakly
immunogenic
or substantially non-immunogenic veneered surface. An animal as used in the
10 invention is preferably a mammal, more preferably a primate, most
preferably a
human.
An antibody or bispecific antibody or functional part, derivative and/or
analogue thereof according to the invention preferably comprises a constant
region
15 of a human antibody. According to differences in their heavy chain
constant
domains, antibodies are grouped into five classes, or isotypes: IgG, IgA, IgM,
IgD,
and IgE. These classes or isotypes comprise at least one of said heavy chains
that is
named with a corresponding Greek letter. In a preferred embodiment the
invention
provides an antibody according to the invention wherein said constant region
is
20 selected from the group of IgG constant regions, i.e. selected from the
group
consisting of IgGl, IgG2, IgG3 and IgG4. Preferably said constant region is an
IgG4
or IgG1 constant region (Figure 2), more preferably a mutated IgG1 constant
region. Some variation in the constant region of IgG1 occurs in nature and/or
is
allowed without changing the immunological properties of the resulting
antibody.
25 Typically between about 1-10 amino acid insertions, deletions,
substitutions or a
combination thereof are allowed in the constant region. The constant region
may be
mutated as indicated herein for enabling efficient heterodimerization, for
reducing
effector function or for other reasons including half-life, stability and the
like.
30 Rational methods have evolved toward minimizing the content of non-human
residues in the human context. Various methods are available to successfully
graft
the antigen-binding property of an antibody onto another antibody. The binding
properties of antibodies may rest predominantly in the exact sequence of the
CDR3
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
51
region, often supported by the sequence of the CDR1 and CDR2 regions in the
variable domain combined with the appropriate structure of the variable domain
as
a whole. Various methods are presently available to graft CDR regions onto a
suitable variable domain of another antibody. Some of these methods are
reviewed
in J.C. Almagrol and J. Fransson (2008) Frontiers in Bioscience 13, 1619-1633,
which is included by reference herein.
The light chain variable region of a variable domain comprising a variable
heavy chain sequence as depicted in Figure 3, is preferably a germline light
chain
of or based on 012, preferably the rearranged germline human kappa light chain
IgVK1-39*01/IGJK1*01 or a fragment or a functional derivative thereof
(nomenclature according to the IMGT database worldwide web at imgtorg). The
terms rearranged germline human kappa light chain IgVK1-39*01/IGJK1*01,
IGKV1-39/IGKJ1, huVK1-39 light chain or in short huVK1-39 are used. The light
chain can have 1, 2, 3, 4 or 5 amino acid insertions, deletions, substitutions
or
combination thereof. The mentioned 1, 2, 3, 4 or 5 amino acid substitutions
are
preferably conservative amino acid substitutions, the insertions, deletions,
substitutions or combination thereof are preferably not in the CDR3 region of
the
VL chain, preferably not in the CDR1, CDR2 or CDR3 region or FR4 region of the
VL chain. A preferred sequence for the common light chain is depicted in
figure 1.
Various methods are available to produce bispecific antibodies. One method
involves the expression of two different heavy chains and two different light
chains
in a cell and collecting antibody that is produced by the cell. Antibody
produced in
this way will typically contain a collection of antibodies with different
combinations
of heavy and light chains, some of which are the desired bispecific antibody.
The
bispecific antibody can subsequently be purified from the collection. The
ratio of
bispecific to other antibodies that are produced by the cell can be increased
in
various ways. In a preferred embodiment of the invention, the ratio is
increased by
expressing not two different light chains but two essentially identical light
chains
in the cell. The two essentially identical light chains can be light chains
with
essentially the same light chain variable regions and different light chain
constant
regions or, preferably, two essentially identical light chain constant
regions. This
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
52
concept is in the art also referred to as the "common light chain" method.
When the
essentially identical light chains work together with the two difThrent heavy
chains
allowing the formation of variable domains with different antigen-binding
sites and
concomitant different binding properties, the ratio of bispecific antibody to
other
.. antibody that is produced by the cell is significantly improved over the
expression
of two essentially different light chains. The ratio of bispecific antibody
that is
produced by the cell can be further improved by stimulating the pairing of two
different heavy chains with each other over the pairing of two identical heavy
chains. The art describes various ways in which such hetero-dimerization of
heavy
chains can be achieved. A preferred method is described in US provisional
application 61/635,935, which has been followed up by US regular application
No.
13/866,747 and PCT application No. PCT/NL2013/050294 (WO 2013/157954 Al),
which are incorporated herein by reference. Methods and means are disclosed
for
producing bispecific antibodies (from a single cell), whereby means are
provided
.. that favor the formation of bispecific antibodies over the formation of
monospecific
antibodies. These methods can also be favorably employed in the present
invention.
Thus the invention provides a method for producing a bispecific antibody
according
to the invention (from a single cell), wherein said bispecific antibody
comprises two
CH3 domains that are capable of forming an interface, said method comprising
providing in said cell a) a first nucleic acid molecule encoding a 1st CH3
domain
comprising heavy chain, 1)) a second nucleic acid molecule encoding a 2nd CH3
domain comprising heavy chain, wherein said nucleic acid molecules are
provided
with means for preferential pairing of said 1st and 2nd CH3 domain comprising
heavy chains, said method further comprising the step of culturing said host
cell
and allowing for expression of said two nucleic acid molecules and harvesting
said
bispecific antibody from the culture. Said first and second nucleic acid
molecules
may be part of the same nucleic acid molecule, vector or gene delivery vehicle
and
may be integrated at the same site of the host cell's genome. Alternatively,
said
first and second nucleic acid molecules are separately provided to said cell.
The
.. host cell comprises at least one light chain, and preferably a common light
chain.
A preferred embodiment provides a method for producing a bispecific
antibody according to the invention from a single cell, wherein said
bispecific
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
53
antibody comprises two CH3 domains that are capable of forming an interface,
said
method comprising providing:
- a cell having a) a first nucleic acid molecule encoding a heavy chain
comprising an antigen binding site that can bind to an extracellular part of a
membrane associated member of the TNF receptor superfamily and that contains a
1st CH3 domain, and b) a second nucleic acid molecule encoding a heavy chain
comprising an antigen-binding site that can bind to an extracellular part of a
membrane associated second protein and that contains a 2nd CH3 domain, wherein
said nucleic acid molecules are provided with means for preferential pairing
of said
1st and 2nd CH3 domains,
said method further comprising the step of culturing said cell and allowing
for expression of the proteins encoded by said two nucleic acid molecules and
harvesting said bispecific IgG antibody from the culture. In a particularly
preferred
embodiment, said cell also has a third nucleic acid molecule encoding a common
light chain. Said first, second and third nucleic acid molecule may be part of
the
same nucleic acid molecule, vector or gene delivery vehicle and may be
integrated
at the same site of the host cell's genome. Alternatively, said first, second
and third
nucleic acid molecules are separately provided to said cell. A preferred
common
light chain is based on 012, preferably it is the rearranged germline human
kappa
light chain IgVK1 39*01/IGTK1*01, as described above. Means for preferential
pairing of said 1st and said 2nd CH3 domain are preferably the corresponding
mutations in the CH3 domain of the heavy chain coding regions. The preferred
mutations to produce essentially only bispecific antibodies are the amino acid
substitutions L351K and T366K (numbering according to EU numbering) in the
first CH3 domain and the amino acid substitutions L351D and L368E in the
second
CH3 domain, or vice versa (Figure 2). Further provided is therefore a method
according to the invention for producing a bispecific antibody, wherein said
first
CH3 domain comprises the amino acid substitutions L351K and T366K (numbering
according to EU numbering) and wherein said second CH3 domain comprises the
amino acid substitutions L351D and L368E, said method further comprising the
step of culturing said cell and allowing for expression of proteins encoded by
said
nucleic acid molecules and harvesting said bispecific antibody from the
culture.
Also provided is a method according to the invention for producing a
bispecific
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
54
antibody, wherein said first CH3 domain comprises the amino acid substitutions
L351D and L368E (numbering according to EU numbering) and wherein said
second CH3 domain comprises the amino acid substitutions L351K and T366K,
said method further comprising the step of culturing said cell and allowing
for
expression of said nucleic acid molecules and harvesting said bispecific
antibody
from the culture. Antibodies that can be produced by these methods are also
part of
the present invention. The CH3 hetero-dimerization domains are preferably IgG1
hetero-dimerization domains. The heavy chain constant regions comprising the
CH3 hetero-dimerization domains are preferably IgG1 constant regions.
The member of the TNF receptor superfamily (first membrane protein) is
preferably CD137; 0X40; CD40 or CD30. In a preferred embodiment the first
membrane protein is CD137 or 0X40, preferably CD137. A binding molecule of the
invention preferably comprises one (antigen) binding site for said first
membrane
protein. In some embodiments a binding molecule of the invention is monovalent
for said first membrane protein. A binding molecule preferably comprises one
(antigen) binding site for said second membrane protein. In some embodiments a
binding molecule of the invention is monovalent for said second membrane
protein.
In some embodiments a binding molecule of the invention is monovalent for said
first membrane protein and monovalent for said second membrane protein. In
some
embodiments a binding molecule of the invention is monovalent for a member of
the TNF receptor superfamily and monovalent for a member of the B7 family. In
some embodiments a binding molecule of the invention is monovalent for CD137
and monovalent for a member of the B7 family. In some embodiments a binding
molecule of the invention is monovalent for CD137 and monovalent thr PD-Li.
Bivalent monoclonal anti CD137 antibodies are known in the art to activate
CD137
whereas monovalent CD137 binding molecules of the prior art typically do not
activate.
A first membrane protein as described herein is a member of the TNF
receptor superfamily which is a cell membrane protein. A protein is said to be
a
membrane protein on a cell if it has a transmembrane region that is present in
the
cell membrane of the cell it is on. This is typically the first cell as
described herein.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
00
rr
The protein can have further transmembrane regions. In such case, all
transmembrane regions that are present in a cell membrane are present in the
cell
membrane of the same cell. The first membrane protein is a cell membrane
protein
that has an extracellular part when present on the cell membrane. The cell
membrane is the membrane of a cell that separates the inside of the cell from
the
outside of the cell. The first membrane protein is typically on the cell
membrane of
the first cell as described herein. In the context of a binding molecule of
the
invention or a method or use of the invention the first membrane protein is
typically on the cell membrane of the first cell as described herein. The
first
membrane protein can be present on said second cell, but it is preferred that
the
expression of the first membrane protein is negligible on said second cell.
Typically
the level of said first membrane protein on said second cell is at most 10%
compared to the expression of the first membrane protein on the first cell.
The
second cell preferably does not significantly express said first membrane
protein.
Expression is at least not significant if the first membrane protein cannot be
detected (above background) by means of immune fluorescence in a FACS assay
with an antibody specific for said first membrane protein.
The second membrane protein is likewise a cell membrane protein. It has a
transmembrane region that is present in the cell membrane of the cell it is
on. This
is typically the second cell as described herein. The second protein can have
further
transmembrane regions. In such case, all transmembrane regions that are
present
in a cell membrane are present in the cell membrane of the same cell. The
second
membrane protein is a cell membrane protein that has an extracellular part
when
present on the cell membrane. In the context of a binding molecule of the
invention
or a method or use of the invention the second membrane protein is typically
on the
cell membrane of the second cell as described herein. The second membrane
protein
can be present on said first cell, but it is preferred that the expression of
the second
membrane protein is negligible on said first cell. Typically the level of said
second
membrane protein on said first cell is at most 10% compared to the expression
of
the second membrane protein on the second cell. The first cell preferably does
not
significantly express said second membrane protein. Expression is at least not
significant if the second membrane protein cannot be detected (above
background)
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
56
by means of immune fluorescence in a FAG'S assay with an antibody specific for
said second membrane protein.
According to some embodiments, a binding molecule or a (bispecific) antibody
or variant according to the invention has one antigen binding site that can
bind an
extracellular part of a member of the TNF receptor superfamily, and a second
antigen binding site that can bind a second membrane protein that is not a
member of the TNF receptor superfamily. This provides the advantage that in
cis
activation of (immune) cells such as T cells expressing several different
members of
the TNF receptor superfamily is at least in part avoided, thereby reducing the
potential adverse side effects and toxicity due to nonspecific T cell
activation. These:
embodiments of the present invention are in contrast to prior art approaches
which
relate to binding agents: binding to receptors of the TNT superfamily, in
particular
binding agents binding to at least two different receptors of the TNF
superfamily.
Such prior art approaches may lead to T cell activation in cis, meaning in the
absence of a second target, and may involve the risk of an excessive T cell
response,
for instance resulting in a cytokine storm. Consequently, such prior art
approaches
have an increased potential of adverse side effects compared to a binding
molecule
according to the invention having a first antigen binding site that can bind
an
extracellular part of a member of the TNF receptor superfamily and a second
antigen binding site that can bind a membrane protein that is not a member of
the
TNF receptor superfamily.
Also provided is an antibody or a functional part, derivative and/or analogue
thereof that comprises an antigen binding site that can bind an extracellular
part
of CD137 or 0X40 and an antigen binding site that can bind an extracellular
part
of a second membrane protein, wherein said second membrane protein is not a
member of the TNF receptor superfamily. Also provided is a method of
stimulating
activity of a member of the TNT' receptor superfamily on a cell comprising
providing a first cell and a second cell, wherein said first cell has said
member of
the TNF receptor superfamily on the cell membrane and said second cell has a
second membrane protein on the cell membrane, the method comprising contacting
said cells with an antibody or a functional part, derivative and/or analogue
thereof
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
57
that comprises two variable domains, wherein one variable domain comprises a
first antigen binding site that can bind an extracellular part of said member
of the
TNF receptor superfamily and another variable domain comprises a second
antigen
binding site that can bind an extracellular part of said second membrane
protein,
thereby stimulating activity of said member on said first cell; wherein said
second
membrane protein is not a member of the TNF receptor superfamily. In some
embodiments, said method is an in ultro method.
In some embodiments said antibody or functional part, derivative and/or
analogue thereof comprises one antigen binding site that can bind said member
of
the TNF receptor superfamily and one antigen binding site that can bind said
second membrane protein that is not a member of the TNF receptor superfamily.
In
some embodiments, the antigen binding part of said antibody or functional
part,
derivative and/or analogue of the invention consists of one immunoglobulin
variable domain that can bind an extracellular part of said member of the TNF
receptor superfamily and one immunoglobulin variable domain that can bind said
second membrane protein that is not a member of the TNF receptor superfamily.
Said bispeeifie antibody is preferably a full length antibody. In some
embodiments,
said bispecific antibody is a full length IgG-, i.e. a full length IgGl, IgG2,
IgG3 or
IgG4, preferably a full length IgG1 or a full length IgG4.
Further provided is an antibody or a functional part, derivative and/or
analogue thereof that comprises an antigen binding site that can bind an
extracellular part of CD137 or 0X40 and an antigen binding site that can bind
an
extracellular part of a second membrane protein, wherein said second membrane
protein is a member of the B7 family, preferably PD-L1. Also provided is a
method
of stimulating activity of a member of the TNF receptor superfamily on a cell
comprising providing a first cell and a second cell, wherein said first cell
has said
member of the TNF receptor superfamily on the cell membrane and said second
cell
has a second membrane protein on the cell membrane, the method comprising
contacting said cells with an antibody or a functional part, derivative and/or
analogue thereof that comprises two variable domains, wherein one variable
domain comprises a first antigen binding site that can bind an extracellular
part of
said member of the TNF receptor superfamily and another variable domain
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
58
comprises a second antigen binding site that can bind an extracellular part of
said
second membrane protein, thereby stimulating activity of said member on said
first
cell; wherein said second membrane protein is a member of the B7 family,
preferably PD-Li. In some embodiments, said method is an in vitro method.
In some embodiments said antibody or functional part, derivative and/or
analogue thereof comprises one antigen binding site that can bind said member
of
the TNF receptor superfamily and one antigen binding site that can bind said
second membrane protein that is a member of the B7 family, preferably PD-Li.
In
some preferred embodiments, the antigen binding part of said antibody or
functional part, derivative and/or analogue of the invention consists of one
immunoglobulin variable domain that can bind an extracellular part of said
member of the TNF receptor superfamily and one immunoglobulin variable domain
that can bind said second membrane protein that is a member of the B7 family,
preferably PD-Li. Said bispecific antibody is preferably a full length
antibody. In
some embodiments, said bispecific antibody is a full length Igo, i.e. IgGl,
IgG2,
IgG3 or IgG4, preferably a full length IgG1 or a full length IgG4.
A variable domain that "blocks" the binding of said first membrane protein to
a binding partner thereof interferes with binding of the first membrane
protein to
said binding partner. Such a variable domain can bind the first membrane
protein.
Such a blocking variable domain can bind an epitope on said first membrane
protein and compete with a binding partner of the first membrane protein for
binding to the epitope. Such a blocking variable domain and the binding
partner of
the first membrane protein can also bind to different epitopes on said first
membrane protein. In such cases the blocking activity can for instance be due
to
diminished binding of the binding partner, and/or displacement of the binding
partner when it is already bound to said first membrane protein, and/or a
blocking
variable domain can prevent binding of a binding partner to the first membrane
protein through sterie hindrance. All these and other mechanisms can, at least
partially, prevent that said binding partner binds to said first membrane
protein.
In one embodiment the domain that comprises an antigen binding site that
binds the TNF receptor superfamily member blocks the binding of the member to
a
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
59
ligand of the member. TNF receptor superfamily member - ligand interactions
have
been studied extensively in the art. Generally, members of the TNF receptor
superfamily typically are known to have at least one ligand. Examples of known
receptor ligand pairs are the TNF receptors tumor necrosis factor receptor 1
and 2
and the ligand TNF-alpha; the receptor 0X40 and the ligand 0X40L; the receptor
CD40 and the ligand CD154; the Fas receptor and the ligand FasL; the CD30
receptor and the ligand CD153; and the receptor CD137 and the ligand CD137L.
In
some embodiments the variable domain that comprises an antigen binding site
that binds the TNF receptor superfamily member does not block the binding of
the
member to a ligand of the member.
In some embodiments, the domain comprises an antigen binding site that
binds the TNF receptor superfamily member and blocks the binding of its TNF
receptor superfamily target membrane protein to a binding partner thereof.
Said
variable domain may be further characterized such that when provided in a
monospecifie bivalent antibody comprising two of said variable domains, it
does not
stimulate activity of the TNF-receptor superfamily member on a cell without
crosslinking. In some embodiments, the domain that comprises an antigen
binding
site that binds the TNF receptor superfamily member comprises a variable
domain
that blocks the binding of CD137 to CD137L, said variable domain being further
characterized by the fact that, when provided in a monospecific bivalent
antibody
comprising two of said variable domains, it does not stimulate activity of
CD137 on
a cell.
The terms "binding partners; binding pair; receptor ligand pair and the like
refers to proteins that can bind to each other and exert an activity as a
result of the
binding. At least one of the partners or pair is a membrane protein on the
cell
membrane of a cell. The activity is typically exerted on the cell that has
this
membrane protein on the cell.
A variable domain that blocks the binding of a specific binding pair of
membrane proteins as described herein typically reduces binding of the pair
when
compared to the binding in the absence of the variable domain. This is
preferably
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
measured in an in citro assay. Typically this is done by incubating the
variable
domain with the membrane protein that it can bind to and subsequently
incubating
the mixture with the other member of the pair. The binding of the pair is then
compared with the binding of the pair in the absence of the variable domain. A
5 variable domain can completely prevent the binding of the first membrane
protein
to a binding partner thereof. It can also partially prevent the binding of the
binding
pair. A variable domain that blocks the binding of a specific binding pair of
membrane proteins preferably reduces binding of the pair by at least 50%,
preferably at least 60%, preferably at least 70%, preferably at least 80%, and
more
10 preferably at least 90% when compared to the binding in the absence of
the
variable domain. Blocking of binding by a variable domain is defined herein as
the
blocking obtained using a bivalent monoclonal antibody comprising two of the
same
of said variable domains. The variable domain of course also blocks the
binding
when present in an antibody comprising said variable domain and a variable
15 domain that binds a second membrane protein.
Specific variable domains that can bind an extracellular part of CD137 and
that at least partially block the binding of CD137 ligand to CD137 are
variable
domains that comprise the amino acid sequence of the VH of: MF6783; MF6861;
20 .. MF6795; MF6808; MF6798; MF6754; MF6763; MF6744; MF6785; MF6825;
MF6737; MF6749; MF6788; or MF6797.
Specific variable domains that can bind an extracellular part of PD-L1 and
that block the binding of PD1 to PD-Li are variable domains that comprise the
amino acid sequence of the VH of MF5554; MF5576; MF5578; MF9375; MF9376;
25 MF7702; MF5359; MF5377; MF5382; MF5424; MF5426; MF5439; MF5442;
MF5553; MF5557; MF5561; MF5576; MF5594; or MF5708. The amino acid
sequences are depicted in figure 3.
The variable domain that binds the member of the TNF receptor superfamily
30 .. is preferably a variable domain that, when provided in a monospecific
bivalent
antibody comprising two of said domains, does not stimulate activity of the
TNF-
receptor superfamily member on a cell. Said variable domain in the context of
a
bivalent monospecific antibody comprises two of the same of said variable
domains
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
61
and does not stimulate the activity of cells comprising the TNF-receptor
superfamily member.
Stimulating activity of a member of the TNF receptor superfamily on a cell is
typically measured by measuring a biological activity of the cell. The type of
activity depends on which member of the TNF receptor superfamily is analyzed.
For 0X40 and CD137, for instance, the activation state of an OX40 and/or CD137
positive T-cell can be measured. 0X40 and CD137 are so-called co-stimulatory
proteins that stimulate the activation of an activated T-cell. Suitable
methods for
measuring the activation of a T-cell are provided in the example section. One
method is measuring IL-2, IFNy and/or TNFG production by an activated T-cell
or
composition comprising said T-cell. Other TNF receptors have different
biological
activities. For instance CD30 is expressed on activated T- and B-cells and is
a
positive regulator of apoptosis. Stimulation of CD30 can be measured by
measuring
apoptosis of activated B- or T-cells in response to a binding molecule of the
invention. CD40 is a costimulatory protein found on antigen presenting cells
such
as macrophages and stimulation further stimulates the activation of the
antigen
presenting cell. Activity of a member of the TNF receptor superfamily is
stimulated
when the activity measured in the presence of a binding molecule as discussed
herein, preferably in the presence of an antibody or functional part,
derivative
and/or analogue according to the invention, is higher than the activity
measured
under otherwise identical conditions in the absence of the binding molecule,
preferably the antibody or functional part, derivative and/or analogue
according to
the invention. Stimulating the activity includes induction of an activity and
enhancement of an already present activity.
Stimulating activity of CD137 or 0X40 is preferably measured by measuring
a biological activity of the CD137 or OX40 comprising cell. The biological
activity is
preferably the activation state of the CD137 or OX40 expressing cell. CD137
and
0)(40 are co-stimulatory molecules expressed on immune cells, including
activated
T cells. Stimulation of activity of CD137 or 0X40 is preferably measured by
determining the level of activation of the immune cells, e.g. of activated T-
cells. In
an individual the stimulation of activity of CD137 or (I)X40 is preferably
measured
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
62
by measuring the activation of the immune cells and/or T-cells of the
individual.
Alternatively, it can also be determined by, where applicable, measuring the
tumor
response in the individual; the virus load of the individual; or the parasite
load of
the individual.
The invention also provides a method of engaging and/or activating T-cells
comprising providing a system comprising a T-cell and a cell (second cell) to
which
said T-cell is to be engaged or activated, and providing said system with at
least
one antibody, preferably at least one bispecific antibody, that comprises a
variable
domain that can bind a member of the TNF receptor superfamily and a variable
domain that can bind to an extracellular part of a second protein and
incubating
said system under conditions that are permissive for the T-cell to become
engaged
and/or activated. In some embodiments, said method is an in uitro method. Said
TNF receptor superfamily member is preferably CD137 or 0X40, most preferably
CD137, and said second membrane protein is preferably not a member of the TNF
receptor superfamily. Said second membrane protein is preferably a member of
the
B7 family, most preferably PD-Li. The cell to which said T-cell is to be
engaged or
activated is preferably an immune cell, (for example antigen presenting cell,
or
macrophage), a neoplastie cell, a virus infected cell, or an intracellular
parasite
infected cell. Engaging and/or activating T-cells directs T-cells to a
specific target.
Activating a T-cell is activating the T-cell receptor of said T-cell. Engaging
a T-cell
typically is activating a T-cell. Engagement can also direct an already
activated T-
cell to a target specified by the antibody. Conditions that are permissive for
said T-
cell to become engaged and/or activated are typically culture conditions but
can
also be incubation in a non-human animal. The conditions are such that the T-
cell
is not engaged in the absence of the antibody. If collections of T-cells are
measured
some of these can be already engaged or activated provided that the collection
contains sufficient T-cells that are not engaged or activated.
An antibody of the invention can bring two cells together in close proximity
that allows the interactions between the cells mediated by proteins other than
the
member of the TNF receptor superfamily and the second membrane protein bound
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
63
by the antibody of the invention. One such interaction is an interaction of a
T-cell
receptor of one cell and MHC on the other cell.
Said first and second cells are preferably different cells. The different
cells
can both express said first and second membrane protein. Typically however,
the
first membrane protein is expressed only on said first cell and said second
membrane protein only on said second cell. The biological activity is
typically more
stimulated if the first cell does not express said second membrane protein;
said
second cell does not express said first membrane protein; or more preferably a
combination thereof. When the TNF receptor superfamily member is OX40; CD137;
CD30 or CD40 it is preferred that said first cell is an immune cell,
preferably a
T cell. In these cases it is preferred that the second cell is an aberrant
cell, tumor
cell or an immune cell (for example a macrophage or an antigen presenting
cell).
Aberrant cells are cells that are not normally present in a healthy
individual. Non-
limiting preferred examples of such cells are cancer cell, virus-infected
cells,
parasite infected cells or cells induced to express the second membrane
protein. A
suitable second cell is also an immune cell. Preferred examples of such cells
are
dendritic cells, macrophages, other cells of the myeloid lineage or B cells.
In some
cases a cell may express the second membrane protein as a result of
suppressive
factors released by neighboring cells such as immune cells, fibroblasts or
cancer
cells. In some embodiments, said second cell is an antigen presenting cell
presenting a tumor antigen or a pathogenic antigen, like for instance a viral
antigen or a parasite antigen, in the context of a major histocompatibility
complex
(MHC). Said MHC complex is preferably a human leukocyte antigen (HLA)
complex. In this context the antibody of the invention can enhance both the
expansion and differentiation of antigen naive T cells in vitro. Inducing and
enhancing novel T cell responses against tumor antigens typically will result
in
more effective tumor immunity and cancer cell eradication.
CD137 can be expressed by activated T-cells. It is also found on other cells
such as dendritic cells, natural killer cells, granulocytes and cells of the
blood
vessel wall at sites of inflammation. The protein is known for its
costimulatory
activity for activation of T-cells. The ligand CD137L is expressed on
monocytes,
macrophages and other cells. Binding of CD137 to CD137 ligand exerts effects
in
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
64
both the receptor and the ligand containing cell. Activation of the ligand or
receptor
can be achieved in various ways. Common ways are coating onto tissue-culture
plates or cross-linking via antibodies (for review see Schwartz, 2004). CD137
expression on both innate and adaptive immune cells, coupled with its ability
to
.. potentiate antitumor responses has established it as a therapeutic target
to
enhance tumor immunity. Various CD137-targeted immunotherapeutics have
reached clinical development (for review see Makkouk et al 2016). Activation
of the
receptor or the ligand appears to require homomeric association in the
cellular
membrane to exert their effect. Antibodies with two binding sites for CD137
are
capable of activating the receptor or ligand. Hence, such antibodies are
bivalent for
CD137. Molecules that only have one binding site for CD137 were also produced.
Such monovalent binding molecules of the prior art could not activate the
receptor
(McNamara 2008). In contrast, a binding molecule or antibody or variant
according
to the present invention is able to activate CD137, even when it is monovalent
for
.. CD137.
0X40 is a secondary co- stimulatory immune checkpoint molecule expressed
on T-cells. 0X40 expression is not constitutive, it is typically expressed
after 24 to
72 hours following activation; its ligand, OX4OL, is also not expressed on
resting
antigen presenting cells, but is following their activation.
In the present invention it was found that a binding molecule with only one
binding site for a TNF receptor superfamily member (first membrane protein)
can
be activating if the binding molecule also has a binding site for a second
membrane
protein on another cell (second cell), including when the second membrane
protein
is not a member of the TNF receptor superfamily member. The second membrane
protein can be a ligand for a receptor of the TNF receptor superfamily.
However,
typically it is not a ligand of the TNF receptor superfamily member that is
the first
membrane protein. The second membrane protein can be a ligand for a TNF
receptor superfamily member that is not the ligand of the first membrane
protein.
Stimulation of activity of a member of the TNF receptor superfamily on a cell
typically requires the bringing together of two or more receptor complexes.
The
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
homotrimeric ligand arrayed on a cell surface membrane typically achieves this
by
engaging multiple TNF receptor superfamily member complexes on a neighbouring
cell. It is thought that the clustering of the TNF receptor superfamily
complexes
facilitates stimulation of the activity of the cell. This is, for instance,
also apparent
5 from artificial receptors that only have a cytoplasmic part of the CD137
receptor.
Close proximity of the cytoplasmic parts of various artificial receptors also
stimulates the artificial receptor containing cell. Bivalent monospecific
antibodies
specific of a TNF receptor superfamily member are also capable of mimicking
the
ligand effect and stimulate the activity. It is thought that the arms of the
antibody
10 bring together or cluster the receptors. Such activity is also referred
to as cross-
linking of the receptors. The activity can on occasion be further stimulated
by
providing an anti-antibody antibody, this provides further cross-linking of
the
receptor. Prior art binding molecules that have only one binding site for a
TNF-
receptor superfamily member are typically not capable of stimulating the
activity.
15 Such molecules fail to cluster or cross-link the TNF receptor
superfamily members.
However, a binding molecule or antibody or variant according to the present
invention is capable of stimulating the activity of a TNF-receptor superfamily
member, including when it is monovalent for said TNF-receptor superfamily
member. Without being bound to any theory, it is believed that a bispecific
20 antibody according to the present invention can also cluster the TNF
receptor
superfamily receptor complexes, thereby promoting activation of the TNF
receptor
superfamily member. This holds particularly true when the second membrane
protein that is bound by an antibody according to the present invention is a
member of the B7 family such as PD-Li.
In one aspect of the present invention the second membrane protein is
present on the cell membrane as part of a multimeric protein comprising two or
more instances of said second membrane protein. Such multimerie proteins can
provide two or more epitopes for the antigen binding site of a binding
molecule of
the invention. In such a case, bound TNF receptor superfamily member on the
other cell will become clustered and stimulate the activity of the TNF
receptor
containing cell. A binding molecule of the invention can force proximity of
TNF
receptor superfamily member through binding to another protein on a different
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
66
cell. A feature also referred to as trans-crosslinking as opposed to cis-
crosslinking
by binding molecules that bind two or more instances of the TNF receptor
superfamily member on the same cell. In some embodiments the second membrane
protein is a homodimer or a homotrimer. A homodimer is a protein that is
composed of two identical polypeptide units. A homotrimer is a protein that is
composed of three identical polypeptide units. Without being bound by any
theory
it is believed that the epitopes for the antigen binding site of the second
membrane
protein collectively bind a number of binding molecules. These thereby
function as
an anchor that forces the close proximity of two or more of the TNF receptor
superfamily members. The proximity is sufficiently close to stimulate the
activity
of the TNF receptor superfamily member on a cell.
In another embodiment the said second membrane protein is a protein that is
present in one or more discrete zones on the cell membrane. Cell membranes do
not
provide a homogenous distribution of all components of the cell membrane. It
is
presently known that cell membranes have zones wherein one or more components
of the cell membrane are more frequently present than other parts of the
membrane (for review see Vereb, G., et al. 2003 Proc. Natl. Acad. Sci. 100.14:
8053-
8058). Said zone is preferably a cluster of proteins, a domain, a micro-domain
or a
compartment on the cell membrane, preferably an immunological synapse. Without
being bound by any theory it is believed that the non-random distribution
facilitates the close proximity of the TNF receptor superfamily member.
In other embodiments stimulation of activity of a TNF receptor superfamily
member on a cell is achieved by providing two or more binding molecules that
bind
the same member of the TNF receptor superfamily (first membrane protein) and
the same second membrane protein. Embodiments that involve two or more
binding molecules are also referred to as Oligoclonics embodiments. As for
instance shown in Figures 15 and 16, Oligoclonics embodiments can result in
T cell activation. General methods for making such Oligoclonicst products are
disclosed in WO 2013/157953 and W02004/009618 and are incorporated here by
reference. The term Oligoclonics' is a registered trademark, indicated by rt.
In an
Oligoclonicst embodiment at least two of the binding molecules bind different
epitopes on said first membrane protein; different epitopes on said second
membrane protein; or different epitopes on said first membrane protein and
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
67
different epitopes on said second membrane protein. An Oligoclonics
embodiment
allows the binding of two or more binding molecules to the same molecule of
the
first and/or second membrane protein, thereby stimulating activity of a TNF
receptor superfamily member on a cell. It is preferred that the at least two
of the
binding molecules bind different epitopes on said second membrane protein; or
bind
different epitopes on said first membrane protein and different epitopes on
said
second membrane protein. In a particularly preferred embodiment the at least
two
binding molecules bind the same epitope on said first membrane protein and
different epitopes on said second membrane protein. In some Oligoclonics0
embodiments the two binding molecules block the TNF-receptor superfamily
member-ligand interaction. In other Oligoclonics0 embodiments the two binding
molecules do not block the TNF-receptor superfamily member-ligand interaction.
Different epitopes on a first and second membrane protein are preferably such
that
simultaneous binding of a binding molecule that binds one of the epitopes and
a
binding molecule that binds to the different epitope is possible. In a
preferred
embodiment the different epitopes are non-competing epitopes. In a preferred
embodiment a first and a second of said binding molecules can bind the same
domain of CD137 or OX40. In a preferred embodiment said first and second
binding molecule bind the same epitope on CD137 or 0X40.
The second membrane protein is preferably a multimeric cytokine receptor, a
member of the B7 family, a member of the CD28 family; a member of ATP-binding
cassette transporters (ABC transporters); an aquaporin; a member of the
serine/threonine kinase receptor family; a member of the receptor tyrosine
kinase
family. In a preferred embodiment the second membrane protein is a member of
the B7 family. In a preferred embodiment the B7 family member is CD80; CD86;
PD-Li; PD-L2; ICOSL; B7-H3; B7-H4; B7-H5; B7-H6; or B7-H7. It is preferred
that
the second membrane protein is a co-inhibitory protein of the B7-family. In
this
preferred embodiment it is preferred that the variable domain that binds the
second membrane protein blocks the binding of the B7-family member to the
binding partner thereof of the CD28 family. In this way a potential co-
inhibitory
signal provided by the second membrane protein to the first cell is reduced.
In a
particularly preferred embodiment the second membrane protein is P11)-Li or PD-
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
68
L2, preferably PD-Li. In another preferred embodiment the second membrane
protein is a member of the EGF receptor family (ErbB); the insulin receptor
family;
the IGF receptor family; the FGF receptor family; the VEGF receptors family;
the
HGF receptor family; or the AXL receptor family. The second membrane protein
is
.. preferably a member of the EGF receptor family (ErbB), preferably EGFR;
ErbB-2
or ErbB-3, preferably ErbB-2. It is preferred that the variable domain that
binds
an EGFR, ErbB-3 or ErbB-4 member of the EGF receptor family blocks the binding
of a growth factor to said member. In this embodiment the activity of the EGF
receptor family member on said second cell is reduced.
In embodiments of the invention the second membrane protein is a member of
a binding pair. For instance, the EGF receptor (EGFR) and EGF form a binding
pair. Other non-limiting examples of suitable binding pairs are HER3 and
heregulin; LGR5-Rspondin; LGR4-Rspondin; or a B7 family member ligand and a
receptor thereof of the CD28 family. In a preferred embodiment of the
invention a
binding molecule as described herein blocks the binding of the second membrane
protein to the complementary member of the binding pair. Such binding
molecules
typically stimulate activity of a member of the TNF receptor superfamily on
the
cell and block an activity of the second membrane protein. Such binding
molecules
.. are particularly well suited for situations wherein the second cell is a
tumor cell, or
treatment of individuals with cancer. In a preferred embodiment the second
membrane protein is a member of the B7 family, preferably PD-L1 or PD-L2,
preferably PD-Li and said at least one binding molecule preferably blocks the
binding of said B7 family member to its normal receptor of the C11)28 family.
In a
preferred embodiment the second membrane protein is PD-Li and said at least
one
binding molecule preferably blocks the binding of PD-L1 to P11)-1.
The invention provides a method of enhancing a biological effect in a CD i37
expressing cell, the method comprising providing a system with a first cell
and a
second cell, wherein said first cell comprises CD137 on the cell membrane, and
said
second cell comprises a protein on the cell membrane with two or more
instances
(i.e. two or more copies of the same epitope are present) of the same epitope
on an
extracellular part of said protein, and providing said system with a binding
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
69
molecule that comprises a binding site for an extracellular part of CD137, and
a
binding site for said epitope, the method further comprising incubating said
system
under conditions that allow said biological activity to be enhanced. In some
embodiments, said method is an in vitro method. In some embodiments, said
CD137 expressing cell is an immune cell, preferably a T cell, and said second
cell is
a tumor cell. In some embodiments, said CD137 expressing cell is an immune
cell,
preferably a T cell, and said second cell is another immune cell. In some
embodiments, said CD137 expressing cell is an immune cell, preferably a T
cell,
and said second cell is a cell of the myeloid lineage. In some embodiments,
said
CD137 expressing cell is an immune cell, preferably a T cell, and said second
cell is
an antigen presenting cell. Said antigen presenting cell preferably presents a
tumor antigen or a pathogenic antigen in the context of MHC, preferably in the
context of HIA.
A cell typically has a member of the TNF-receptor superfamily on the
membrane if the member is expressed by the cell. Expression can be measured in
various ways. Quantitative RNA specific PCR is often used.
Immunohistochemistry
or FACS analysis using immune-fluorescence is also often used.
A suitable system wherein the first cell and second cell are provided is a
cell
culture. Another suitable system is a non-human animal comprising the first
cell
and second cell. Other suitable systems are ex uiuo systems wherein the cells
are
maintained in active form but wherein growth of the cells is not necessarily
facilitated. A first and second cell can be incubated together under, for
instance,
assay conditions that not necessarily facilitate growth but allow biological
activity
to be measured.
Incubating said system under conditions that are permissive for cells
expressing said biological activity mediated by the binding of said first
membrane
protein and said second membrane protein means that the system is maintained
under conditions wherein the first and second cell can exhibit a biological
activity
as a result of the binding partners. In cluo or in vitro incubation does not
have to
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
involve more than passing of sufficient time to allow the biological activity
to
become apparent.
A variable domain that does not block the binding of a specific binding pair
of
5 membrane proteins as described herein typically does not reduce binding
of the
pair when compared to the binding in the absence of the variable domain. This
is
preferably measured in an in vitro assay. Typically this is done by incubating
the
variable domain with the membrane protein that it can bind to and subsequently
incubating the mixture with the other member of the pair. The binding of the
pair
10 is then compared with the binding of the pair in the absence of the
variable
domain. A variable domain is considered not to block the binding of a specific
binding pair of membrane proteins if it reduces binding of the pair by not
more
than 50%, preferably not more than 40%, preferably not more than 30%,
preferably
not more than 20%, and more preferably not more than 10%, when compared to the
15 binding in the absence of the variable domain. Binding by a variable
domain and
the blocking or non-blocking of the binding to the other member of the binding
pair
is defined herein as the blocking obtained using a bivalent monoclonal
antibody
comprising said two of the same of said variable domains. The blocking or non-
blocking is defined as obtained with a bivalent monospecific antibody
comprising
20 said two of the same of said variable domains.
Specific variable domains that can bind an extracellular domain of CD137
and that do not block the binding of CD137 to CD137L are variable domains that
comprise the amino acid sequence of the VH of MF6860; MF6848; MF6805;
MF6832; MF6870; MF6862; MF6875; or MF6873.
25 Specific variable domains that can bind an extracellular domain of PD-L1
and
that do not block the binding of PD1 to PD-Li are variable domains that
comprise
the amino acid sequence of the VH of MF5361.
Functional aspects of variable domains in kind not necessarily in amount,
30 such as binding to an antigen, blocking capacity of receptor ligand
interaction,
biological activity of a variable domain, etc. can be can be determined in
various
ways. Suitable formats are a Fab fragment or an antibody. A suitable antibody
format is a monospecific bivalent antibody comprising two of the variable
domains.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
71
Another suitable format is for instance a bispecific antibody comprising the
variable domain to be tested and another variable domain. The other variable
domain is preferably a variable domain with a neutral specificity with respect
to
the assay to be performed. A suitable neutral variable domain is a variable
domain
that can bind tetanus toxoid.
An antibody or functional part, derivative and/or analogue thereof of the
invention preferably comprises a variable domain that blocks the binding of
its
TNF receptor superfamily target membrane protein to a binding partner thereof.
In some embodiments, an antibody or functional part, derivative and/or
analogue
thereof of the invention comprises a variable domain that blocks the binding
of its
TNF receptor superfamily target membrane protein to a binding partner thereof,
and that, when provided in a monospecific bivalent antibody comprising two of
said
variable domains, does not stimulate activity of the TNF-receptor superfamily
member on a cell. In some embodiments, an antibody or functional part,
derivative
and/or analogue thereof of the invention comprises a variable domain that
blocks
the binding of CD137 to CD137L, and that, when provided in a monospecific
bivalent antibody comprising two of said variable domains, does not stimulate
activity of CD137 on a cell..
The invention also provides a method for the treatment of an individual that
has a cancer, the method comprising administering a binding molecule of the
invention, preferably an antibody or a functional part, derivative and/or
analogue
of the invention or a bispecific antibody of the invention, to the individual
in need
thereof. The individual is preferably an individual that has cancer. In some
embodiments the cancer is a cancer that comprises cancer cells that express
said
second membrane protein. In some embodiments the cancer is a cancer that
comprises cancer cells that express a member of the B7 family. In some
embodiments, immune cells and/or cells of the myeloid lineage of said
individual
express said second membrane protein, preferably a member of the B7 family. In
some embodiments, antigen presenting cells (APCs) of said individual express
said
second membrane protein, preferably a member of the B7 family. According to
these embodiments, the cancer cells may or may not express said second
membrane
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
72
protein. When APCs express said second membrane protein, antigens of said
cancer are presented by such APCs of the individual and transactivation of
immune cells (preferably T cells) can be induced by an antibody or a
functional
part, derivative and/or analogue of the invention, which is able to bind an
immune
cell and an immune cell, APC or tumor cell of the individual. In some
embodiments, an antibody or a functional part, derivative and/or analogue of
the
invention is used that binds CD137 and a member of the B7 family, preferably
PD-Li. Such an antibody or functional part, derivative and/or analogue of the
invention can transactivate an immune cell by binding a CD137-expressing
immune cell (preferably a T cell) and either a tumor cell and/or an immune
cell
and/or a cell of the myeloid lineage and/or an APC that expresses said member
of
the B7 family.
The cancer is preferably an adenocarcinoma. Preferred cancers are colorectal
cancer; pancreatic cancer; lung cancer; breast cancer; liver cancer; prostate
cancer;
ovarian cancer; cervical cancer; endometrial cancer; head and neck cancer;
melanoma; testis cancer; urothelial cancer; renal cancer; stomach cancer; or
carcinoid cancer. In a preferred embodiment the cancer is colorectal cancer;
pancreatic cancer; lung cancer; breast cancer; liver cancer; prostate cancer;
ovarian
cancer; cervical cancer; endometrial cancer; head and neck cancer; or
melanoma. In
a particularly preferred embodiment the cancer is colorectal cancer;
pancreatic
cancer; lung cancer; breast cancer; or liver cancer. In a particularly
preferred
embodiment the cancer is a gastrointestinal cancer. In a preferred embodiment
the
cancer is colorectal cancer. In this embodiment the binding molecule
preferably an
antibody or functional part, derivative and/or analogue thereof is preferably
an
antibody with a variable domain that can bind CD137 or 0X40 and a variable
domain that can bind PD-Li. The variable domain that binds CD137 or 0X40
preferably blocks the binding of CD137 to CD137 ligand or, in case of 0X40
blocks
the binding of 0X40 the 0X40 ligand. The variable domain that binds PD-L1
preferably blocks the binding of PD-1 to PD-L1.
Further provided is an ex rim system comprising an antibody or a functional
part, derivative and/or analogue thereof or bispecific antibody or a
functional part,
derivative and/or analogue thereof the invention, and said first cell said
second cell.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
73
The first and said second cell preferably express respectively said first and
said
second membrane protein on the cell membrane. The system is preferably a cell
system suitable for the maintenance and/or the growth of said first cell. The
cell
system is preferably suitable for the maintenance and/or the growth of said
second
cell. Such as system is for instance suitable to raise and/or multiply immune
cells
that are directed towards aberrant cells. Such immune cells can subsequently
be
administered to an individual in need thereof, for instance a cancer patient.
The
immune cells preferably comprise a T-cell or NK-cell, preferably a eytotoxie T-
cell.
The immune cells are preferably autologous to the individual in need thereof.
Further provided is a method for stimulating an immune response in an
individual against an aberrant cell in said individual, the method comprising
providing said individual with an antibody or a functional part, derivative
and/or
analogue thereof of the invention. The aberrant cell is preferably a cancer
cell, a
virus-infected cell, a parasite or a parasite infected cell. In a preferred
embodiment
the cell is a cancer cell or a neoplastic cell. In this embodiment the
antibody or
functional part, derivative and/or analogue thereof is preferably an antibody
with a
variable domain that can bind an extracellular part of C11)137 or 0X40 and a
variable domain that can bind PD-Li. The variable domain that binds CD137 or
0X40 preferably blocks the binding of CD137 to CD137 ligand or, in ease of
0X40
blocks the binding of 0X40 the OX ligand. The variable domain that binds P11)-
L1
preferably blocks the binding of PD-1 to PD-Li.
A neoplasm is an abnormal growth of tissue and when it also forms a mass is
commonly referred to as a tumor. A neoplasm in the present invention typically
forms a mass. A neoplastie cell is a cell from a neoplasm that has formed a
mass.
The World Health Organization (WHO) classifies neoplasms into four main
groups:
benign neoplasms, in situ neoplasms, malignant neoplasms, and neoplasms of
uncertain or unknown behavior. Malignant neoplasms are also simply known as
cancers.
Stimulating an immune response encompasses inducing an immune response
and enhancing an already existing immune response. The immune response in an
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
74
individual can be measured by measuring where applicable; the tumor load of
the
individual; the virus load of the individual; the parasite load of the
individual.
Said virus-infected cell is preferably a cell infected with an immune-
deficiency virus, a herpes virus, preferably a herpes simplex virus, a
varicella-
zostervirus, a cytomegalovirus or an Epstein-Barr virus, a papilloma virus, a
hepatis virus, preferably a hepatitis A, B or C virus, a measles virus or an
adenoviruses . The virus is preferably a virus known to be able to persist in
an
individual. Persistent infections are characterized as those in which the
virus is not
.. cleared but remains in specific cells of infected individuals. Persistent
infections
may involve stages of both silent and productive infection without rapidly
killing or
even producing excessive damage of the host cells. Persistent virus-host
interaction
may be a latent, a chronic and/or a slow infection.
A parasite-infected cell is a cell that is infected with an intracellular
parasite.
Such parasites are parasitic microorganisms that are capable of growing and
reproducing inside the cells of a host. Some intracellular parasites can also
live
outside a cell. Such parasites are so-called facultative intracellular
parasites. Non-
limiting examples are Listeria monocytogenes, Legionella, certain species of
mycobacterium and Cryptococcus neoformans. Preferred intracellular parasites
are
parasites that cannot grow outside host cells, preferred examples are
Chlamydia,
and closely related species, certain species of mycobacterium such as
Mycobacterium leprae, certain protozoa, including: Apicomplexans (Plasmodium
spp., Toxoplasma gondii and Cryptosporidium parvum and trypanosomatids.
The invention also provides a nucleic acid molecule that encodes an antibody
heavy chain variable region according to the invention. The nucleic acid
molecule
(typically an in vitro, isolated or recombinant nucleic acid molecule)
preferably
encodes any one of the heavy chain variable regions as depicted in Figure 3 or
a
heavy chain variable region as depicted in Figure 3 having 1, 2, 3, 4 or 5
amino acid
insertions, deletions, substitutions or combination thereof. In a preferred
embodiment the nucleic acid molecule comprises a sequence as depicted in
Figure
3. The nucleic acid molecule preferably uses codons that are optimized for
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
expression in the antibody producing cell that is to be used. Preferably the
nucleic
acid encoding a heavy chain variable region as depicted in Figure 3 or a heavy
chain variable region as depicted in Figure 3 having 1, 2, 3, 4 or 5 amino
acid
insertions, deletions, substitutions or combination thereof is codon optimized
for
5 expression in a human cell preferably Per.C6TM; or a Chinese hamster,
preferably
CHO. The invention further provides a nucleic acid molecule that codes for the
mentioned heavy chain variable region together with a heavy chain constant
region
of Figure 2.
10 A nucleic acid molecule as used in the invention is typically but not
exclusively a ribonucleic acid (RNA) or a deoxyribonucleic acid (DNA).
Alternative
nucleic acids are available for a person skilled in the art. A nucleic acid
molecule
according to the invention is for instance comprised in a cell. When said
nucleic
acid molecule is expressed in said cell, said cell can produce an antibody
according
15 to the invention. Therefore, the invention in one embodiment provides a
cell
comprising an antibody according to the invention and/or a nucleic acid
molecule
according to the invention. An antibody is produced when said cell produces a
heavy chain and a light chain. Provided is a cell that can produce an antibody
of
the invention. The cell preferably comprises a nucleic acid molecule that
encodes
20 an antibody heavy chain that comprises an antibody heavy chain variable
region
that, when combined with a common light chain, can bind said first membrane
protein. Said cell preferably further comprises a nucleic acid molecule that
encodes
an antibody heavy chain that comprises an antibody heavy chain variable region
that, when combined with a common light chain, can bind said second membrane
25 protein. Said cell preferably further comprises a nucleic acid molecule
that codes
for a common light chain. Said cell is preferably an animal cell, more
preferably a
mammal cell, more preferably a primate cell, most preferably a human cell. For
the
purposes of the invention a suitable cell is any cell capable of comprising
and
preferably of producing an antibody according to the invention and/or a
nucleic acid
30 according to the invention.
The invention further provides a cell comprising an antibody according to the
invention. Also provided is a cell that comprises one or more nucleic acid
molecules
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
76
that alone or together encode an antibody of the invention. The one or more
nucleic
acid molecules are expressible nucleic acid molecules meaning that they
contain
the in cis required signals for RNA transcription and translation of protein
coding
domains. Preferably said cell (typically an in vitro, isolated or recombinant
cell)
produces said antibody. In a preferred embodiment said cell is a hybridoma
cell, a
Chinese hamster ovary (CH()) cell, an NSO cell or a PER-C6TM cell. In a
particularly preferred embodiment said cell is a CHO cell. Further provided is
a
cell culture that comprises a cell according to the invention. Various
institutions
and companies have developed cell lines for the large scale production of
antibodies, for instance for clinical use. Non-limiting examples of such cell
lines are
CHO cells, NSO cells or PER.C6TM cells. These cells are also used for other
purposes such as the production of proteins. Cell lines developed for
industrial
scale production of proteins and antibodies are herein further referred to as
industrial cell lines. Thus in a preferred embodiment the invention provides
the
use of a cell line developed for the large scale production of antibody for
the
production of an antibody of the invention. The invention further provides a
cell for
producing an antibody comprising a nucleic acid molecule that codes for a VH,
a
VL, and/or a heavy chain as depicted in Figures 3, 1 and 2. Preferably said
nucleic
acid molecule comprises a sequence as depicted in Figures 1 and 2.
The invention further provides a method for producing an antibody
comprising culturing a cell of the invention and harvesting said antibody from
said
culture. Preferably said cell is cultured in a serum free medium. Preferably
said
cell is adapted for suspension growth. Further provided is an antibody
obtainable
by a method for producing an antibody according to the invention. The antibody
is
preferably purified from the medium of the culture. Preferably said antibody
is
affinity purified.
A cell of the invention is for instance a hybridoma cell line, a CHO cell, a
293F cell, an NS() cell or any other cell type known in the art for its
suitability for
antibody production for clinical purposes, in particular for the production of
antibodies used for administration in humans. In a particularly preferred
embodiment said cell is a human cell, preferably a cell that is transformed by
an
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
77
adenovirus El region or a functional equivalent thereof. A preferred example
of
such a cell line is the PER.C6TM cell line or equivalent thereof. In a
particularly
preferred embodiment said cell is a CHO cell or a variant thereof, preferably
a
variant that makes use of a Glutamine synthetase (OS) vector system for
expression of an antibody.
The invention further provides a pharmaceutical composition comprising one
or more antibodies or variants thereof according to the invention. The
pharmaceutical composition preferably comprises a pharmaceutically acceptable
excipient or carrier.
An antibody or variant thereof of the invention may further comprise a label,
preferably a label for in viuo imaging. Such a label is typically not
necessary for
therapeutic applications. In for instance a diagnostic setting, a label can be
helpful.
For instance in visualizing target cells in the body. Various labels are
suited and
many are well known in the art. In a preferred embodiment the label is a
radioactive label for detection. In another preferred embodiment, the label is
an
infrared label. Preferably the infrared label is suited for in uluo imaging.
Various
infrared labels are available to the person skilled in the art. Preferred
infrared
labels are for instance, IRDye 800; IRDye 680RD; IRDye 680LT; IRDye 750; IRDye
700DX; IRDye 800R5 IRDye 650; IRDye 700 phosphoramidite; IRDye 800
phosphoramidite (LI-COR USA; 4647 Superior Street; Lincoln, Nebraska).
The amount of antibody according to the invention to be administered to a
patient is typically in the therapeutic window, meaning that a sufficient
quantity is
used for obtaining a therapeutic effect, while the amount does not exceed a
threshold value leading to an unacceptable extent of side-effects. The lower
the
amount of antibody needed for obtaining a desired therapeutic effect, the
larger the
therapeutic window will typically be. An antibody according to the invention
exerting sufficient therapeutic effects at low dosage is, therefore,
preferred. The
dosage can be in range of the dosing regimen of Nivolumab. The dosage can also
be
lower.
In a tumor suppressive environment the expression of PD-Ll on surrounding
cells is expected to reach a density threshold that will result in activation
of CD137
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
78
on T cells as described in Example 8 (Figure 28A and 28B). As such the
bispecific
antibody will be able to activate T cells within the tumor and not ¨ or to a
significantly lesser extent - act on cells expressing low PD-Li cell surface
levels. In
case the C11)137xPD-L1 bispecific antibody contains a P11)-Li blocking Fab
arm, the
antibody will in addition overcome the PD-1/PD-L1 blockade. By acting in
'trans'
the CD137xPD-L1 antibody will release the PD-1/PD-L1 blockade and
simultaneously activate the T cell by activating CD137. As a result a CD137xPD-
L1 antibody can enhance the local T-cell responses leading to the release of a
plethora of cytokines (Example 9) that in turn can activate other immune cells
in
the tumor microenvironment and overcome at least in part the local immune
suppression in the tumor. It has been shown by the present inventors that a
bispecific antibody according to the invention often has better T cell
activating
properties as compared to antibodies that are based on prior art benchmark
antibodies with the same kind of specificity, such as for instance antibodies
based
on Urelumab (anti-CD i37) or based on Atezolizumab (anti-PD-L1) In the
Examples, stronger T cell activating activity has been achieved with a
bispecific
antibody according to the invention in comparison with a mixture of two of
such
benchmark-based antibodies. This is for instance shown in the T cell
transactivation assays and the SEB stimulation assays of the current Examples.
It
has also been demonstrated that a bispecific antibody according to the present
invention is able to reverse immune suppression induced by tumor-associated M2
macrophages and is capable of (re)stimulating tumor specific T cells isolated
from
patient tumors in ritro. A bispecific antibody according to the present
invention can
(re)stimulate tumor-specific CD4+ effector memory T cells, tumor-specific CD8+
effector memory T cells and tumor-specific CD8+ terminally differentiated T
cells,
while a benchmark anti-PD-Li antibody based on Atezolizumab typically only
(re)stimulates CD4+ T cells. Hence, a bispecific antibody according to the
present
invention has a potency of (re)stimulating a more variable subset of antigen-
specific T cells as compared to the benchmark antibody, including CD8+ T
cells.
Next to reinvigorating existing cytotoxic T cell responses against the tumor
by activating antigen-experienced CD8 T cells, CD137xPD-L1 bispecific
antibodies
may enhance de novo CD8+ T cell anti-tumor responses. Tumor (neo)antigens shed
into the environment by dying tumor cells or tumor cells engulfed by antigen
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
79
presenting cells are transported to draining lymph nodes or tertiary lymphoid
structures, which are ectopic lymphoid formations found in tumoral tissues. In
the
local tumor environment, the tumor antigens are presented to naive CD8+ T
cells
that will expand and differentiate upon antigen-recognition.
As shown in the Examples, an antibody according to the invention can
enhance T cell expansion following CD8+ T cell priming to a higher extent as
compared to benchmark antibodies based on Urelumab or based on Atezolizumab.
In the Examples it has been demonstrated that an antibody according to the
invention can induce both expansion and differentiation of antigen-specific
CD8+
T cells, greater than a mixture of benchmark antibodies based on Urelumab and
based on Atezolizumab, which will facilitate the generation of large
populations of
tumor-specific memory and terminally differentiated killer T cells.
An antibody or variant thereof and in particular a bispecific antibody or a
variant thereof according to the invention may have fewer side effects than a
combination of bivalent monospecific antibodies with the variable domains.
Combinations of antibodies that block inhibitory and/or costimulatory
molecules
benefit patients that do not respond to existing immunotherapies. However,
dual
blockade of immuno-modulatory receptors (iMODs) has been shown to increase
immune-related toxicity. An antibody or variant thereof and in particular a
bispecific antibody or a variant thereof according to the invention is suited
to
address dual blockade of iMODs, as they can exert functional activities that
cannot
be reproduced by monoclonal antibody combinations, and can more selectively
target specific cell populations, which reduces safety liabilities in
patients. Without
being bound to any theory, it is believed that the reduced chance of adverse
side
effects of a bispecific antibody or variant of the invention, as compared to
(a
combination of) monospecific antibodies, is at least in part because a
bispecific
antibody or variant of the invention typically exhibits T cell activation in.
trans,
whereas it has a low in. cis T cell activation activity. Use of an antibody
with low in.
cis T cell activation activity in context of the present invention is
preferred because
this diminishes the potential non-specific T cell response. An antibody or
bispecific
antibody or a functional part, derivative and/or analogue thereof according to
the
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
invention has less immune-related toxicity than a combination of bivalent
monospecific antibodies with the variable domains.
In view of the above, a bispecific antibody according to the present
invention,
or a functional part, derivative and/or analogue thereof, is preferred for
therapeutic
5 applications.
The antibodies were produced as bispecific antibodies by cloning them into
complementary expression vectors that contain mutations in the CH3 region that
drives hetero-dimerization of heavy chains. Many bispecific antibodies were
10 produced at small scale and tested in binding and functional assays on
cancer cell
lines. An antibody of the invention, particularly a bispecific antibody of the
invention can combine low toxicity profiles with high efficacy. An antibody of
the
invention can be useful in various types and lines of immune targeted
therapies.
An antibody of the invention can have an increased therapeutic window when
15 compared to an antibody that binds the same antigen(s) with both arms.
Further provided is a use of a bispecific antibody according to the invention
or
a functional part, derivative and/or analogue thereof, for the preparation of
a
medicament for the treatment or prevention of aberrant cells, a tumor and/or
the
20 formation of metastases. The tumor from which said metastases originate
is
preferably a tumor that is positive for said second cell membrane protein,
preferably positive for a member of the B7 family.
Antibodies of the invention can be produced at levels > 50 mg/L after
25 transient transfeetion in suspension 293F cells. The bispecific
antibodies can be
purified to greater than 98% purity with yields > 70%. Analytical
characterization
studies show bispecific lgG1 antibody profiles that are comparable to bivalent
monospecific lgGl.
30 The invention also provides a bispecific antibody or a functional part,
derivative and/or analogue thereof that can bind to an extracellular part of a
membrane associated member of the TNF receptor superfamily and an
extracellular part of a membrane associated second membrane protein,
preferably
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
81
a member of the B7 family. In some embodiments said bispecific antibody or
functional part, derivative or analogue thereof comprises one antigen binding
site
that can bind said member of the TNF receptor superfamily and one antigen
binding site that can bind said second protein, preferably said member of the
B7
family. In some preferred embodiments, the antigen binding part of said
bispecific
antibody or functional part, derivative or analogue of the invention consists
of one
immunoglobulin variable domain that can bind an extracellular part of said
member of the TNF receptor superfamily and one immunoglobulin variable domain
that can bind said member of the B7 family. Said bispecific antibody or
functional
part, derivative or analogue thereof is preferably monovalent for said member
of
the TNF receptor superfamily and monovalent for said member of the B7 family.
Said bispecific antibody is preferably a full length antibody. In some
embodiments,
said bispecific antibody is a full length Igo, i.e. a full length IgGl, IgG2,
IgG3 or
IgG4, preferably a full length IgG1 or a full length IgG4.
The invention also provides a bispecific antibody or a functional part,
derivative and/or analogue thereof, that can bind to an extracellular part of
CD137
and an extracellular part of PD-Li. Said bispecific antibody or functional
part,
derivative or analogue thereof preferably comprises two antigen binding sites.
Said
bispecific antibody or functional part, derivative or analogue thereof
preferably
comprises one antigen binding site that can bind CD137 and one antigen binding
site that can bind PD-L1. In some preferred embodiments, the antigen binding
part
of said bispecific antibody or functional part, derivative or analogue of the
invention consists of one immunoglobulin variable domain that can bind an
extracellular part of CD137 and one immunoglobulin variable domain that can
bind PD-L1. Said bispecific antibody or functional part, derivative or
analogue
thereof is preferably monovalent for CD137 and monovalent for PD-Li. In some
embodiments the antigen binding site that can bind CD137 is able to block the
binding of CD137 to CD137L. In some embodiments the antigen binding site that
can bind CD137 is not able to block the binding of CD137 to CD137L. In some
embodiments the antigen binding site that can bind PD-Li is able to block the
binding of PD-Li to PD-1. In some embodiments the antigen binding site that
can
bind PD-Li is not able to block the binding of PD-Li to P11)-1. Said
bispecific
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
82
antibody is preferably a full length antibody. In some embodiments, said
bispecific
antibody is a full length IgG, i.e. a full length IgGl, IgG2, IgG3 or IgG4,
preferably
a full length IgG1 or a full length IgG4.
Also provided is a method for the treatment of an individual that has a
cancer, the method comprising administering a binding molecule of the
invention
or a bispecific antibody or a functional part, derivative or analogue of the
invention
to the individual in need thereof.
The invention further provides a binding molecule of the invention or a
bispecific antibody or a functional part, derivative or analogue of the
invention, thr
use in the treatment of an individual that has cancer.
Further provided is a cell system comprising an antibody or a bispecific
antibody or a functional part, derivative and/or analogue thereof of the
invention,
and a first cell that expresses a membrane associated member of the TNF
receptor
superfamily and a second cell that expresses a membrane associated second
membrane protein, preferably a member of the B7 family.
The invention provides a method of stimulating activity of a member of the
TNF receptor superfamily on a cell comprising providing a first cell and a
second
cell, wherein said first cell has said member on the cell membrane and said
second
cell has a second membrane protein on the cell membrane, the method comprising
contacting said cells with a bispecific antibody or variant thereof that
comprises
two variable domains, wherein one variable domain comprises a first antigen
binding site that can bind an extracellular part of said member of the TNF
receptor
superfamily, and wherein another variable domain comprises a second antigen
binding site that can bind an extracellular part of said second membrane
protein,
thereby stimulating activity of said member on said first cell. In some
embodiments, said bispecific antibody comprises one antigen binding site that
can
bind said member of the TNF receptor superfamily. In some embodiments, said
method is an in vitro method. In a preferred embodiment said member of the TNF
receptor superfamily is CD137 or 0X40. Said second membrane protein is
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
83
preferably not a member of the TNF receptor superfamily. Said bispecific
antibody
is preferably monovalent for said member of the TNF receptor superfamily and
monovalent for said second membrane protein, preferably monovalent for a
member of the B7 family. Said bispecific antibody is preferably a full length
antibody. In some embodiments, said bispecific antibody is a full length IgG,
i.e. a
full length IgGl, IgG2, IgG3 or IgG4, preferably a full length IgG1 or a full
length
IgG4.
Said first cell preferably does not significantly express said second membrane
protein on the cell membrane. Said second membrane protein is preferably a
.. protein that is present in one or more zones on the cell membrane. Said
zone is
preferably a cluster, domain, micro-domain or compartment on the cell
membrane,
preferably an immunological synapse. Said second membrane protein is
preferably
present on the cell membrane as a part of a multimeric protein comprising two
or
more instances of said second membrane protein. In some embodiments said
second membrane protein is present on the cell membrane as a part of a
homodimer or a homotrimer. In a preferred embodiment said second membrane
protein is a multimeric cytokine receptor, a member of the B7 family, a member
of
the CD28 family; a member of ATP-binding cassette transporters (ABC
transporters); an aquaporin; a member of the serine/threonine kinase receptor
family; a member of the receptor tyrosine kinase family. The second membrane
protein is preferably a member of the B7-family, preferably PD-Li or PD-L2,
preferably PD-L1. In a preferred embodiment the second membrane protein is a
member of the EGF receptor family (ErbB); the RIF receptor family; the FGF
receptor family; the VEGF receptors family; the HGF receptor family; or the
AXL
receptor family. The second membrane protein is preferably a member of the EGF
receptor family (ErbB), preferably EGFR; ErbB-2 or ErbB-3, preferably ErbB-2.
Preferably the variable domain that binds the member of the TNF receptor
superfamily, blocks the binding of a ligand to the member. The variable domain
that binds an extracellular part of said member of the TNF receptor
superfamily is
preferably defined as a variable domain that, when in a bivalent monospecific
antibody format that comprises two of said variable domains that bind said
member of the TNF receptor superfamily, does not stimulate activity of said
TNF
receptor superfamily member on a cell. A method preferably further comprises
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
84
providing a further bispecific antibody comprising an antigen binding site
that can
bind an extracellular part of said member of the TNF receptor superfamily and
an
antigen binding site that can bind an extracellular part of said second
membrane
protein, wherein said first and second bispecific antibodies bind:
- different epitopes on said first membrane protein;
- different epitopes on said second membrane protein; or
- different epitopes on said first membrane protein and different epitopes on
said second membrane protein;
the method further comprising incubating said first and second cell with said
first and second bispecific antibodies, thereby stimulating activity of said
member
of the TNF receptor superfamily on said first cell. In some embodiments, said
method is an in uitro method. In a preferred embodiment the TNF receptor
superfamily member is CD137 or 0X40. In some embodiments said first and said
second bispecific antibody each comprise one antigen binding site that can
bind
said member of the TNF receptor superfamily. Said second membrane protein is
preferably not a member of the TNF receptor superfamily. Said first and/or
said
second bispecific antibody are preferably monovalent for said member of the
TNF
receptor superfamily and monovalent for said second membrane protein,
preferably
monovalent for said member of the B7 family. Said first and/or said second
bispecific antibody is/are preferably a full length antibody. In some
embodiments,
said first and/or said second bispecific antibody is/are a full length IgG,
i.e. a full
length IgC.a, IgG2, IgG3 or IgG4, preferably a full length IgG1 or a full
length
IgG4.
The antigen binding sites of the first and second bispecific antibody that can
bind said second membrane protein, preferably bind different epitopes on the
extracellular part of said second membrane protein. The different epitopes on
the
extracellular part of said second membrane protein are preferably non-
competing
epitopes.
Also provided is a bispecific antibody that comprises an antigen binding site
that can bind an extracellular part of CD137 or 0X40 and an antigen binding
site
that can bind an extracellular part of a second membrane protein. In some
embodiments said bispecific antibody comprises one antigen binding site that
can
bind said CD137 or 0X40. Said second membrane protein is preferably not a
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
member of the TNF receptor superfamily. The second membrane protein is
preferably not to a significant extent expressed by a T-cell. The second
membrane
protein is preferably expressed on an immune cell, a cell of the myeloid
lineage, an
antigen presenting cell, a tumor cell, a virus infected cell or a parasite
infected cell.
r
Preferably said second membrane protein is a protein that is present in one or
more zones on the cell membrane. The zone is preferably a cluster, domain,
micro-
domain or compartment on the cell membrane, preferably an immunological
synapse. In some embodiments said second membrane protein is a protein that is
present on the cell membrane as a part of a multimerie protein comprising two
or
10 more of said second membrane protein. In some embodiments said second
membrane protein is present on the cell membrane as a part of a homodimer or a
homotrimer. Preferably said second membrane protein is a multimeric cytokine
receptor, a member of the B7 family, a member of the CD28 family; a member of
ATP-binding cassette transporters (ABC transporters); an aquaporin; a member
of
15 the serineithreonine kinase receptor family; a member of the receptor
tyrosine
kinase family. The second membrane protein is preferably a member of the B7
family, preferably PD-L1 or PD-L2, preferably PD-L1. In some embodiments the
second membrane protein is a member of the EGF receptor family (ErbB); the
insulin receptor family; the IGF receptor family; the FGF receptor family; the
20 VEGF receptors family; the HGF receptor family; or the AXL receptor
family. In
some embodiments the second membrane protein is a member of the EGF receptor
family (ErbB), preferably EGFR; ErbB-2 or ErbB-3, preferably ErbB-2. The
variable domain that binds said CD137 or 0X40 preferably blocks the binding of
a
ligand to the member. The variable domain that binds an extracellular part of
said
25 CD137 or 0X40 is preferably defined as a variable domain that, when in a
bivalent
monospecific antibody format that comprises two of said variable domains that
bind said CD137 or 0X40, does not stimulate activity of CD137 or 0X40 on a
cell.
Said bispecific antibody is preferably monovalent for CD137 or 0X40 and
monovalent for said second membrane protein. Said bispecific antibody is
30 preferably a full length antibody. In some embodiments, said bispecific
antibody is
a full length IgG, i.e. a full length IgGl, IgG2, IgG3 or IgG4, preferably a
full
length IgG1 or a full length IgG4.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
86
The invention also provides a composition comprising one or more bispecific
antibodies according to the invention. Also provided is a composition or kit
of parts
comprising two or more of the bispecific antibodies of the invention, wherein
the
antigen binding sites that can bind CD137 or OX40 of a first and a second
bispecific
antibody bind different epitopes on said CD137 or 0X40. Also provided is a
method
of stimulating activity of CD137 or 0X40 on a cell comprising providing a
first cell
and a second cell, wherein said first cell has said CD137 or 0X40 (first
membrane
protein) on the cell membrane and said second cell has a second membrane
protein
on the cell membrane, the method comprising contacting said cells with a
bispecific
antibody according to the invention (first bispecific antibody) that comprises
two
variable domains, wherein one variable domain comprises a first antigen
binding
site that can bind an extracellular part of said first membrane protein and
another
variable domain comprises a second antigen binding site that can bind an
extracellular part of said second membrane protein, thereby stimulating
activity of
said first membrane protein on said first cell. In some embodiments said
bispecific
antibody comprises one antigen binding site that can bind said first membrane
protein. In some embodiments, said method is an in uitro method. The method
preferably further comprises providing a further bispecific antibody according
to
the invention (second bispecific antibody) comprising a variable domain with
an
antigen binding site that can bind an extracellular part of said first
membrane
protein; and a variable domain with an antigen binding site that can bind an
extracellular part of said second membrane protein, wherein said first and
second
bispecific antibody bind:
- different epitopes on said first membrane protein;
- different epitopes on said second membrane protein; or
- different epitopes on said first membrane protein; and different epitopes on
said second membrane protein;
the method further comprising incubating said first and second cell with said
first and second bispecific antibody, thereby stimulating activity of CD137 or
0X40
on said first cell. The second membrane protein is preferably a member of the
B7
family, more preferably PD-L1.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
87
An antibody that is defined by an MF sequence as indicated herein below is
preferably a bispecific antibody that has two different variable domains,
wherein
one of these variable domains comprises the indicated sequence.
An antibody or a functional part, derivative and/or analogue thereof that
comprises a variable domain that can bind to an extra-cellular part of CD137
preferably comprises a heavy chain variable region with a CDR3 region that
comprises the amino acid sequence of the CDR3 region of the variable heavy
chain
region of MF6754; MF6763; MF6785; or MF6797 (Figure 3).
An antibody or a functional part, derivative and/or analogue thereof that
comprises a variable domain that can bind to an extra-cellular part of CD137
preferably comprises a heavy chain variable region with a CDR1, CDR2 and CDR3
region that comprises the amino acid sequence of the CDR1, CDR2 and CDR3 of a
variable heavy chain region of one of the VH depicted for MF6754; MF6763;
MF6785; or MF6797 (Figure 3). The CDR1, CDR2 and CDR3 sequences are
preferably selected from the same VH region.
An antibody or a functional part, derivative and/or analogue thereof that
comprises a variable domain that can bind to an extra-cellular part of CD137
preferably comprises the amino acid sequence of the variable heavy chain
region of
MF6754; MF6763; MF6785; or MF6797 having at most 15, preferably 0, 1, 2, 3, 4,
5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of the indicated MF. The amino acid insertion(s),
deletion(s),
substitution(s) or a combination thereof, if any, are preferably not in the
amino
acid sequence of the CDR regions.
An antibody or a functional part, derivative and/or analogue thereof that
comprises a variable domain that can bind to an extra-cellular part of PD-Li
preferably comprises a heavy chain variable region with a CDR3 region that
comprises the amino acid sequence of the CDR3 region of the variable heavy
chain
region of MF5554; MF5576; MF5578; MF9375; MF9376; MF7702; MF5424;
MF5561; MF5439; MF5553; MF5594; MF5426; MF5442 or MF5361 (Figure 3).
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
88
An antibody or a functional part, derivative and/or analogue thereof that
comprises a variable domain that can bind to an extra-cellular part of PD-Li
preferably comprises a heavy chain variable region with a CDR1, CDR2 and CDR3
region that comprises the amino acid sequence of the CDR1, CDR2 and CDR3 of a
variable heavy chain region of one of the VH depicted for MF5554; MF5576;
MF5578; MF9375; MF9376; MF7702; MF5424; MF5561; MF5439; MF5553;
MF5594; MF5426; MF5442 or MF5361 (Figure 3). The CDR1, CDR2 and CDR3
sequences are preferably selected from the same VH region.
An antibody or a functional part, derivative and/or analogue thereof that
comprises a variable domain that can bind to an extra-cellular part of PD-Li
preferably comprises the amino acid sequence of the variable heavy chain
region of
MF5554; MF5576; MF5578; MF9375; MF9376; MF7702; MF5424; MF5561;
MF5439; MF5553; MF5594; MF5426; MF5442 or MF5361 having at most is,
preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2,
3, 4 or 5
amino acid insertions, deletions, substitutions or a combination thereof with
respect to the amino acid sequence of the VH of the indicated MF. The amino
acid
insertion(s), deletion(s), substitution(s) or a combination thereof, if any,
are
preferably not in the amino acid sequence of the CDR regions.
An antibody or a functional part, derivative and/or analogue thereof
preferably comprises a variable domain that can bind to an extracellular part
of
CD137 that blocks the binding of CD137 to CD137 ligand and a variable domain
that can bind to an extracellular part of PD-L1 that blocks the binding of PD-
1 to
PD-Li. The variable domain that binds an extracellular part of PD-Li in this
antibody or a functional part, derivative and/or analogue thereof preferably
comprises a VH region with the amino acid sequence of the CDR3 or the amino
acid
sequence of the CDR1, CDR2 and CDR3 of one of the VH of MF5554; MF5576;
MF5578; MF9375; MF9376; MF7702; MF5424; MF5561; MF5439; MF5553;
MF5594; MF5426; MF5442 or MF5361 (Figure 3). In a preferred embodiment, the
variable domain that binds an extracellular part of PD-Li comprises a VH
region
with the amino acid sequence of a VH of MF5554; MF5576; MF5578; MF9375;
MF9376; MF7702; MF5424; MF5561; MF5439; MF5553; MF5594; MF5426;
MF5442 or MF5361 having at most 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or
10 and
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
89
preferably having 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions,
substitutions or
a combination thereof with respect to the amino acid sequence of the VH of the
indicated MF.
The variable domain that binds an extracellular part of CD137 in this
antibody or a functional part, derivative and/or analogue thereof preferably
comprises a VH region with the amino acid sequence of the CDR3 or the amino
acid
sequence of the CDR1, CDR2 and CDR3 of one of the VH of MF6754; MF6763;
MF6785; or MF6797 (Figure 3). In a preferred embodiment, the variable domain
that binds an extracellular part of CD137 comprises a VH region with the amino
.. acid sequence of the VH of MF6754; MF6763; MF6785; or MF6797 having at most
15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1,
2, 3, 4 or 5
amino acid insertions, deletions, substitutions or a combination thereof with
respect to the amino acid sequence of the VH of the indicated MF. The amino
acid
insertion(s), deletion(s), substitution(s) or a combination thereof, if any,
are
preferably not in the amino acid sequence of the CDR regions. A particularly
preferred combination in this antibody or functional part, derivative and/or
analogue is the combination of variable domains that comprise the indicated
sequence or variant thereof of MF6797 and MF7702; MF6763 and MF7702;
MF6785 and MF7702; MF6797 and MF5553; MF6763 and MF5553; MF6785 and
MF5553; MF6754 and MF5424; MF6763 and MF5561; MF6785 and MF5439;
MF6797 and MF5553; MF6744 and MF5594; MF6744 and MF5361; MF6783 and
MF5361; or MF6783 and MF5594.
An antibody or a functional part, derivative and/or analogue thereof as
described herein preferably comprises
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 or the amino acid sequence of the CDR1, CDR2
and CDR3 of the VH of MF6754; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 or the amino acid sequence of the CDR1, CDR2
and CDR3 of the VH of MF5554; MF5576; MF5578; MF9375; MF9376; MF7702;
MF5594; MF5424; MF5426; MF5553; MF5442; MF5561; MF5439 or MF5361
(Figure 3).
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
An antibody or a functional part, derivative and/or analogue thereof
preferably comprises
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6754 having at most 15, preferably 0, 1, 2,
3,
5 4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino
acid insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MFG 754 and;
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5554; MF5576; MF5578; MF9375; MF9376;
10 MF7702; MF5594; MF5424; MF5426; MF5553; MF5442; MF5561; MF5439 or
MF5361 (Figure 3) having at most 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9
or 10 and
preferably having 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions,
substitutions or
a combination thereof with respect to the amino acid sequence of the VH of the
indicated MF.
1,5
An antibody or a functional part, derivative and/or analogue thereof as
described herein preferably comprises
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 or the amino acid sequence of the CDR1, CDR2
20 and CDR3 of the VH of MF6763; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 or the amino acid sequence of the CDR1, CDR2
and CDR3 of the VH of MF5554; MF5576; MF5578; MF9375; MF9376; MF7702;
MF5594; MF5424; MF5426; MF5553; MF5442; MF5561; MF5439 or MF5361
25 (Figure 3).
An antibody or a functional part, derivative and/or analogue thereof
preferably comprises
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6763 having at most 15, preferably 0, 1, 2,
3,
30 4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino
acid insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6763 and;
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
91
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5554; MF5576; MF5578; MF9375; MF9376;
MF7702; MF5594; MF5424; MF5426; MF5553; MF5442; MF5561; MF5439 or
MF5361 (Figure 3) having at most 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9
or 10 and
preferably having 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions,
substitutions or
a combination thereof with respect to the amino acid sequence of the VH of the
indicated MF.
An antibody or a functional part, derivative and/or analogue thereof as
described herein preferably comprises
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 or the amino acid sequence of the CDR1, CDR2
and CDR3 of the VH of MF6785; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 or the amino acid sequence of the CDR1, CDR2
and CDR3 of the VH of MF5554; MF5576; MF5578; MF9375; MF9376; MF7702;
MF5594; MF5424; MF5426; MF5553; MF5442; MF5561; MF5439 or MF5361
(Figure 3).
An antibody or a functional part, derivative and/or analogue thereof
preferably comprises
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6785 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6785 and;
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5554; MF5576; MF5578; MF9375; MF9376;
MF7702; MF5594; MF5424; MF5426; MF5553; MF5442; MF5561; MF5439 or
MF5361 (Figure 3) having at most 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9
or 10 and
preferably having 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions,
substitutions or
a combination thereof with respect to the amino acid sequence of the VH of the
indicated MF.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
92
An antibody or a functional part, derivative and/or analogue thereof as
described herein preferably comprises
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 or the amino acid sequence of the CDR1, CDR2
and CDR3 of the VH of MF6797; and
- a PD-L1 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 or the amino acid sequence of the CDR1, CDR2
and CDR3 of the VH of MF5554; MF5576; MF5578; MF9375; MF9376; MF7702;
MF5594; MF5424; MF5426; MF5553; MF5442; MF5561; MF5439 or MF5361
(Figure 3).
An antibody or a functional part, derivative and/or analogue thereof
preferably comprises
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6797 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6797 and;
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5554; MF5576; MF5578; MF9375; MF9376;
MF7702; MF5594; MF5424; MF5426; MF5553; MF5442; MF5561; MF5439 or
MF5361(Figure 3) having at most 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or
10 and
preferably having 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions,
substitutions or
a combination thereof with respect to the amino acid sequence of the VH of the
indicated MF.
As shown in the Examples, an antibody with a PD-L1 binding variable
domain that is based on MF5553 provides particularly good T cell activation
results
in combination with different CD137 binding variable domains, including
MF6754,
MF6763, MF6785 and MF6797.
Further provided is therefore a bispecific antibody or a functional part,
derivative and/or analogue thereof that comprises:
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
93
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF6754; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF5553.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF6754;
and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5553.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6754 having at most is, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF6754 and:
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5553 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF5553.
Further provided is a bispecific antibody or a functional part, derivative
and/or analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MFG 763; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF5553.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
94
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF6763;
and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5553.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6763 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6763 and;
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5553 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF5553.
Further provided is a bispecific antibody or a functional part, derivative
and/or analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MFG 785; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF5553.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF6785;
and
- a PD-L1 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5553.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6785 having at most 15, preferably 0, 1, 2,
3,
5 4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino
acid insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MFG 785 and;
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5553 having at most 15, preferably 0, 1, 2,
3,
10 4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino
acid insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF5553.
Further provided is a bispecific antibody or a functional part, derivative
15 and/or analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF6797; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF5553.
20 Also provided is a bispecific antibody or a functional part, derivative
and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF6797;
and
25 - a PD-L1 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5553.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
30 - a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6797 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
96
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6797 and;
- a PD-L1 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5553 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF5553.
It is furthermore shown in the Examples that an antibody with a PD-Li
binding variable domain that is based on MF7702 provides particularly good T
cell
activation results in combination with different CD137 binding variable
domains,
including MF6763, MF6785 and MF6797.
Further provided is therefore a bispecific antibody or a functional part,
derivative and/or analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF6797; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF7702.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF6797;
and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF7702.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6797 having at most is, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
97
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6797 and;
- a PD-L1 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF7702 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF7702.
Further provided is a bispecifie antibody or a functional part, derivative
and/or analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF6763; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF7702.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF6763;
and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF7702.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6763 having at most is, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6763 and;
- a PD-L1 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF7702 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
98
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF7702.
Further provided is a bispecific antibody or a functional part, derivative
and/or analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF6785; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF7702.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF6785;
and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF7702.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6785 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6785 and;
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF7702 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF7702.
It is furthermore shown in the Examples that a bispecific antibody with a
CD137 binding variable domain that is based on MF6744 and a PD-Li binding
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
99
variable domain that is based on MF5594 provides particularly good T cell
activation; see for instance Figures 14-16. Importantly, such antibody has a
stronger T cell activation potential as compared to an antibody that is based
on the
antibody Urelumab.
Further provided is therefore a bispecific antibody or a functional part,
derivative and/or analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF6744; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF5594.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF6744;
and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5594.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6744 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6744 and;
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5594 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF5594.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
100
It is furthermore shown in the Examples that a bispecific antibody with a
CD137 binding variable domain that is based on MF6744 and a PD-Li binding
variable domain that is based on MF5361 provides particularly good T cell
activation; see for instance Figures 14-16. Importantly, such antibody has a
.. stronger T cell activation potential as compared to an antibody that is
based on the
antibody Urelumab.
Further provided is therefore a bispecific antibody or a functional part,
derivative and/or analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF6744; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF5361.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF6744;
and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5361.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6744 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6744 and;
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5361 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF5361.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
101
It is furthermore shown in the Examples that a bispecific antibody with a
CD137 binding variable domain that is based on MF6783 and a PD-Li binding
variable domain that is based on MF5361 provides particularly good T cell
activation; see for instance Figures 14-15. Importantly, such antibody has a
stronger T cell activation potential as compared to an antibody that is based
on the
antibody Urelumab.
Further provided is therefore a bispecific antibody or a functional part,
derivative and/or analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF6783; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF5361.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF6783;
and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5361.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6783 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6783 and;
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5361 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF5361.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
102
It is furthermore shown in the Examples that a bispecific antibody with a
CD137 binding variable domain that is based on MF6783 and a PD-Li binding
variable domain that is based on MF5594 provides particularly good T cell
activation; see for instance Figures 14-15.
Further provided is therefore a bispecific antibody or a functional part,
derivative and/or analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF6783; and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 region of the VH of MF5594.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF6783;
and
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5594.
Also provided is a bispecific antibody or a functional part, derivative and/or
analogue thereof that comprises:
- a CD137 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6783 having at most 15, preferably 0, 1, 2,
3,
4, 5, (3, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the amino acid sequence of the VH of MF6783 and;
- a PD-Li binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF5594 having at most 15, preferably 0, 1, 2,
3,
4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino acid
insertions,
deletions, substitutions or a combination thereof with respect to the amino
acid
sequence of the VH of MF5594.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
103
In addition, it is shown in the Examples that a combination of a bispecific
antibody with a CD137 binding variable domain that is based on MF6744 and a
PD-L1 binding variable domain that is based on MF5361, together with a
bispecific
antibody with a CD137 binding variable domain that is based on MF6744 and a
r
PD-Li binding variable domain that is based on MF5594 (applied as a dual
bispecific, e.g., Oligoelonics embodiment) provides a superior T cell
activation (see
Figures 14-16) and superior to an antibody that is based on Urelumab.
Further provided is therefore a mixture or kit of parts, comprising:
- a first bispecific antibody or a functional part, derivative and/or analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the CDR3 region of the VH of MF6744, and a
PD-Li binding variable domain comprising a VH region with the amino acid
sequence of the CDR3 region of the VH of MF5594; and
- a second bispecific antibody or a functional part, derivative and/or
analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the CDR3 region of the VH of MF6744 and a
PD-Li binding variable domain comprising a VH region with the amino acid
sequence of the CDR3 region of the VH of MF5361.
Also provided is a mixture or kit of parts, comprising:
- a first bispecific antibody or a functional part, derivative and/or analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of
MF6744, and a PD-Li binding variable domain comprising a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5594;
and
- a second bispecific antibody or a functional part, derivative and/or
analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the CDR.1, CDR2 and CDR3 regions of the VH of
MF6744, and a PD-Li binding variable domain comprising a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5361.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
104
Also provided is a mixture or kit of parts, comprising:
- a first bispecific antibody or a functional part, derivative and/or analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the VH of MF6744 having at most 15, preferably
0,
0 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5
amino acid
insertions, deletions, substitutions or a combination thereof with respect to
the
amino acid sequence of the VH of MF6744, and a PD-Li binding variable domain
comprising a VH region with the amino acid sequence of the VH of MF5594 having
at most 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 and preferably
having 0, 1, 2, 3,
4 or 5 amino acid insertions, deletions, substitutions or a combination
thereof with
respect to the amino acid sequence of the VH of MF5594; and
- a second bispecific antibody or a functional part, derivative and/or
analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the VH of MF6744 having at most 15, preferably
0,
1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino
acid
insertions, deletions, substitutions or a combination thereof with respect to
the
amino acid sequence of the amino acid sequence of the VH of MF6744, and a PD-
L1
binding variable domain that comprises a VH region with the amino acid
sequence
of the VH of MF5361 having at most 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9
or 10
and preferably having 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions,
substitutions or a combination thereof with respect to the amino acid sequence
of
the VH of MF5361.
In addition, it is shown in the Examples that a combination of a bispecific
antibody with a CD137 binding variable domain that is based on MF6744 and a
PD-Li binding variable domain that is based on MF5361, together with a
bispecific
antibody with a CD137 binding variable domain that is based on MF6783 and a
PD-L1 binding variable domain that is based on MF5594 (applied as a dual
bispecific, e.g., Oligoclonicsk embodiment) provides superior T cell
activation as
compared to an antibody that is based on Urelumab.
Further provided is therefore a mixture or kit of parts, comprising:
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
105
- a first bispecific antibody or a functional part, derivative and/or analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the CDR3 region of the VH of MF6783, and a
PD-Li binding variable domain comprising a VH region with the amino acid
sequence of the CDR3 region of the VH of MF5594; and
- a second bispecific antibody or a functional part, derivative and/or
analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the CDR3 region of the VH of MFG 744 and a
PD-L1 binding variable domain comprising a VH region with the amino acid
sequence of the CDR3 region of the VH of MF5361.
Also provided is a mixture or kit of parts, comprising:
- a first bispecific antibody or a functional part, derivative and/or analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the CDR.1, CDR2 and CDR3 regions of the VH of
MF6783, and a PD-Li binding variable domain comprising a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5594;
and
- a second bispecific antibody or a functional part, derivative and/or
analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the CDR.1, CDR2 and CDR3 regions of the VH of
MF6744, and a PD-Li binding variable domain comprising a VH region with the
amino acid sequence of the CDR1, CDR2 and CDR3 regions of the VH of MF5361.
Also provided is a mixture or kit of parts, comprising:
- a first bispecific antibody or a functional part, derivative and/or analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the VH of MF6783 having at most 15, preferably
0,
1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino
acid
.. insertions, deletions, substitutions or a combination thereof with respect
to the
amino acid sequence of the VH of MF6783, and a PD-Li binding variable domain
comprising a VH region with the amino acid sequence of the VH of MF5594 having
at most 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 and preferably
having 0, 1, 2, 3,
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
106
4 or 5 amino acid insertions, deletions, substitutions or a combination
thereof with
respect to the amino acid sequence of the VH of MF5594; and
- a second bispecific antibody or a functional part, derivative and/or
analogue
thereof that comprises a CD137 binding variable domain comprising a VH region
with the amino acid sequence of the VH of MF6744 having at most 15, preferably
0,
1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino
acid
insertions, deletions, substitutions or a combination thereof with respect to
the
amino acid sequence of the amino acid sequence of the VH of MF6744, and a PD-
L1
binding variable domain that comprises a VH region with the amino acid
sequence
of the VH of MF5361 having at most 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9
or 10
and preferably having 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions,
substitutions or a combination thereof with respect to the amino acid sequence
of
the VH of MF5361.
It is also shown in the Examples that the binding of the CD137-specific VH of
MF6797, which has good T cell activating properties, is associated with the
presence of amino acids comprising Arg66, Gly70 and Phe72 of the CD137 amino
acid sequence as depicted in Figure 42.
The invention therefore also provides an isolated, synthetic or recombinant
antibody, or a functional part, derivative and/or analogue thereof, that is
able to
bind to CD137, wherein the binding of said antibody or functional part,
derivative
or analogue to CD137 is associated with the presence of amino acids comprising
Arg66, Gly70 and Phe72 of the CD137 amino acid sequence as depicted in Figure
42. The binding of said antibody or functional part, derivative or analogue to
CD137 is preferably also associated with an amino acid comprising Va171 of the
CD137 amino acid sequence as depicted in Figure 42.
The term "Arg66" refers to the arginine residue at position 66 of the CD137
sequence as depicted in Figure 42. The term "Gly70" refers to the glycine
residue at
position 70 of the CD137 sequence as depicted in Figure 42. The term "Va171"
refers to the valine residue at position 71 of the CD137 sequence as depicted
in
Figure 42. The term "Phe72" refers to the phenylalanine residue at position 72
of
the CD137 sequence as depicted in Figure 42.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
107
The binding of an antibody or functional part, derivative or analogue to
CD137 is associated with the presence of the recited amino acid residues if,
when
any one of these residues is substituted by alanine, binding of the antibody
or
functional part, derivative or analogue to the resulting CD137 protein is
reduced.
Some embodiments provide an isolated, synthetic or recombinant antibody, or
a functional part, derivative and/or analogue thereof, that is able to bind to
CD137,
wherein said antibody or functional part, derivative or analogue specifically
binds
amino acids Arg66, Gly70 and Phe72 of the CD137 amino acid sequence as
depicted
in Figure 42. Said antibody or functional part, derivative or analogue
preferably
also specifically binds amino acid Va171 of the CD137 amino acid sequence as
depicted in Figure 42.
Some preferred embodiments provide a bispecific antibody, or a functional
part, derivative and/or analogue thereof, that is able to bind to CD137 and to
PD-Li and that has a CD137 binding variable domain based on MF6797 and a
PD-Li binding variable domain based on MF7702. The binding of such bispecific
antibody, which has particularly good T cell activating properties, to CD137
and
PD-Li is associated with amino acids comprising the above mentioned CD137
amino acid residues.
Now that the above mentioned CD137 amino acid residues have been
identified, it has become possible to generate or select antibodies, or
variants
thereof, that specifically bind these amino acid residues. Generation and/or
selection of binding molecules that specifically bind certain amino acid
residues can
be done using methods well known in the art, such as for instance by
immunizing a
transgenic non-human animal capable of generating antibodies with an antigen
fragment containing the particular domain comprising the target amino acid
residues. Alternatively, by screening an antibody phage display library, for
phage
that bind to identified amino acid residues.
Further provided is an antibody or a variant thereof that competes with
antibody PB17311 for binding to CD137 and/or PD-L1. A competing antibody or
variant thereof is for instance identified using a competition assay wherein
cells
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
108
comprising CD137 and/or PD-Li are incubated with PB17311 and with candidate
antibodies or variants thereof. Candidate antibodies or variants thereof that
are
capable of diminishing the amount of bound PB17311, as compared to a control
wherein the cells comprising CD137 and/or PD-Li are incubated with PB17311
without the candidate antibodies or variants thereof, are competing antibodies
or
variants.
Some embodiments provide an isolated, synthetic or recombinant antibody, or
a functional part, derivative and/or analogue thereof, that competes with
antibody
PB17311 for binding to C,D137 and/or PD-Li.
Some embodiments provide an isolated, synthetic or recombinant antibody, or
a functional part, derivative and/or analogue thereof, that competes with
antibody
PB17311 for binding to amino acids Arg66, Gly70 and Phe72 of the CD137 amino
acid sequence as depicted in Figure 42, more preferably for binding to amino
acids
Arg66, Gly70, Va171 and Phe72 of the CD137 amino acid sequence as depicted in
Figure 42.
Some embodiments provide an isolated, synthetic or recombinant antibody, or
a functional part, derivative and/or analogue thereof, that competes with
antibody
PB17309 for binding to CD137 and/or PD-Li.
Some embodiments provide an isolated, synthetic or recombinant antibody, or
a functional part, derivative and/or analogue thereof, that competes with
antibody
PB17310 for binding to CD137 and/or PD-L1.
Antibodies or variants thereof that compete with PB17309 or PB17310 for
binding to CD137 and/or PD-Li are for instance isolated using a competition
assay
wherein binding of PB17309 or PB17310 to cells comprising CD137 and/or PD-Li
in the absence of a candidate antibody or variant thereof is compared with the
binding of PB17309 or PB17310 to cells comprising CD137 and/or PD-L1 in the
presence of said candidate antibody or variant thereof. A candidate antibody
or
variant thereof that is capable of diminishing the amount of bound PB17309 or
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
109
PB17310, as compared to a control wherein the cells comprising CD137 and/or
PD-L1 are incubated with PB17309 or PB17310 without said candidate antibody or
variant thereof, is identified as a competing antibody or variant thereof.
An 0X40 x PD-Li bispecifie antibody or a functional part, derivative and/or
analogue thereof as described herein preferably comprises
- an 0X40 binding variable domain that comprises a VH region with the
amino acid sequence of the CDR3 or the amino acid sequence of the CDR1, CDR2
and CDR3 of the VH of MF6629; MF6630; MF6637; MF6643; MF6645; MF6648;
MF6655; MF6658; MF6660; MF6675; MF6686; MF6690; MF6692; MF6700;
MF6706; MF6714; MF6721; MF6722; MF6724; MF6728; MF6729; MF6826;
MF6940; MF6942; MF6943; MF6944; MF6947; MF6949; MF7331; MF7332;
MF7334; MF7341; MF7345; MF7350; MF7351; MF7352; MF7353; MF7356;
MF7358; MF7365; MF7366; MF7371; MF7372; MF7374; MF7378; MF7382;
MF7383; MF7394; MF7395; or MF7397; and
- a PD-Li binding variable domain. The PD-L1 binding variable domain
preferably comprises a VH region with the amino acid sequence of the CDR3 or
the
amino acid sequence of the CDR1, CDR2 and CDR3 of the VH of a PD-L1 specific
VH as depicted in figure 3. In a preferred embodiment of a PD-Li specific VH
as
depicted for MF5594; MF5424; MF5426; MF5553; MF5442; MF5561; MF5426; or
MF5439 (Figure 3).
An antibody or a functional part, derivative and/or analogue thereof
preferably comprises
- an 0X40 binding variable domain that comprises a VH region with the
amino acid sequence of the VH of MF6629; MF6630; MF6637; MF6643; MF6645;
MF6648; MF6655; MF6658; MF6660; MF6675; MF6686; MF6690; MF6692;
MF6700; MF6706; MF6714; MF6721; MF6722; MF6724; MF6728; MF6729;
MF6826; MF6940; MF6942; MF6943; MF6944; MF6947; MF6949; MF7331;
MF7332; MF7334; MF7341; MF7345; MF7350; MF7351; MF7352; MF7353;
MF7356; MF7358; MF7365; MF7366; MF7371; MF7372; MF7374; MF7378;
MF7382; MF7383; MF7394; MF7395; or MF7397 having at most 15, preferably 0,
1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 and preferably having 0, 1, 2, 3, 4 or 5 amino
acid
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
110
insertions, deletions, substitutions or a combination thereof with respect to
the
amino acid sequence of the amino acid sequence of the indicated VH and;
- a PD-L1 binding variable domain. The PD-Li binding variable domain
preferably comprises a VH region with the amino acid sequence of the VH of
r
wiF5594; MF5424; MF5426; MF5553; MF5442; MF5561; MF5426; or MF5439
(Figure 3) having at most 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10
and
preferably having 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions,
substitutions or
a combination thereof with respect to the amino acid sequence of the VH of the
indicated MF (Figure 3).
The mentioned at most 15, preferably 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 and
preferably 1, 2, 3, 4 or 5 amino acid substitutions in the mentioned H, VH, L
and
VL regions are preferably conservative amino acid substitutions, the
insertions,
deletions, substitutions or a combination thereof are preferably not in the
CDR3
region of the H, VH, L or VL chain, preferably not in the CDR1, CDR2 or CDR3
region of the VH or VL chain and preferably not in the FR.4 region.
For the purpose of clarity and a concise description features are described
herein as part of the same or separate embodiments, however, it will be
appreciated that the scope of the invention may include embodiments having
combinations of all or some of the features described.
The invention is further explained in the following examples. These examples
do not limit the scope of the invention, hut merely serve to clarify the
invention.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
ill
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1. Common light chain used in mono- and bispecific IgG.
Figure 1A: Common light chain amino acid sequence. Figure 1B: Common light
chain variable domain DNA sequence and translation (IGKV1-39/jkl). Figure 1C:
Common light chain constant region DNA sequence and translation. Figure 1D:
IGKV1-39/jk5 common light chain variable domain translation. Figure 1E: V-
region IGKV1-39A
Figure 2. IgG heavy chains for the generation of bispecific molecules. Figure
2A:
VH is nucleic acid encoding the amino acid sequence for an MF depicted in
Figure
3. Figure 2B: CH1 region. Figure 2C: hinge region. Figure 211): CH2 region.
Figure
2E: CH2 containing L235G and G238R substitutions. Figure 2F: CH3 domain
containing substitutions L351K and T366K (KK). Figure 2G; CH3 domain
containing substitutions L351D and L368E (DE)
Figure 3. Amino acid sequences of heavy chain variable regions. Figure 3A: VH
sequences of CD137 specific clones. Figure 3B: VH sequences of PD-Li specific
clones. Figure 3C; VH sequences of 0X40 specific clones. Figure 3D: VH
sequences
of PD-L1 specific clones.
The notation MF refers to a fab containing a heavy chain variable region as
depicted and a common light chain. The amino acid sequence of the light chain
is
indicated in figure 1A. The underlined sequences indicate per amino acid
sequence
respectively the CDRL the CDR2 and the CDR3 region according to Kabat
numbering.
Figure 4. Vector map and features of pIRES-Neo3 (MV1363).
Figure 5. Vector map and features of pVAX1.
Figure 6. Vector map and features of the phagemid vector MV1473 used to
generate 'immune' phage display libraries.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
112
Figure 7. Vector map and features of the IgG expression vector MV1452 or
MV1453, that were used for expression of the CD137, PD-1, PD-Li and 0X40
specific Fab arms in the KK-variant heavy chain or the DE variant heavy chain,
respectively, for bispecific IgG generation.
Figure 8. Amino acid sequence of the VH gene that is tetanus toxin specific
when
combined with the common light chain as MF1337, and that is present in the DE-
variant heavy chain that was used to generate PD-L1xTT bispecific IgG
molecules.
The underlined sequences indicate per amino acid sequence respectively the
CDR1,
the CDR2 and the CDR3 region.
Figure 9. Vector map and features of the IgG expression vector MV1377, that
was
used for expression of the TT specific Fab arm MF1337 in the DE-variant heavy
chain for bispecific IgG generation.
Figure 10. PD-1/PD-L1 blocking assay.
Assessment of the capacity of the anti-PD-Li antibody panel to block the
interaction of PD-Li to coated PD-1 at a concentration of 10 itg/mlbispecific
IgG.
Data are normalized to data obtained with the bivalent benchmark PD-Li
antibody
MPDL3280A at a concentration of 10 itg/ml (100% blocking). A representative
example is shown of the P11)-L1 panel. Maximum binding (normalized to 0%
blocking) was established by incubation with a non-PD-1/PD-L1 specific human
isotype antibody. All PD-Li variable domains comprising MF sequences depicted
in
Figure 3 and not represented here block the PD-1/PD-L1 interaction >70%.
Figure 11. Activation of CD137 in Jurkat CD137-NFkBluc cells by bivalent CD137
antibodies
Figure 12. Activation of CD137 in Jurkat CD137-NFkBluc cells by CD137xPD-L1
antibodies in the absence (left) or presence of a IgG cross linking antibody
(right).
MF numbers refer to CD137 Fabs present in the CD137xPD-L1 bispecific
antibodies.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
113
Figure 13. Activation of primary T cells by bivalent CD137 antibodies (top) or
monovalent antibodies (bottom) in combination with a PD-Li Fab arm (MF5594) as
measured by IL-2 release.
PG6744: bivalent CD137 antibody containing two MF6744 arms (also denoted as
6744x6744).
PG6783: bivalent CD137 antibody containing two MF6783 arms (also denoted as
6783x6783).
PG6860: bivalent CD137 antibody containing two MF6860 arms (also denoted as
6860x6860).
20H4.9: anti-CD137 reference antibody based on WO 2005/035584.
Figure 14. Activation of CD137 on Jurkat-CD137-luc cells in the presence of
CHO
cells overexpressing PD-Li or CHO wildtype cells. CD137 activation was
measured by luciferase expression.
PG6744: bivalent CD137 antibody (6744x6744)
PB14671: bispecific CD137xPD-L1 antibody (6744x5361)
PB14580: bispecific CD137xPD-L1 antibody (6744x5594)
PB14890: bispecific CD137xTT antibody (6744x1337)
PG6783: bivalent CD137 antibody (6783x6783)
PB14681: bispecific CD137xPD-L1 antibody (6783x5361)
PB14590: bispecific CD137xPD-L1 antibody (6783x5594)
PB15855: bispecific CD137xTT antibody (6783x1337)
20H4.9: anti-CD137 reference antibody based on WO 2005/035584
Figure 15. Activation of primary T cells by bivalent CD137 antibodies,
CD137xPD-
L1 bispecific antibodies or CD137xPD-L1 Oligoclonics combinations in the
presence of CHO cells overexpressing PD-Li or CHO wild type cells. Activation
was measured by IL-2 release.
PG6744: bivalent CD137 antibody (6744x6744)
PB14671: bispecific CD137xPD-L1 antibody (6744x5361)
PB14580: bispecific CD137xPD-L1 antibody (6744x5594)
PB14890: bispecific CD137xTT antibody (6744x1337)
20H4.9: anti-CD137 reference antibody based on WO 2005/035584
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
114
M0R7480: anti-CD137 reference antibody based on US 8,337,850
Figure 16. SEB-stimulation of IL-2 production is enhanced by anti-CD137xPD-L1
bispecific antibody or anti-CD137xPD-L1 Oligoclonics'k in healthy donor blood
cells.
PB14580: bispecific CD137xPD-L1 antibody (6744x5594)
PB14671: bispecific CD137xPD-L1 antibody (6744x5361)
MPDL3280A: anti-PD-Li reference antibody based on WO 2010/077634
PB9469: bispecific PD-L1xTT antibody (5594x1337)
PB14890: bispecific CD137xTT antibody (6744x1337)
20H4.9: anti-CD137 reference antibody based on WO 2005/035584
Ctrl Ab: PG-2708p213; anti RSV-G
Figure 17. SEB-stimulation of IL-2 production in healthy donor blood cells is
dramatically enhanced by anti-CD137xP1I)-L1 bispecific antibodies in
comparison
to the anti-CTLA-4 antibody 10D1 (which is based on ipilumumab)
Figure 18. Activation of OX-40 on Jurkat-OX-40 NFkB-luc cells in the presence
of
CHO cells overexpressing PD-Li (left panel) or CHO wildtype cells (right
panel).
Activation was determined by measuring lueiferase expression. PD-L1 Fab arm
MF5561; PD-1 Fab arm MF6256 (sequence shown in Figure 43).
Figure 19. Screening of CD137 x PD-L1 antibodies in T-cell activation assay
(12
CD137 Fab arms). T cells from a single donor were stimulated for 72H at 37 C
with
a dose dependent titration of the indicated antibody panel below in the
presence of
CHO cells overexpressing PD-L1 (upper panels) or CHO wildtype cells (lower
panels). CD137 activation was measured by the release of IL-2 using AlphaLISA
,
expressed in IL-2 counts. Positive control antibody 20H4.9 (referred to in
this
Figure as PG6619), and the anti-TT negative control antibody PG1337 (Neg Ctrl
Ab)
CA 03038020 2 0 19-03 -22
WO 2018/056821
PCT/NL2017/050634
115
PB MF1 MF2 PB MF1 MF2 PB MF1 MF2 P8
MF1 MF2
P814143 M06783 M06783 P814183 M66763 M06763 P814145
MG6785 M06785 P814134 M06737 M06737
P814590 M06783 MG5594 P814815 M06763 M05561 P814821
MG6785 M05561 P814808 M66737 MG5561
P814820 M06783 M05561 P815143 M66763 M05426 P815149
M66785 M05426 P815136 M06737 M05426
P1315190 M66783 M65424 P817100 M06763 MG5553 P817103
M06785 M05553 P817106 M06737 MG 5553
P815148 M46783 MG5426 P814585 MG5763 M05594 P814591
MG6785 M65594 P814578 M06737 M05594
P817085 M66783 MG5442 P815185 :M06763 M65424 P815191
M06785 MG5424 P815178 MG6737 MG5424
P817097 MG6783 M05553 P817088 M06763 M45442 P817091
Ni106785 M05442 P817094 MG6737 M05442
P1317109 M06783 M05439 P1317112 M66763 M45439 P817115
M06785 MG5439 P817118 M06737 M05439
P814203 M06808 M06808 P814179 :M66754 M06754 P814152
M66825 M06825 P814195 M06797 M06797
P817050 MG6808 M65561 P814814 M06754 MG5561 PB14829p
M46825 M05561 P814823 MG6797 MG5561
P817074 M66808 M05426 P815142 M06754 M05426 P815157
M06825 M05426 P815151 M06797 M05426
P817098 M66808 M05553 P817101 M06754 M65553 P/317104
M06825 MG5553 P817107 M06797 M05553
P816841 M06808 M05594 P814584 MG6754 MG5594 P814605
MG6825 MG5594 P814593 M66797 M05594
P817062 M06808 M05424 P1315184 M66754 M65424 P815199
M36825 M05424 P815193 MG6797 M05424
P1317086 M66808 M65442 P817089 MG6754 MG5442 P817092
MG6825 MG5442 P817095 M06797 MG5442
P817110 MG6808 M65439 P817113 M06754 MG5439 P817116
M06825 M65439 P817119 MG6797 M65439
P814149 M66805 MG6805 P814135 :M06744 M66744 P814138
M06749 MG6749 P814193 M06788 MG6788
P814826 MG6805 M05561 P814810 M06744 MG5561 P814813
MG6749 MG5561 P817060 M46788 MG5561
P815154 MG6805 MG5426 1'1315138p MG6744 M45426
P815141 MG6749 M05426 P1317084 M06788 M05426
P817099 M06805 M05553 P817102 M06744 M05553 P817105
M66749 M05553 P817108 M06788 M05553
P814596 M66805 M65594 1,1314580p M06744 MG5594
P814583 MG6749 M45594 P816856 M06788 M35594
P1315196 M66805 M05424 P815180 M06744 M05424 P815183
M06749 M05424 P817072 M06788 M05424
P817087 M66805 M05442 P817090 M06744 M65442 P817093
M06749 M65442 P817096 M16788 M05442
P817111 M06805 M05439 P817114 MG6744 MG5439 P817117
M06749 MG5439 P817120 M66788 M05439
Figure 20. Screening of CD137 x PD-Li antibodies in SEB PBMC assay (12 CD137
Fab arms). CD137 xPD-L1 antibodies were tested in SEB PBMC assay in the
presence of 21,tg/m1SEB. CD137 activation was measured by the release of IL-2
using AlphaLISA , expressed in IL-2 counts. Positive control antibody; anti-
CTLA-
4 positive control antibody (based on Ipilimumab, 10D1 ) and the anti-RSV-G
negative control antibody PG2708 (Neg Ctrl Ab).
P8 MF1 MF2 P8 MF1 MF2 PB MF1 MF2 P8
MF1 MF2
P814143 M66783 MG6783 P814183 M06763 M66763 P814145
M06785 MG6785 P814134 M66737 M66737
P814590 M06783 M05594 P814815 M66763 MG5561 P814821
MG6785 M05561 P814808 MG6737 M05561
P814820 M05783 M05561 6815143 M46763 MG5425 P815149
M06785 M05426 P815136 M66737 M05426
P815190 M06783 M05424 P817100 :M66763 M05553 P817103
1466785 14115553 P817105 1406737 M05553
P815148 M66783 MG5426 P814585 :M06763 MG5594 P814591
M46785 M115594 P814578 1406737 M65594
P817085 M66783 M05442 P815185 :M06763 M55424 P815191
MG6785 M45424 P815178 M56737 M65424
P817097 M66783 M05553 P817088 :M06763 M65442 P817091
M06785 MG5442 P817094 M06737 M65442
P817109 M06783 M05439 P817112 MG6763 MG5439 P817115
MG6785 14135439 P817118 M06737 M05439
P814203 M06808 M06808 P814179 M66754 MG6754 P814162
1466825 14136825 P814195 MG6797 M06797
P817050 M66808 MG5561 P1314814 MG6754 MG5561
P81482913 1466825 M115561 P814823 M06797 MG 5561
P817074 MG6808 M05426 P815142 M06754 MG5426 P815157
1466825 M05426 P815151 MG6797 MG5426
P817098 M66808 MG5553 P817101 :M66754 M55553 P817104
M66825 M45553 P817107 M56797 M65553
P816841 M06808 M05594 P814584 :M66754 MG5594 P814605
M66825 1405594 P814593 MG6797 MG5594
P817062 M06808 M05424 P815184 :MG6754 MG5424 P815199
14G6825 MG5424 P815193 1406797 M05424
P817086 M06808 M05442 P817089 :M66754 M05442 P817092
1466825 14115442 P817095 14G6797 M05442
P817110 M66808 MG5439 P817113 :14G6754 MG5439 P817116
M06825 M05439 P817119 1466797 :M65439
P814149 1466805 1406805 P814135 14G6744 1466744 P814138
1466749 1466749 P814193 1466788 1466788
P814826 M66805 MG5561 P814810 14136744 M65561 P814813
M06749 1405561 P817060 1466788 :M65561
P815154 M06805 M05426 P815138p 1446744 1445426
P815141 MG6749 1445426 P817084 M66788 MG5426
P817099 M06805 M05553 P817102 M66744 M65553 P817105
M06749 1445553 P1317108 1406788 14135553
P814596 M06805 M05594 P814580p 1456744 1405594
P814583 M66749 1445594 P816856 1466788 144 5594
P815196 MG6805 M05424 P815180 1406744 MG5424 P815183
MG6749 M65424 P817072 1466788 14G5424
P817087 M06805 M05442 P817090 M06744 M55442 P817093 M06749
M05442 P817096 M56788 M05442
P817111 M66805 M05439 P817114 M06744 M45439
P/317117 M06749 MG5439 P817120 M06788 M65439
Figure 21. Screening of CD137 x PD-L1 antibodies in SEB PBMC assay (8 CD137
Fab arms). CD137xPD-L1 antibodies were tested in SEB PBMC assay in the
presence of 21,tg/m1SEB. CD137 activation was measured by the release of IL-2
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
116
using AlphaLISA , expressed in ilL-2 counts. Positive control antibody; anti-
CTLA-
4 positive control antibody (based on Ipilimumab, 10D1 ) and the anti-RSV-G
negative control antibody PG2708 (Neg Ctrl Ab).
PB MF1 MF2 PB MF1 MF2 PB MF1 MF2
PB14203 MG6808 MG6808 PB17088 MG6763 MG5442 PB14591 MG6785
MG5594
PB17050 MG6808 MG5561 PB17112 MG6763 .MG5439 PB15191 MG6785
MG5424
PB17074 MG6808 .MG5426 PB14179 MG6754 .NA66754 PB17091 MG6785
.M65442
PB17098 MG6808 MG5553 PB14814 MG6754 MG5561 PB17115 MG6785
MG5439
PB16841 MG6808 MG5594 PB15142 MG6754 MG5426 PB14162 M66825
MG6825
PB17062 MG6808 MG5424 PB17101 MG6754 MG5553 PB14829 MG6825
MG5561
PB17086 MG6808 ..MG5442 PB14584 ,MG6754 MG5594 PB15157 MG6825
,MG5426
PB17110 MG6808 MG5439 PB15184 MG6754 ..NA65424 PB17104 MG6825
M65553
PB14149 MG6805 MG6805 PB17089 MG6754 MG5442 PB14605 MG6825
MG5594
PB14826 MG6805 MG5561 PB17113 MG6754 MG5439 PB15199 MG6825
.MG5424
PB15154 MG6805 .MG5426 PB14135 MG6744 .MG6744 PB17092 MG6825
MG5442
PB17099 MG6805 .MG5553 PB14810 MG6744 MG5561 PB17116 MG6825
MG5439
PB14596 MG6805 MG5594 PB15138 MG6744 MG5426 PB14195 M66797
MG6797
PB15196 MG6805 MG5424 PB17102 MG6744 MG5553 PB14823 MG6797
MG5561
P B17087 MG6805 MG5442 .. PB14580 MG6744 MG5594 PB15151 MG6797
MG5426
PB17111 MG6805 MG5439 PB15180 MG6744 MG5424 PB17107 MG6797
MG5553
PB14183 .MG6763 .MG6763 PB17090 MG6744 .MG5442 .PB14593 MG6797
.MG5594
PB14815 MG6763 MG5561 PB17114 MG6744 MG5439 PB15193 M66797
MG5424
PB15143 MG6763 MG5426 PB14145 MG6785 MG6785 PB17095 MG6797
MG5442
PB17100 MG6763 MG5553 PB14821 MG6785 .MG5561 PB17119 MG6797
MG5439.
PB14585 MG6763 MG5594 PB15149 MG6785 .NA65426
0
Br P 15185 MG6763 MG5424 PB17103 MG6785 MG5553
Figure 22. Bispecific anti-CD137xPD-L1 antibodies and their parental bivalent
anti-CD137 antibodies bind to human and cynomolgus CD137 as determined by
flow cytometry.
Figure 23. Bispecific anti-CD137xPD-L1 antibodies and their parental bivalent
anti-PD-Li antibodies bind to human and rhesus macaque PD-L1 as determined by
flow cytometry.
Figure 24. Bispecific anti-CD137xPD-L1 antibodies and their parental bivalent
antibodies bind to activated T cells as determined by flow cytometry.
Figure 25. Bispecific anti-CD137xPD-L1 antibodies and their parental bivalent
anti-PD-L1 antibodies block P11)-L1 ligand binding as determined by ELISA
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
117
Figure 26. Bispecific anti-CD137xPD-L1 antibodies and their parental bivalent
anti-PD-L1 antibodies block CD137 ligand binding as determined by flow
cytome try
Figure 27. Bispecific anti-CD137xPD-L1 antibodies and their parental bivalent
antibodies block the interaction between PD-Li and PD-1 in an in vitro
blockade
reporter assay.
Figure 28 A. Transactivation of CD137 on Jurkat-CD137-luc cells in the
presence
of CHO cells expressing different PD-Li binding sites per cell in comparison
to
CHO wildtype cells. CD137 activation was measured by luciferase expression.
Figure 28 B. Transactivation of CD137 on Jurkat-CD137-luc cells in the
presence
of human tumor cells expressing different PD-Li binding sites per cell PD-L1.
CD137 activation was measured by luciferase expression
Figure 28 C. Transactivation of CD137 on Jurkat-CD137-lue cells in the
presence
of CHO-PD-LL ES-2 or CH() wild type cells. IgG were tested in triplicate at 10
CD137 activation was measured by luciferase expression. Below the tested
antibodies and their composition
PB/PG Target arm#1 MF Target arm#2 MF
PG6763 CD137 6763 CD137 6763
PB17309 CD137 6763 PD-L1 7702
PB14879 CD137 6763 IT 1337
PG6785 CD137 6785 CD137 6785
PB17310 CD137 6785 PD-L1 7702
PB17200 CD137 6785 IT 1337
PG6797 CD137 6797 CD137 6797
PB17311 CD137 6797 PD-L1 7702
PB17207 CD137 6797 TT 1337
40H4.9 CD137 NA CD137 NA
Ctri Ab TT 1337 TT 1337
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
118
Figure 29. Comparing CD137 x PD-Li antibodies in T-cell activation assay to
single and combination of reference controls. CD137 activation was measured as
IL-2 and TNFa cytokine release and measured by Luminex analysis.
Figure 30. Activity of CD137 x PD-L1 antibody PB17311 in T-cell activation
assay
in comparison to single and combination of reference control antibodies. CD137
activation was measured by multiple cytokine release and measured by Luminex
analysis (25p1ex).
Figure 31, Bispecific anti-CD137xPD-L1 antibodies consistently enhance IL-2
release by PBMCs during a SEB stimulation assay, regardless of PBMC donor or
SEB concentration. CD137 activation was measured as IL-2 release and measured
by Luminex analysis
Figure 32. Bispecifie anti-CI)137xPD-L1 antibodies are more potent than an
anti-
CD137 benchmark antibody or an equimolar mix of anti-CD137 and anti-PD-Li
benchmark antibodies at enhancing cytokine release during a SEB stimulation
assay. CD137 activation was measured as IL-2, IFNy and TNFa cytokine release
and measured by Luminex analysis
Figure 33. PB17311 inhibits M2 macrophage-mediated suppression of anti-
CD3/CD28-stimulated PBMCs as demonstrated by enhancement of IFNy release.
Figure 34, PB17311 enhances T cell expansion following CD8+ T cell priming.
Figure 35. PB17311 enhances differentiation of naïve T cells into central
memory
and effector T cells following priming. TNISCM Naive/ Stem Cell Memory; TCM,
Central Memory, Tim, Effector Memory; TE, Terminal Effector cells.
30 Figure 36, Effect of PB17311 on the expression of CD107a and cytokines
in the
total T cell population. TEm,Effector Memory; TE, Terminal Effector cells
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
119
Figure 37. Effect of PB17311 on the expression of CD107a and cytokines in T
cell
subsets.
Figure 38. Effect of PB17311 on the proliferation of tumor-infiltrating CD4
and
CD8 T cells derived from liver metastasis in colorectal cancer (LM-CRC) and
hepatic carcinoma (H CC).
Figure 39. Identification and visualization of critical residues in CD137 for
PB17311. (A) For each mutated clone, the mean binding value is plotted as a
function of the clone's mean CD137 expression value (gray circles), as
measured by
control antibody binding. Binding is expressed as a percentage of that
obtained
with the WT clone. Dotted lines indicate thresholds used to identify critical
clones
(black dots). (B) The table lists the mean binding reactivities (and ranges)
for all
critical residues identified. Critical residues for PB17311 Ab binding
(outlined in
black) were negative for PB17311 Ab binding (<20% of binding to WT) but
positive
for the control antibody, 555955 MAb (>70% WT). (C) The critical residues
(boxed
outline) are visualized on a CD137 model based on the structure of murine
OX4OL
bound to human 0X40 (PDB ID# 2HEY, Compaan et al., 2006). The non-validated
residue, C133, is shown in gray.
Figure 40. Effect of CD137xPD-L1 bispecific antibody PB17311 on median tumor
volume at day 19 in a xenograft mouse model. MTV, median tumor volume; TGI,
tumor growth inhibition; statistical significance in Mann-Whitney test
indicated by
* (0.01 <P <0.05) and ' (P <0.001) when compared with Group 1
Figure 41. Interference of sCD137 with T-cell activation. Assessment of effect
of
soluble CD137 on the ability of bispecific CD137xPD-L1 antibody to activate
human primary T cells.
Figure 42. Amino acid sequence of CD137 extracellular domain.
Figure 43. Amino acid sequence of MF6256.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
120
EXAMPLES
As used herein "MFXXXX" wherein X is independently a numeral 0-9, refers
to a Fab comprising a variable domain wherein the VH has the amino acid
sequence identified by the 4 digits. Unless otherwise indicated the light
chain
variable region of the variable domain typically has a sequence of Figure 1A,
typically 1B, "MFXXXX VH" refers to the amino acid sequence of the VH
identified
by the 4 digits. The MF further comprises a constant region of a light chain
and a
constant region of a heavy chain that normally interacts with a constant
region of a
light chain. PG refers to a monospecifie antibody comprising identical heavy
and
light chains. PB refers to a bispecific antibody with two different heavy
chains. The
variable region of the heavy chains (VH) differs and typically also the CH3
region,
wherein one of the heavy chains has a KK mutation of its CH3 domain and the
other has the complementing DE mutation of its CH3 domain (see for reference
PCT/NL2013/050294 (published as W02013/157954).
Example 1
Generation of materials for selection and screening
Culturing of cell lines
Human ES-2 cells (eat. no. CRL-1978) were purchased from ATCC and routinely
maintained in McCoy's 5A (Gibco) supplemented with 10% FBS (Lonza). Freestyle
293F cells (cat. no. p/n51-0029) were obtained from Invitrogen and routinely
maintained in 293 FreeStyle medium. HEK293T (cat. no. ATCC-CRL-11268), and
CH(L)-K1 (cat. no. DSMZ ACC110) cell lines were purchased from ATCC and
routinely maintained in DMEM/F12 (Gibco) supplemented with L-Glutamine
(Gibco) and FBS (Lonza).
Generation of 0X40, CD137 and PD-L1 expression vectors for
immunization, and for generation of stable cell lines
Full length cDNA of each target including unique restriction sites for cloning
and
kozak consensus sequence thr efficient translation was either synthetized, or
obtained via PCR amplification on a commercially available expression
construct,
containing the target dil\IA, with specific primers that introduced unique
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
121
restriction sites for cloning and kozak consensus sequence for efficient
translation.
The cDNA of each target was cloned into a eukaryotic expression construct such
as
pIRES-Neo3 (Clontech; FIGURE 4) or pVAX1 (Thermo Fisher Scientific; FIGURE
5) via NheI/EcoRI, resulting in pIRES-Neo3 JTARGET_NAME] and
pVAX1ITARGET_NAME], respectively. The insert sequences were verified by
comparison with NCBI Reference amino acid sequences. The pIRES-Neo3
constructs were used for generation of stable cell lines. The pVAX1 constructs
were
used for immunization purposes. See TABLE 1 for an overview of the names of
the
resulting constructs.
Amino acid sequence full length huCD137 insert (both in pIRES-Neo3 and pVAX1)
for expression on the cell surface (Identical to GenBank: NP_001552.2):
MGNSC,YNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFS
SAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCK
QGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCG
PSPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKR
GRKKLLYIFKQPFMRPVQTNEEDGCSCRFPEEEEGGCEL
Of which:
MGNSCYNIVATLLLVLNFERTRS: signal peptide.
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKE
CSSTSNAE CD CTPGFHCLGAGCSMCEQD CKQ GQELTKKGCKD CCFGTFNDQK
RGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGH
SPQ: ECD of huCD137.
.. IISFFLALTSTALLFLLFFLTLRFSVV: Predicted TM region.
KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL: Intracellular
Amino acid sequence full length macaque (Macaca fascicularis) CD137 insert
(both
in pIRES-Neo3 and pVAX1) for expression on the cell surface (Identical to
GenBank: ABY47575.1):
MGNSCYNIVATLLLVLNFERTRSLQDLCSNCPAGTFCDNNRSQICSPCPPNSFS
SAG( QRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCK
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
122
QGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCG
PSPADLSPGASSATPPAPAREPGHSPQIIFFLALTSTVVLFLLFFLVLRFSVVKRS
RKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
Of which:
MGNSCYNIVATLLLVLNFERTRS: signal peptide.
LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKE
CSSTSNAECDCISGYHCLOAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKR
GICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHS
PQ: ECD of maCD137.
IIFFLALTSTVVLFLLFFLVLRFSVV: Predicted TM region.
KRSRKKLLYIFKQPFMRPVQTNEEDGCSCRFPEEEEGGCEL: Intracellular tail.
Amino acid sequence full length rat CD137 insert (both in pIRES-Neo3 and
pVAX1) for expression on the cell surface (Identical to GenBank:
XP_008762505.1):
MOSSCYNMVVTVLLVVGTEEVRATRNPCDSCEAGTFCSKYPPVCTSCPPSTYSS
T GGQPNCDICRVCQ GYFRFKKPCSSTHNAECE CVE GFHCLGPKCTRCEKD CRP
GQELTEQ GCKNCGLGTFNDQDGAGVCRPWTNCSLD GRSVLKNGTKEKDVVCG
PPVVSLSPSTTPSAVTTPERESGERPLQVLTLFLALTLALLLFLIFIILWFSVPKW
LRKKFPHIFKQPFKKAVRTAQEEDACSCRFPEEEEGGOGSYEL
Of which:
MOSS CYNMVVTVLLVVGTEEVRA: signal peptide.
TRNP CDS CEAGTFCSKYPPVCTS CPPSTYSST GGQPNCDICRVCQ GYFRFKKPC
SSTHNAECECVEGFHCLGPKCTRCEKDCRPGQELTEQGCKNCGLGTFNDQDG
AGVCRPWTNCSLDGRSVLKNGTKEKDVVCGPPVVSLSPSTTPSAVTTPERESGE
RPLQ: ECD of raCD137.
VLTLFLALTLALLLFLIFIILWF: Predicted TM region.
SVPKWLRKKFPHIFKQPFKKAVRTAQEEDACSCRFPEEEEGGGGSYEL:
Intracellular tail.
Amino acid sequence full length huPD-L1 insert (both in pIRES-Neo3 and pVAX1)
for expression on the cell surface (Identical to GenBank: AAI13735.1):
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
123
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALI
VYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQ
DAGVYR CMI SYGGADYKRITVKVNAPYNKINQRILVVD PVTSEHELTCQAE GYP
KAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDP
EENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVK
KCGIQDTNSKKQSDTHLEET
Of which:
MRIFAVFIFMTYWHLLNA: signal peptide.
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYVVEMEDKNIIQFVHGEE
DLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRI
TVKVNAPYNKINQRILVVDPVTSEHELTNAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPP
NER: ECD of huPD-L1.
THLVILGAILLCLGVALTFIF: Predicted TM region.
RLRKGRMMDVKKCGIQDTNSKKQSDTHLEET: Intracellular tail.
Amino acid sequence full length macaque (macaca mulatta) PD-Li insert (both in
pIRES-Neo3 and pVAX1) for expression on the cell surface (Identical to
GenBank:
AB033161.1):
MRIFAVFI FT IYWHLLNAFTVTVP KD LYVVEY GSNMT IE CRF PVE KQ LGLTS LIV
YWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQD
AGVYR CMI SYGGADYKRITVKVNAPYNKINQ RILVVD PVTSEHELT CQAE GYPK
AEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLGPE
ENHTAELVIPELPLALPPNERTHLVILGAIFLLLGVALTFIFYLRKGRMMDMKKS
GIRVTNSKKQRDTQLEET
Of which:
MRIFAVFIFTIYWHLLNA: signal peptide.
FTVTVPKDLYVVEYGSNMTIE CRFPVEKQLGLTSLIVYWEMEDKNIIQFVH GEE
DLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKR
ITVKVNAPYNKINQRILVVDPVTSEHELTNAEGYPKAEVIWTSSDHQVLSGKT
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
124
TTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLGPEENHTAELVIPELPLALPP
NER: ECD of maPD-L1.
THLVILGAIFLLLGVALTFIF: Predicted TM region.
YLRKGRMMDMKKSGIRVTNSKKQRDTQLEET: Intracellular tail.
Amino acid sequence full length human 0X40 insert (both in pIRES-Neo3 and
pVAX1) for expression on the cell surface (Identical to GenBank: NP_003318.1):
MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGM
VSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDT
VCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPA
SNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGG
RAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQ
ADAHSTLAKI
Of which:
MCVGARRLGRGPCAALLLLGLGLSTVTG: signal peptide.
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPC
KPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFS
PGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPIT
VQPTEAWPRTSQGPSTRPVEVPGGRA: ECD.
VAAILGLGLVLGLLGPLAILL: Predicted TM region.
ALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI: Intracellular tail.
Amino acid sequence full length rat (Rattus norvegicus) 0X40 insert (both in
pIRES-Neo3 and pVAX1) for expression on the cell surface (Identical to
GenBank:
NP_037181.1):
MYVWVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCD
HTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQC
RPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASN
SLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAF
AVILGLGUMLAPLTVLLALYLLRKAWRSPNTPKPCWGNSFRTPIQEEQTDTHF
TLAKI
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
125
Of which:
MYVWVQQPTAFLLLGLSLG: signal peptide.
VTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAV
NYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVP
CPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQ
RTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGP: ECD.
AFAVILGLGLGLLAPLTVLLALYLL: Predicted TM region.
RKAWRSPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI: Intracellular tail.
Amino acid sequence full length macaque (Macaca fascicularis) 0X40 insert
(both
in pIRES-Neo3 and pVAX1) for expression on the cell surface (Identical to
GenBank: XP_005545179.1):
MCVGARRLGRGPCAALLLLGLGLSTTAKLHCVGDTYPSNDRCCQECRPGNGM
VSRCNRSQNTVCRPCGPGFYNDVVSAKPCKACTWCNLRSGSERKQPCTATQDT
VCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPA
SNSSDAICEDRDPPPTQPQETQGPPARPTTVQPTEAWPRTSQRPSTRPVEVPRG
PAVAAILGLGLALGLLGPLAMLLALLLLRRDQRLPPDAPKAPGGGSFRTPIQEE
QADAHSALAKI
Of which:
MCVGARRLGRGPCAALLLLGLGLSTTAK: signal peptide.
LHCVGDTYPSNDRCCQECRPGNGMVSRCNRSQNTVCRPCGPGFYNDVVSAKP
CKACTWCNLRSGSERKQPCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHF
SPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPPTQPQETQGPPARP
TTVQPTEAWPRTSQRPSTRPVEVPRGPA: ECD.
VAAILGLGLALGLLGPLAMLL: Predicted TM region.
ALLLIRRDQRLPPDAPKAPGGGSFRTPIQEEQADAHSALAKI: Intracellular tail.
Generation of stable cell lines expressing CD137, 0X40 or PD-L1
pIRES-Neo3 ITARGET_NAME] expression constructs (TABLE 1) were used to
generate Freestyle 293F or CHO-1U clones stably expressing the respective
proteins. Constructs were transiently transfeeted in CHO-Kl cells using
lipofectamine transfection, or using PEI transfeetion for Freestyle 293F cells
and
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
126
screened by FACS using antibodies reacting with the respective proteins. After
confirmation of expression, transiently transfected cells were seeded in
limiting
dilution and cultured under selection pressure relevant for the used
expression
construct to obtain stable cell clones. After 2-3 weeks of selection, clones
were
.. screened by FACS. The selected clones were expanded by serial passage,
retested
in FACS and frozen to -150 C. The names of clones that stably express the
heterologous proteins are CHO-KlITARGET_NAME] cells or Freestyle
293FITARGET_NA1VIE] cells. See TABLE 1 for an overview of the constructs used
to generate the stable cell lines and their resulting name.
Example 2
Immunization, selection and screening
Mice used for immunizations
For generation of human antibodies binding to huCD137, hu0X40 and huPD-L1,
mice transgenic for the human VK1-39 light chain (common light chain mice, see
W02009/157771) and for a human heavy chain (HC) minilocus (comprising a
selection of human V gene segments, all human Ds and all human Js) were
immunized with either recombinant protein or DNA encoding the proteins as
briefly described below. These mice are referred to as `MeMol.iV mice.
Protein immunizations
`MeMolV mice were immunized by subcutaneous injections with recombinant
protein and Gerbu adjuvant MM (Gerbu Biotechnik e#3001). Recombinant huPD-
Ll-His (SinoBiological; cat.no. 10084-H08H), hu0X40-Fc (R&D; cat. no. 3388-0X)
and hu0X40-His (SinoBiological; cat. no. 10481-H08H) proteins were used for
immunizations. No protein immunizations were performed for CD137 antibody
panel generation. Mice were immunized with 40 mg recombinant protein in PBS
mixed with 40 jal of adjuvant in a total volume of 100 pl. Subsequently mice
were
boosted on day 14 and 28 with 20 jug of recombinant protein in PBS together
with
20 jal of adjuvant in a total volume of 50 jal. Mouse serum was collected at
day 35 to
determine serum titers. Mice with low serum titers received additional cycles
of
booster immunizations and serum analyses. Each cycle consisted of two weekly
immunizations using 20 jig of recombinant protein in 50 jal PBS followed one
week
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
127
later by serum collection for titer analysis. Mice showing high serum titers
against
the human and macaque target received a final boost immunization consisting of
daily injections with 20 jag of recombinant protein in 50 )11 PBS on three
consecutive days. One day after the final injection mouse lymphoid tissue was
collected.
DNA immunizations
MeMo ' mice were immunized by DNA tattooing using a micropigmentation
device. DNA tattoo immunizations were performed with 20 pg plasmid DNA
encoding the target antigen (pVAX1ITARGET_NAME], TABLE 1). Mice were
immunized with DNA encoding the human target only (PD-L1) or by alternating
immunizations with DNA encoding the human and rat (CD137, OX40) target to
obtain species cross-reactive antibodies. For PD-Li immunizations, Treg cells
were
depleted four days prior to the start of immunization by injection of mice
with 0.5
mg anti-CD25 antibody PC61.5 (Bioceros) to break tolerance. Mice were
immunized
at day 0, 3, 6, 14, 17, 28 and 31. Mouse serum was collected at day 35 to
determine
serum titers. Mice with low serum reactivity against the human and/or macaque
target received additional cycles of booster immunizations with human, rat or
macaque DNA antigen and serum analyses. Each cycle consisted of two weekly
DNA immunizations followed one week later by serum collection for titer
analysis.
Mice showing strong serum reactivity against cells expressing the human and
macaque target received a final boost immunization followed after 3 days by
collection of lymphoid tissue.
Combination of protein and DNA immunizations (0X40 only)
Mice were immunized with recombinant hu0X40-His (SinoBiological; cat. no.
10481-H08H) and boosted by alternating DNA (pVAXl_ra0X40) and protein
(hu0X40-His) immunizations to obtain species cross-reactive antibodies.
Therefore,
mice were immunized with 40 mg recombinant protein in PBS mixed with 40 iLt1
of
adjuvant in a total volume of 100 pl. Subsequently mice were boosted on day 14
and 17 by DNA tattooing with 20 gg pVAXl_ra0X40, followed on day 28 by protein
immunization with 20 g of hu0X40-His protein in PBS together with 20 I of
adjuvant in a total volume of 50 }11. Mouse serum was collected at day 35 to
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
128
determine serum titers. Mice with low human and/or macaque serum titers
received additional cycles of booster immunizations and serum analyses. Each
cycle
consisted of two weekly protein or DNA immunizations with 20 jig hu0X40-His,
pVAX1_ra0X40 or pVAX1_ma0X40 followed one week later by serum collection for
titer analysis. Mice showing high serum titers against the human and macaque
target received a final boost immunization consisting of daily injections with
20 jig
of recombinant protein in 50 t1 PBS on three consecutive days. One day after
the
final injection mouse lymphoid tissue was collected.
Determination of serum titers
Serum titers were determined by FACS analysis using cell lines expressing the
human and macaque target antigens (Table 1).
Generation of synthetic phage Fab libraries
Synthetic libraries were constructed based on a repertoire of germline human
VH
genes that were selected for frequent use in natural repertoires and canonical
sequence diversity. Synthetic HCDR3 regions were added to these VH genes using
PCR. This was done using forward primers that anneal to framework 1 of the VH
genes and include a Sfif restriction site for cloning. Reverse primers
included
sequences to anneal to framework 3 of the VH genes, followed by randomized
sequences to encode HCDR3 diversity and a framework 4 encoding sequence also
containing a BstEII and Xhof restriction site for cloning. Synthetic CDR3
regions
were either completely random or encoded a more restricted diversity based on
the
frequency of use of amino acid residues at certain positions within the HCDR3.
PCR products encoding the VH genes were cloned into phage display vectors in
fusion with phage M13 gene 3 protein using aforementioned restriction enzymes
and also containing a common light chain encoding gene. Large scale ligation
and
transformation of E. coil TG1 resulted in large libraries of synthetic Fab
fragments
displayed on phage which were used for panning on antigens or cells to
identify
antigen-specific Fab fragments.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
129
Generation of 'immune' phage Fab libraries by RT-PCR from tissues of
immunized mice
Spleen and draining lymph nodes were removed from mice for which a significant
humoral response was observed against the respective target proteins.
Single cell suspensions were generated from both spleen and inguinal lymph
nodes
and subsequently these tissues were lysed in Trizol LS Reagent (Thermo
Scientific
c#10296028) and stored at -80 C until use.
From successfully immunized mice, the inguinal lymph nodes were used for the
construction of 'immune' phage antibody repertoires. RNA was extracted from
the
single cell suspensions of the lymphoid tissue. lug of total RNA was used in a
RT
reaction using an IgG-CH1 specific primer. The resulting eDNA was then used to
amplify the polyclonal pool of VH-encoding cDNA using in-house adapted VH-
specific primers essentially as described in Marks et al. (J Mol Biol. 1991
Dec
5;222(3):581-97). The resulting PCR product was then cloned in a phagemid
vector
(FIGURE 6) for the display of Fab fragments on phage, as described in de Haard
et
al. (J Biol Chem. 1999 Jun 25;274(26):18218-30) with the exception that the
light
chain (Figure 1A and 1B) was the same for every antibody and was encoded by
the
vector. After ligation, the phagemids were used to transform E. coil TG1
bacteria
and transformed bacteria were plated onto LB-agar plates containing ampicillin
and glucose. All phage libraries contained >4x105 transthrmants and had an
insert
frequency of > 90%. Bacteria were harvested after overnight growth and used to
prepare phage according to established protocols (de Haard et al., J Biol
Chem.
1999 Jun 25;274(26):18218-30).
Selection of phage carrying Fab fragments specifically binding to human
target protein from synthetic and 'immune' phage Fab libraries using
recombinant proteins
The phage Fab libraries that were generated were used to select target
specific
Fabs using phage display on directly coated recombinant proteins. For PD-L1,
huPD-Li-His (Sinobiological; cat. no. 10084-H08H), huPD-Li-Fe (R&D; cat. no.
156-B7), and maPD-Li-His (Sinobiological; cat. no. 90251-CO8H) were used. For
CD137, huCD137-Fc (R&D; cat. no. 838-4B), raCD137-Fc (R&D; eat. no. 7968-4B),
moCD137-Fc (R&D; cat. no. 937-4B), huCD137-His (SinoBiological; cat. no. 10041-
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
130
HO8H) and huCD137-Fe (Enzo; eat. no. ALX-522-031-0050) were used, and for
0X40, hu0X40-Fc (R&D; cat. no. 3388-0X) and hu0X40-His (Sinobiological; eat.
no. 10481-H08H).
For selections with recombinant protein, proteins were coated onto the wells
of a
r
0 iviAXISORPTm ELISA plate. The MAXISORPTAI ELISA plates were blocked with
4%
dried skimmed milk (Marvel) in PBS. Phage Fab libraries were also blocked with
4% Marvel and, when Fe tagged recombinant protein was used, also with excess
of
human IgG to deplete for Fe region binders prior to the addition of the phage
library to the coated antigen.
Incubation of the phage library with the coated protein was performed for 1.5
hrs
at room temperature under shaking conditions. Plates or tubes were then washed
fifteen times with 0.05% Tween-20 in PBS followed by 5 times washing with PBS.
Bound phage were Muted for 20 minutes using trypsin, after which trypsin was
neutralized with AEBSF trypsin inhibitor (Sigma).
The eluates were added to E. coli TG-1 and incubated at 37 C for phage
infection.
Subsequently infected bacteria were plated on agar plates containing
Ampieillin
and glucose, and incubated at 37 C overnight. Single clones from the selection
outputs were screened for target binding in ELISA or FACS depending on the
target.
For selections with synthetic phage Fab libraries, a second round selection
was
performed after rescue of the first round selection output using the same
protocol
as outlined above for the first round selection.
Selection of phage carrying Fab fragments specifically binding to human
target from 'immune' phage Fab libraries using cells stably expressing the
target protein
Phage Fab libraries that were generated from target immunized mice were
selected
using phage display on cells expressing the respective target. The stable cell
lines
expressing CD137, 0X40 or PD-L1 (Table 1) were used for lst round selections.
Cells were blocked with 10% FBS in PBS. After blocking, the rescued phage were
incubated with blocked cells. Cells plus phage were incubated for 1 hr at 4 C.
Washing the cells (5 times) was performed using 1 ml of 10% FBS in PBS. Bound
phage were eluted using trypsin for 20 minutes, after which trypsin was
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
131
neutralized with AEBSF trypsin inhibitor (Sigma). The eluate was added to K
coil
TG-1 and incubated at 37 C for phage infection. Subsequently, phage-infected
bacteria were plated on agar plates containing ampicillin and glucose, and
incubated at 37 C overnight.
For PD-L1, second round selections with ES-2 cells endogenously expressing
huPD-
Ll were performed with the same protocol as was used for the 1st round
selection.
After selection, single clones were screened for target binding in FACS.
Screening for Target specific Fab clones in ELISA
Of single clones, soluble Fab or phage were prepared (J Mol Biol. 1991 Dec
5;222(3):581-97; J Biol Chem. 1999 Jun 25;274(26):18218-30). Obtained soluble
Fab
or phage samples were diluted (1:5 or 1:10, respectively) in 4% dried skimmed
milk
(Marvel) in PBS (blockbuffer) and tested for binding in ELISA to wells coated
with
the same antigen as was used for selection, or with huCD137-Fc (R&D; eat. no.
838-4B) for all selection outputs performed with either raCD137-Fc (R&D; cat.
no.
7968-4B) or moCD137-Fc (R&D; cat. no. 937-4B).
Bound Fabs were detected by staining with an anti-myc antibody (Roche; cat.
no.
11667203001) diluted 1:1000 in blockbuffer, followed by a HRP-conjugated anti-
mouse IgG antibody (Jackson Immunoresearch; cat. no. 715-035-15(i) diluted
1:5000 in blockbuffer. Bound phage were detected by staining with a HRP-
conjugated monoclonal anti-M13 antibody (GE healthcare; cat. no. 27-9421-01)
diluted 1:5000 in blockbuffer.
After each antibody staining, wells were washed with PBS-T (PBS-0.05% v/v
Tween 2(1). Bound secondary antibody was visualized by TMB/H202 staining and
staining was quantified by means of OD45o. measurement. Clones were considered
to bind the target when the OD450nm was at least three times above the
background signal obtained with a negative control Fab.
The VH-encoding cDNA's of all target-specific clones were sequenced. A
selection of
unique clones based on sequence identity and cluster analysis was then
analyzed in
FACS on binding to the target expressed on cells as described below for the
clones
obtained from the cell selection outputs.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
132
Screening for Target specific Fab clones in FACS
Of single clones, selected on cells expressing the respective target, soluble
Fab or
phage were prepared as described (J Mol Biol. 1991 Dec 5;222(3):581-97; J Biol
Chem. 1999 Jun 25;274(26):18218-30). Fab samples were tested for binding in
FACS to cells expressing the human and macaque target (Table 1) by incubation
with a mix of 1:5 diluted Fab sample with 1:1000 diluted anti-myc antibody
(Gentaur; cat. no. 04-CMYC-9E10) in FACS buffer (0.5% HI-FBS in PBS). Bound
Fab/anti-myc complexes were detected by incubation with an APC-conjugated goat
anti-mouse IgG antibody (BD Bioscience; cat. no. 550826) diluted 1:500 in FACS
buffer.
Phage samples were tested for binding in FACS by diluting the phage samples
1:3
in blockbuffer and incubation with target expressing cells for 1 hour. Bound
phage
were detected by staining with a biotinylated anti-M13 antibody (Fitzgerald,
eat.
nr. 61R-M101ABTB62-FEZ, 1:125 in FACS buffer, 30 minutes on ice) and PE-
labeled streptavidin (Invitrogen, cat. nr. SA1004-4; 1:400 in FACS buffer for
15
minutes on ice). After each antibody incubation, wells were washed three times
with FACS buffer. Stained cells were analysed using a FACS Accuri C6
instrument
(Becton and Dickinson). Clones were considered positive when the mean
fluorescence intensity was at least three times above the background signal
obtained with a negative control Fab.
Results
The VH sequences of 24 CD137-specific clones, 14 P11)-Li-specific clones and
50
0X40-specific clones that were obtained by the above-mentioned methods are
depicted in Figure 3.
Example 3
Characterization huCD137, hu0X40 and huPD-L1 specific Fab clones in
IgG format
Recloning human CD137, 0X40 and PD-L1 specific Fab to IgG format
A selection of unique clones, based on CDR3 sequence and VH germline
differences, that bound human and macaque target protein expressed on cells,
was
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
133
then re-cloned to an IgG expression plasmid such as MV1452 (Figure 7), which
contained the common light chain (Figure 1), using Sfil-BstEII digestion and
ligation of the pool of digested cDNA's according to standardized molecular
biological techniques.
Expression of bispecific IgG containing a human CD137, 0X40 or PD-L1
specific Fab and a tetanus toxin specific Fab
Bispecific antibodies were generated by transient co-transfection of two
plasmids
encoding IgG with different VH domains, using a proprietary CH3 engineering
technology to ensure efficient hetero-dimerisation and formation of bispecific
antibodies. The common light chain present on both plasmids containing the
heavy
chain is also co-transfected in the same cell. In our co-pending applications
(e.g.
W02013/157954 and W02013/157953; incorporated herein by reference) we have
disclosed methods and means for producing bispecific antibodies from a single
cell,
whereby means are provided that favor the formation of bispecific antibodies
over
the formation of monospecific antibodies. These methods can also be favorably
employed in the present invention. Specifically, preferred mutations to
produce
essentially only bispecific full length IgG molecules are amino acid
substitutions at
positions 351 and 366, e.g. L351K and T366K (numbering according to EU
numbering) in the first CH3 domain (the 'KK-variant' heavy chain) and amino
acid
substitutions at positions 351 and 368, e.g. L351D and L368E in the second CH3
domain (the 'DE-variant' heavy chain), or vice versa. It was previously
demonstrated in our co-pending applications that the negatively charged DE-
variant heavy chain and positively charged KK- variant heavy chain
preferentially
pair to form heterodimers (so-called 'DEKK' bispecific molecules).
Homodimerization of DE-variant heavy chains (DE-DE homodimers) or KK-variant
heavy chains (KK-KK homodimers) hardly occurs due to strong repulsion between
the charged residues in the CH3-CH3 interface between identical heavy chains.
VH genes encoding the antibodies binding human CD137, 0X40 and PD-Li
described above were cloned into an IgG expression vector such as MV1452
encoding the positively charged CH3 domain. A tetanus toxin (TT) targeting
antibody (Figure 8) was cloned into the MV1377 IgG expression vector (Figure
9)
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
134
encoding the negatively charged CH3 domain. For expression of the CD137
antibody panel in IgG format, the entire panel was also cloned into the
negatively
charged CH3 domain vector to be able to produce monospecific CD137xCD137
bivalent IgG.
Suspension growth-adapted 293F Freestyle cells were cultivated in T125 flasks
on
a shaker plateau until a density of 3.0 x 106 cells/ml. Cells were seeded at a
density
of 0.3-0.5 x 106 viable cells/m1 in each well of a 24-deep well plate (24 well
format).
The cells were transiently transfected with a mix of two plasmids encoding
different antibodies, cloned into the proprietary vector system. Seven days
after
transfection, the cellular supernatant was harvested and filtered through a
0.22
pM filter (Sartorius). The sterile supernatant was stored at 4 C until
purification
of the antibodies.
Purification of (bispecific) IgG
Purification of IgG was performed on a small scale (<500 rig), using protein-A
affinity chromatography. Small scale purifications were performed under
sterile
conditions in 24 well filter plates using filtration. First, the pH of the
medium was
adjusted to pH 8.0 and subsequently, IgG-containing supernatants were
incubated
with protein A Sepharose CL-4B beads (50% v/v) (Pierce) for 2hrs at 25 C on a
shaking platform at 600 rpm. Next, the beads were harvested by filtration.
Beads
were washed twice with PBS pH 7.4. Bound IgG was then eluted at pH 3.0 with
0.1 M citrate buffer and the eluate was immediately neutralized using Tris pH
8Ø
Buffer exchange was performed by centrifugation using multiscreen Ultracel 10
multiplates (Millipore). The samples were finally harvested in PBS pH7.4. The
IgG
concentration was measured using Octet. Protein samples were stored at 4 C.
IgG quantification using Octet
To determine the amount of IgG purified, the concentration of antibody was
determined by means of Octet analysis using protein-A biosensors (Forte-Bio,
according to the supplier's recommendations) using total human IgG (Sigma
Aldrich, eat. nr. 14506) as standard.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
135
Specificity analysis huCD137xCD137 bivalent IgG and hu0X40xTT and
huPD-L1xTT bispecific IgG
The huCD137xCD137 bivalent IgG and hu0X40xTT and huPD-L1xTT bispecific
IgG were tested for binding in FACS to the stable cell lines expressing the
relevant
human and macaque orthologs (Table 1) and the wt cells. Therefore, cells were
harvested and diluted to 106cells/m1 in FACS buffer (PBS/0.5%BSA/0.5mM EDTA).
1-2 x105 cells were added to each well in a U-bottom 96 well plate. Cells were
centrifuged fbr 2 minutes at 300 g at 4 C. Supernatant was discarded by
inverting
the plate(s). 500 of each IgG sample at a concentration of 10 ktg/m1 was added
and
incubated for 1H on ice. Cells were centrifuged once, supernatant was removed
and
cells were washed twice with 150g1 of FACS buffer. 5N1 1:400 diluted goat anti
human IgG PE (Invitrogen) was added and incubated for 30 minutes on ice in the
dark. After adding FACS buffer, cells were centrifuged once, supernatant was
removed and cells were washed twice with FACS buffer. Cells were analyzed on a
FACSCanto Flow cytometer (Becton and Dickinson) in a HTS setting. Binding of
the antibodies to cells was assessed by measuring the mean fluorescence
intensity
(MFI) of the stained cell population. Antibodies were considered to bind their
target when the MFI was at least five-fold that of the same cell population
stained
with a (negative control) non-binding antibody (directed to tetanus toxoid).
Binning huCD137 specific Fab arms present in CD137xCD137 bivalent IgG
on the ability to block the CD137 interaction with CD137L
huCD137 binding clones in bivalent IgG format were tested for their ability to
block the interaction of CD137 with CD137L. Therefore, wells of a Maxisorp 96
well plate were coated with recombinant CD137-Fc (R&D; cat.no. 838-4B) at 1.25
iLtg/m1 in PBS and incubated overnight at 4 C. Wells were washed two times
with
PBST (0.05% \TN Tween20 in PBS), and subsequently blocked with 2% BSA in PBS
(block buffer) for one hour at room temperature. Thereafter, wells were
incubated
for one hour at room temperature with 0.25 ktg/m1 CD137L-muCD8 biotin (Aneell;
cat.no. 503-030) diluted in block buffer in the presence or absence of 20
g/ml IgG .
Next, wash steps were repeated and wells were incubated with HRP-conjugated
streptavidin (Becton Dickinson; cat.no. 554066) diluted 1:2000 in blockbuffer
for 30
minutes at room temperature. For detection of bound streptavidin, wells were
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
136
washed three times with PBST and incubated with TMB substrate components A
and B (1:1 ratio) (Becton Dickinson; cat.no, 51-2606KC and 51-2607KCõ
respectively). Reaction was stopped after 10 minutes with 1M H2SO4 and the
OD45omii was measured using an ELISA plate reader. Based on the results,
clones
were binned in 4 different groups: "Blocking clones" were considered to fully
block
the interaction of CD137 with CD137L when the ELISA signal was reduced more
than 70% at an IgG (CD137xCD137) concentration of 20 gg/ml, compared to a
control in which a TT specific competition antibody was added (0% blocking);
"Partially blocking clones" reduced the signal between 25-70%; "Non-blocking
clones" showed an ELISA signal that was reduced upto 25%, or enhanced upto
25%; "Enhancing clones" showed an increase in ELISA signal over 25%. The
results
obtained with a representative selection of the CD137 antibody panel tested as
CD137xCD137 bispecific molecules are indicated in Table 2.
Binning huCD137 specific Fab arms present in CD137xCD137 bivalent IgG
on domain specificity
The above mentioned huCD137 binding clones in bivalent IgG format were also
tested for domain specificity in FACS on HEK293T cells that were transiently
transfected with eight different pIRES-Neo3 mouse/human CD137 hybrid
expression constructs, a FL mouse CD137 pIRES-Neo3 expression construct (see
amino acid insert sequences below) or the pIRES-Neo3_huCD137 expression
construct used for generation of stable huCD137 expressing Freestyle 293F
cells
(Table 1). The same FACS protocol was used as described above during
specificity
analysis of the antibody panel. For generation of the hybrid constructs the
.. extracellular domain of mouse and human CD137 was divided in 5 domains; 4
cysteine rich domains based on Uniprot reference sequences Q07011 (huCD137)
and P20334 (moCD137) and 1 hinge domain from end of cysteine rich domain 4 to
the transmembrane domain. The following amino acid insert sequences were
cloned into pIRES-Neo3 (Figure 4) via NheI/EcoRI; Text in bold is the signal
peptide. Underscored text is the sequence identical to human CD137. Text in
Italics represent the transmembrane and intracellular domain sequences.
Amino acid sequence Full length mouse CD137.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
137
MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTF
SSI GGQPNCNICRVCAGYFRFKKFCSSTHNAE CE CIE GFH CLGPQ CTRCEKD CR
PGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVC
GPPVVSFSPSITTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSITKWIR
KKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Amino acid sequence mo/huCD137 chimeric insert A (human cysteine rich domain
1; mouse sequence from cysteine rich domain 2 forward).
MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSS CPPSTF
SSI GGQPNCNICRVCAGYFRFKKFCSSTHNAE CE CIE GFH CLGPQ CTRCEKD CR
PGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVC
GP PVVS F S PS TT I SVT PE G GP G GH S LQVL TLFLALTSALLLALIFITLLFSVLKIIIR
WPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Amino acid sequence mo/huCD137 chimeric insert B (human cysteine rich domain
1 and 2; mouse sequence from cysteine rich domain 3 forward).
MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSF
SSAGGQRTCDICRQCKGVFRTRKECSSTSNAECECIEGFHCLGPQCTRCEKDCR
P GQ E LTKQ GCKT CS LGTFND QNGT GVCRPWTN CS LD GRSVLKT GTTE KDVVC
GP PVVS FS PS TT I SVT PE G GP G GE S LQVL TLFLALTSALLLALIFITLLFSVLKIIIR
KKFPHIFKQPFKKTTGA4QEEDACSCRCPQEEEGGGGGYEL
Amino acid sequence mo/huCD137 chimeric insert C (human cysteine rich domain
1 to 3; mouse sequence from cysteine rich domain 4 forward).
MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSF
SSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDC
KQGQELTKKGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVV
CGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALL/ALIFITLLE.SVLKIII
RWPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Amino acid sequence mo/huCD137 chimeric insert D (human cysteine rich domain
1 to 4; mouse sequence from hinge domain forward).
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
138
MGNSCYNIVATLLLVINFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSF
SSA(1GQRTCDICRQ CKGVFRTRKE CSSTSNAE CD CTPGFHCLGAGCSMCEQD C
KQGQELTKKG CKDCCITGTFNDQKR1( CRPWTNCSLD( KSVLVNG TKERDVVC
GP PVVS F S PS TTIS VT PE GGP G GHSLQVLTLFLAL TSALLLALIFITLLFSI-LKITIR
KKEPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Amino acid sequence mo/huCD137 chimeric insert E (mouse cysteine rich domain
1; human sequence from cysteine rich domain 2 forward).
NIGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKPCPPNS
FSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQD
CKQ GQELTKKGCKDCCF GTFNDQKRGI CRPWTNCSLD GKSVLVNGTKERDVV
CGPSPADLSPGASSVTPPAPAREPGHSPQRSEFLALTSTALLPLIFFLITLRFSAIT
KRGRKKLLYIFKQPFMRPT-QTTQEEDGCSCRFPEEEEGGCEL
Amino acid sequence mo/huCD137 chimeric insert F (mouse cysteine rich domain 1
and 2; human sequence from cysteine rich domain 3 forward).
MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRIKYNPVCKSCPPSTE
SSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECDCTPGFHCLGAGCSMCEQDC
KQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVC
GPSPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFUFFLTLRFSI-1-K
RGRKAILLYIFKOPFMRPITQTTQEEDGCSCRFPEEKEGGCEL
Amino acid sequence mo/huCD137 chimeric insert G (mouse cysteine rich domain 1
to 3; human sequence from cysteine rich domain 4 forward).
MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKS CPPSTF
SSI GGQPNCNICRVCAGYFRFKKFCSSTHNAECE CIE GFH CLGPQ CTRCEKDCR
PGQELTKQGCKDCCFGITNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCG
PSPADLSPGASSVIPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSITKR
GRKKLLYLFKQPFMRPT-QTTQEEDGCSCRFPEEEEGGCEL
Amino acid sequence mo/huCD137 chimeric insert H (mouse cysteine rich domain 1
to 4; human sequence from hinge domain forward).
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
139
MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTF
SSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCR
PGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVC
GPSPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSITK
RGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
Based on the FACS results obtained with the chimeric and full length mouse and
human CD137 constructs, clones were binned based on the observed binding
patterns. Antibodies were considered to bind (chimeric) CD137 when the MFI was
at least three-fold that of the same cell population stained with a (negative
control)
non-binding antibody (directed to tetanus toxoid).
Results
The domain specificities of the CD137-specific Fab arms are depicted in Table
2.
Binning hu0X40 specific Fab arms present in OX40xTT bispecific IgG on
the ability to block the 0X40 interaction with OX4OL
hu0X40 binding clones in bispecific IgG format (0X40xTT) were tested for their
ability to block the interaction of 0X40 with OX4OL. Therefore, wells of a
Maxisorp
96 well plate were coated with recombinant hu0X40-Fc (R&D; cat.no. 3388-0X) at
0.156 gg/ml in PBS and incubated overnight at 4 C. Wells were washed two times
with PBST (0.05% v/v Tween20 in PBS), and subsequently blocked with 4% dried
skimmed milk (ELK) in PBS (block buffer) for one hour at room temperature.
Thereafter, wells were incubated for one hour at room temperature with 0.016
gg/ml OX4OL (R&D; cat.no. 1054-0X) diluted in block buffer in the presence or
absence of bispecific OX40xTT IgG at 20 gg/ml. Next, wells were washed 3 times
with PBST and subsequently incubated for one hour with a biotinylated anti-
OX4OL antibody (R&D; cat.no. BAF1054) diluted in 2% BSA/PBS to 0.5 gg/ml.
Next, wash steps were repeated and wells were incubated with HRP-conjugated
streptavidin (Becton Dickinson; cat.no. 554066) diluted 1:2000 in 2% BSA/PBS
for
30 minutes at room temperature. For detection of bound streptavidin, wells
were
washed three times with PBST and incubated with TMB substrate components A
and B (1:1 ratio) (Becton Dickinson; cat.no. 51-2606KC and 51-2607KC,
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
140
respectively). Reaction was stopped after 10 minutes with 1M H2SO4 and the
OD45onm was measured using an ELISA plate reader.
Based on the results, clones were binned in 2 different groups: "Blocking
clones"
reduced the ELISA signal >24% at an IgG (OX40xTT) concentration of 20 itg/ml,
compared to a control in which a TT specific competition antibody was added
(0%
blocking); "Non-blocking clones" showed an ELISA signal that was less than 24%
reduced or enhanced the ELISA signal. This experiment was performed twice,
with
different subsets of hu0X40 binding clones in bispecific IgC. format
(OX40xTT).
The results of the 0X40 antibody panel tested as OX40xTT bispecific molecules
are
given in Table 5.
Binning hu0X40 specific Fab arms present in OX40xTT bispecific IgG on
domain specificity
hu0X40 binding clones in bispecific OX40xTT IgG format were tested for domain
specificity in FACS on HEK293T cells that were transiently transfected with
eight
different pIRES-Neo3 rat/human 0X40 hybrid expression constructs (see amino
acid insert sequences below), the pIRES-Neo3_ra0X40 or the pIRES-Neo3_hu0X40
expression construct used for generation of stable ra0X40 and hu0X40
expressing
Freestyle 293F cells (Table 1). The same FACS protocol was used as described
above during specificity analysis of the antibody panel. For generation of the
hybrid constructs the extracellular domain of rat and human 0X40 was divided
in
5 domains; 4 cysteine rich domains based on Uniprot reference sequences P43489
(hu0X40) and P15725 (ra0X40) and 1 hinge domain from end of cysteine rich
domain 4 to the transmembrane domain. The following amino acid insert
sequences were cloned into pIRES-Neo3 (Figure 4) via NheI/EcoRI; Text in bold
is
the signal peptide. Underscored text is the sequence identical to human 0X40.
Text
in Italics represent the transmembrane and intracellular domain sequences.
Amino acid sequence ra/hu0X40 chimeric insert A (human cysteine rich domain 1;
rat sequence from cysteine rich domain 2 forward).
MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGN
GMVSRCSRSQNTVCRPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTE
DTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQI
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
141
RHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLV
APE GPAFA VILGLGLGLLAPLTVLLALYLLRKA WRSPNTPKPCIVGNSFRTMEE
Q'TDTHFTLAKI
.. Amino acid sequence ra/hu0X40 chimeric insert B (human cysteine rich domain
1
and 2; rat sequence from cysteine rich domain 3 forward).
MCVGARRLGRGPCAALLLLGLGLSTVTGLHC,VGDTYPSNDRCCHECRPGN
GMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQ
DTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQI
RHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLV
APE GPAFA IILGLGLGLLAPLITTLALYLLRK41171SPNTPKPCIVGNSFRITIQEE
Q'TDTHFTLAKI
Amino acid sequence ra/hu0X40 chimeric insert C (human cysteine rich domain 1
.. to 3; rat sequence from cysteine rich domain 4 forward).
MCVGARRLGRGPCAALLLLGLGLSTVTGLHC,VGDTYPSNDRCCHECRPGN
GMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQ
DTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGSNQACKPWTNCTLSGKQIRH
PASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPE
GPAFAV/LGLGLGLLAPLTVLLALYLLRK4R7SPNTPKPCWGATSFRTPIQEEQT
DTHFTLAKI
Amino acid sequence ra/hu0X40 chimeric insert D (human cysteine rich domain 1
to 4; rat sequence from hinge domain forward).
MCVGARRLGRGPCAALLLLGLGLSTVTGLHC,VGDTYPSNDRCCHECRPGN
GMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQ
DTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTL
QPASNSSDAICEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAP
EGPAFAIILGLGLGLLAPLTVLLALYLLRKAITRSPNTPKPCWGNSFRTPIQEEQ
TDTHFTLAKI
Amino acid sequence ra/hu0X40 chimeric insert E (rat cysteine rich domain 1;
human sequence from cysteine rich domain 2 forward).
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
142
MYVVVVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRC
DHTRDTVCHPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRC
RAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASINSS
DAICEDRDPPATQPQETQ GPPARPITVQPTEAWPRTSQ GPSTRPVEVPGGRA
AILGLGLI/LGLLGPLAILLALYLLRRDORLPPDAHKPPGGGSFRTMEEQADAH
STLAKI
Amino acid sequence ra/hu0X40 chimeric insert F (rat cysteine rich domain 1
and
2; human sequence from cysteine rich domain 3 forward).
MYVVVVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRC
DHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCR
CRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNS
SDAI CEDRDPPATQPQETQ GPPARPITVQPTEAWPRTSQ GPSTRPVEVPGGRA
AA/LGLGL VLGLLGPLAILLALYLLRRDORLPPDAHKPPGGGSFRTYNEEQADA
HSTLAKI
Amino acid sequence ra/hu0X40 chimeric insert G (rat cysteine rich domain 1 to
3;
human sequence from cysteine rich domain 4 forward).
MYVVVVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRC
DHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQ
CRPGTQPROSSHKLGVDCVPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPAS
NSSDAICEDRDPPATQPQETQ GPPARPITVQPTEAWPRTSQ GPSTRPVEVPGGR
A VAA/L GLGLUGLLGPLAILLALYLLRRDORLPPDAHKITGGGSFRITIQEEQA
DATISTLAKI
Amino acid sequence ra/hu0X40 chimeric insert H (rat cysteine rich domain 1 to
4;
human sequence from hinge domain forward).
MYVWVQQPTAFLLLGLSLGVTVKLNCVKDTYPS GHKCCRE CQPGH GMVSRC
DHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQ
CRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPAS
NSLDTVCEDRDPPATQPQETQ GPPARPITVQPTEAWPRTSQ GPSTRPVEVPGGR
A VAA/L GLGLUGLLGPLAILLALYLLRRDORLPPDAHKITGGGSFRITIQEEQA
DATISTLAKI
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
143
Based on the FACS results obtained with the chimeric and full length rat and
human 0X40 constructs, clones were binned based on the observed binding
patterns. Antibodies were considered to bind (chimeric) 0X40 when the MFI was
at
least three-fold that of the same cell population stained with a (negative
control)
non-binding antibody (directed to tetanus toxoid).
The results of the hu0X40 binding clones in bispecific OX40xTT IgG format are
given in Table 5.
Binning huPD-L1 specific Fab arms present in the PD-L1xTT bispecific
IgG on the ability to block the PD-1/PD-L1 interaction
14 huPD-L1 binding clones (VH sequences depicted in Figure 3) were tested for
their ability to block the interaction of PD-Li with PD-1, and their ability
to block
the interaction between PD-L1 and CD80. Therefore PD1-Fc (R&D systems; eat.
no. 1086-PD) or CD8O-Fc (R&D systems; cat. no. 140-B1) was coated to a
maxisorp
plate at 1 and 3 gg/ml, respectively. Coated wells were blocked with 4% BSA in
PBS. Thereafter, 0.55jag/m1 biotinylated PD-L1 (BPS bioscience; cat. no.
71105)
was added in the presence or absence of huPD-L1xTT bispecific IgG in the range
of
0.15 to 20 .tg/ml. Bound biotinylated PD-Li was detected with HRP-conjugated
streptavidin (BD bioscience: cat. no. 554066) diluted 1:2000 in block buffer.
After
each incubation step, the ELISA plate was washed three times with PBS-T (PBS-
0.05% v/v Tween 20). Bound streptavidin was visualized by TMB/H202 staining
and staining was quantified by means of OD45onm measurement. Clones were
considered to block the interaction of PD-1 with PD-Li when the ELISA signal
was
reduced more than 70% at an IgG (PD-L1xTT) concentration of 10 gg/ml, compared
to a control in which a TT specific competition antibody was added. See Figure
10
for the results obtained with a representative selection of the PD-Li antibody
panel
tested as PD-L1xTT bispecific molecules. Except thr MF5361, PD-Li-specific Fab
arms depicted in Figure 10 block the PD-1/PD-L1 interaction >70%. In addition,
all
other P1)-Li-specific Fab arms comprising MF sequences depicted in Figure 3
also
block the PD-1/PD-L1 interaction >70% (data not shown).
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
144
In conclusion, the tested huPD-L1 specific Fab arms block the PD-1/PD-L1
interaction, except for MF5361.
Affinity ranking huCD137, hu0X40 and huPD-L1 specific Fab arms
present in the CD137xCD137, OX40xTT and PD-L1xTT bispecific IgG
Bispecific antibodies that were shown to bind the respective human and macaque
orthologs in FACS were ranked on apparent affinity for both orthologs in FACS.
Therefore, the stable cell lines expressing the respective orthologs (Table 1)
were
harvested and diluted to 1x106cells/m1 in FACS buffer (PBS/ 0.5%BSA/ 0.5mM
EDTA). Cells were centrifuged for 2 minutes at 300 g at 4 C. Supernatant was
discarded by inverting the plate(s). 50p1 of each IgG sample, in a 11-step, 2-
fold
dilution series ranging from 10 to 0.01 lag/ml, was added and incubated for 1H
on
ice. Cells were centrifuged once, supernatant was removed and cells were
washed
twice with 150ial of FACS buffer. 50p1 diluted 1:400 goat anti human IgG PE
(Invitrogen) was added and incubated for 30 minutes on ice in the dark. After
adding FACS buffer, cells were centrifuged once, supernatant was removed and
cells were washed twice with FACS buffer. Cells were analyzed on a FACSCanto
Flow cytometer (Becton and Dickinson) in a HTS setting. Binding of the
antibodies
to cells was assessed by measuring the mean fluorescence intensity (MFI) of
the
stained cell population. Antibodies were considered to bind their target when
the
MFI was at least five-fold that of the same cell population stained with a
(negative
control) non-binding antibody (directed to tetanus toxoid).
Reference antibodies
Antibodies that inhibit the function of PD-Li and CD137 and CTLA-4 are known
in
the art. Monoclonal bivalent antibodies were constructed according to
published
information and expressed in 293F Freestyle or CHO-S cells. The anti-PD-Li
antibody MPDL3280A (surrogate based on Atezolizumab) was based on the
information disclosed in W02010077634A1. The information of the anti-CD137
antibodies 20H4.9 (surrogate based on Urelumab) and PF-05082566 (surrogate
based on Utomilumab) were obtained from WO 2005/035584 and W02015119923
respectively. VH information of M0R7480 was obtained from U58337850 B2 and
recloned in an IgG1 backbone. The information with regard to the anti-CTLA-4
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
145
antibody 101)1 (surrogate based on Ipilimumab) was obtained from PCT
Publication No. WO 01/14424.
Example 4
Materials & Methods
PBMC isolation
Human whole blood was obtained from buffy coats (Sanquin) and was diluted 1:1
with PBS. Leucosep tubes (Greiner Bio-One cat. no. 227 290) were filled with
17.5
m Ficoll-Paque Plus (Amersham Biosciences eat. no. 17-1440-02) warmed at room
temperature (RT). Ficoll-Paque Plus was spun down for 30 seconds at 1000 x g
at
RT. 30 ml of diluted whole blood was poured on top. The tubes were spun at
1000xg
for 10 minutes at RT and the mononuclear PBMC interface was harvested, washed
twice in PBS and resuspended in 250 [t1 PBS. The PBMCs were counted and
readjusted to 1x106/m1 in tissue culture medium (DMEM with 10% FCS) and
frozen down by adding an equal volume of ice-cold freeze medium (80% culture
medium/20% DMSO). Cells were stored in 1 ml aliquots at -150 C until further
use.
T cell activation assay
PBMCs were thawed and 9 volumes of culture medium (RPMI1640 with L-
glutamine and 10% heat inactivated FBS) was added. Cells were centrifuged for
10
minutes at 150 g at RT. The cell pellet was resuspended in 10 ml culture
medium
and cells were allowed to rest by incubating overnight in a 50 ml falcon tube
at
37 C, 5% CO, in 95% relative humidity. Next day, T lymphocytes were isolated
using Easy Sep T cell enrichment (pan CD3) purification procedure as described
by
the manufacturer (Stem cell Technologies cat #19051). The EasySep procedure
uses negative selection. Briefly, PBMCs were centrifuged for 10 minutes at 150
g at
RT. The cell pellet was resuspended in 2 ml PBS + 2% FBS with 1mM EDTA . The
cell suspension was filtered through a 30 jtm mesh nylon strainer. Cells
counted
and readjusted to 5x107 cells/ml in PBS + 2% FBS with imM EDTA. 50 of
EasySep Human T Cell Enrichment cocktail was added to each 2 ml cell volume,
mixed and allowed to incubate for 10 minutes at RT. Next, 50 tl of EasySep D
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
146
Magnetic Particles were added to each 2 ml cell volume and allowed to incubate
for
minutes at RT. The total volume was brought to 2.5 ml with PBS + 2% FBS with
1mM EDTA. Next, the tube was placed into the magnet allowing the undesired
cell
fraction to be bound to the magnet for 5 minutes at RT. Next, the tube was
5 .. inverted and the purified T cells fraction was poured off in a new tube,
cells were
harvested by 10 minutes centrifugation at 150 g at RT and subsequently
resuspended at a concentration of 1x105 cells/m1 in culture medium. For the T
cell
activation assay the inner wells of a 96 well plates (96 wells Flat Bottom
plates-
Cellstar #655180) were coated overnight with 30 g/mL anti-CD3 UCHT1 in PBS.
Next day, plates were washed with PBS. Antibody dilutions (80vig/m1) were
prepared and incubated at a 1:1 ratio with a cross linking antibody aHuIgG-Fe
(Bethyl eat. no. #A80-104A) for 15 minutes at RT. Next, serial dilutions of
the
mixture were prepared. 100 viL of the crosslinked antibodies were added to
each
well followed by 100 [iL purified T-cell suspension. Each plate contained a
serial
dilution of negative (PG1337) and positive control antibody (Urelumab) that
served
as reference controls. T cell cultures were stimulated for 3 days at 37 C, 5%
CO2 in
95% relative humidity prior to being tested thr IL-2 secretion and/or cell
surface
expression of antigens. The concentration of released IL-2 was determined by
AlphaLISA (Perkin Elmer cat no #AL221C). Expression of cell surface antigens
related to check point inhibition or co stimulatory antigens was determined by
flow
cytometry.
SEB assay
The functional activity of the bispecific antibodies was determined by using
PBMCs
stimulated by Staphylococcus enterotoxin B (SEB). SEB specifically activates T
cells expressing the V63 and V68 T cell receptor chain. PBMCs from 3 donors
were
thawed, washed, counted and resuspended in culture medium (RPMI1640 plus 10%
heat inactivated FBS) to a concentration of 2x106 cells/mi. Cells were seeded
in flat
bottom 96-well plates (2x105 cells/well) in the presence of SEB (2000 or 125
ng/ml).
Antibody serial dilutions starting at 20[ig/m1 were added. Each plate
contained a
serial dilution of negative (PG1337) and positive control antibody (based on
ipilumumab) that served as reference controls. Cells were stimulated for 3
days at
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
147
37 C, 5% CO2 in 95% relative humidity prior to being tested for cytokine
secretion
and/or cell surface expression of antigens.
PD-1 PD-L1 blockade reporter assay
The PD-1/PD-L1 blockade reporter assays used were developed by Promega and
are based on a two cell system; CHO cells expressing PD-L1, and a T cell
activator
and a Jurkat / NFAT-RE Reporter Cell Line overexpressing PD-1, The PD-1 / PD-
L1 blockade reporter assays were performed using the thaw and use format of
Promega. PD-Li expressing CHO cells (cat. no. C187103) were thawed in 14.5 ml
Cell Recovery Medium (DMEM/F12 containing 10% FBS), Next, 50 I cell
suspension was added to the inner wells of a 96 well half area plate (Corning,
eat.
no. 3688). Plates were incubated overnight at 37 C, 5% CO, in 95% relative
humidity. Next day, culture medium was removed and 20 I test antibody in
assay
medium (RPMI 1640 containing 4% FBS) in a serial dilution (starting
concentration 10 [ig/m1) was added to each well. Each plate contained a serial
dilution of negative (PG1337) and positive control antibody (based on
Nivolumab/MPDL3280A) that served as reference controls. PD-1 effector cells
(cat
no. C187105) were thawed in 5.9 ml Assay medium and 20 I cell suspension was
added to each well. Plates were incubated for 6 H or overnight at 37 C, 5% CO,
in
95% relative humidity, 40 1 of luciferase (Bio-Glo Luciferase Assay System,
cat.
no. G794L) was added the next day and the amount of luciferase activity was
measured using aBioTek Synergy 2 Multi-Mode Microplate Reader. Potency was
measured as luciferase activity in comparison to the negative control
antibody.
Screening of the PD-L1 antibody panel
VH from the PD-L1 antibody panel were recloned into the charged engineered Fc-
silenced vectors such that upon expression of the antibody heavy chains hetero
dimerisation of heavy chains is forced resulting in the generation of
bispecific
antibodies after transfection, The PD-L1 Fab arms were recloned in the MV1624
vector. PD-L1 antibodies were combined with MF1337, a TT targeting Fab arm, to
generate bispecific antibodies targeting PD-L1 in a monovalent manner. The
panel
of PD-Li antibodies in monovalent format was ranked for activity as shown in
Table 3.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
148
Cytokine assays
ELISA: After stimulation of T-cells or PBMCs at various times, plates were
centrifuged and media was removed. Cytokine levels were detected by AlphaLISA
in accordance with the manufacturer's instructions (Perkin Elmer).
Concentrations
were calculated based on the standard curve.
Luminex assay: Another method used to determine eytokine production in vitro
was using multiplex analysis developed by eBioscience. Levels of IFN-y, IL-2,
and
TNF-a were measured in culture supernatants following manufacturers'
instructions. Results were analyzed by eBioseience analysis software.
Generation of Jurkat CD137-NFkB1ue
A Jurkat CD137-NFkBlue stable reporter cell line was generated by stably
integrating a full length CD137 construct and a NF- KB luciferase reporter
construct in Jurkat E6 cells. Therefore the full length CD137 MV1604
[pIRESneo3](Clontech) was transfected and stable clones expressing CD137 were
generated following antibiotic selection. Next, the NF- KB luciferase reporter
construct pCIL4.32[1uc2P/NF- KB-RE/Hygro] (Promega) was transfected in the
clone
with the highest CD137 expression and stable clones expressing both CD137 and
NF- KB luciferase were selected following antibiotic selection. Clones were
selected
for their capacity to respond to CD137L after initial activation by plate
bound CD3
antibodies (clone OKT-3) and PMA/ionomycin. The clone that showed the highest
window of activation was used as a thaw and use format in the CD137 reporter
assay.
CD137 reporter assay
For the direct CD137 activation assay 96 well plates (Costar, cat. no. 3917)
were
coated overnight with 2jag/m1 anti-CD3 (OKT3) in PBS. For the CD137 activation
assay mediated by cross linking 96 well plates (Costar, cat. no. 3917) were
coated
overnight with 2 }ig/ml anti-CD3 in PBS + 10 }ig/ml anti-human IgG (Bethyl,
cat.
no. A80-104A). Next day, plates were washed with PBS. The above-mentioned
Jurkat CD137-NFkBlue cells were thawed and washed with DMEM/F12 medium
containing 10% heat inactivated fetal bovine serum (assay medium). Cells were
resuspended at a density of 2x106 cells/ml. 25 p1 cell suspension was plated
into
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
149
the inner wells of the coated 96 well assay plate. 25 gl test antibody in a
serial
dilution was added to each well (starting concentration 20 g/m1) followed by
25 I
assay medium. Each plate contained a serial dilution of negative (PG1337) and
positive control antibody that served as reference controls. Plates were
incubated
overnight at 37 C, 5% CO2, in 95% relative humidity. 50 I of luciferase
(Promega,
Bright-GbTM, cat. no. E2610) was added the next day and the amount of
luciferase
activity was measured using aBioTek Synergy 2 Multi-Mode Microplate Reader.
Large scale bispecific antibody production
Proteins were produced in FreeStyleTM 293-F cells (Invitrogen) using
polyetyleneimine (PEI) as transfection reagent with a PEI/DNA mass ratio of
2.5:1.
Bispecific antibodies were transfected using a 1:1 DNA mass ratio at 0.4-2L
scale.
Cell supernatants were purified by batch-wise incubation with Mab Select SuRe
LX
sepharose (GE Healthcare), followed by acidic elution and neutralization using
Tris. The proteins were consequently desalted and centrifuged followed by
cation
exchange purification using a Resource S (GE Healthcare) column equilibrated
in
mM phosphate buffer pH 6Ø A gradient elution to 1M NaCl was used to elute
the proteins and protein containing fractions were collected and analyzed
using
NuPAGE 4-12% Bis-Tris protein gels (Invitrogen). Fractions containing
bispecific
20 antibody were pooled and applied to a Superdex200 26/600 gel filtration
column
(GE Healthcare) equilibrated in PBS. Fractions were collected and analyzed on
NuPAGE, after which monomeric antibody-containing fractions were pooled and
sterile filtered (0.22 gm).
25 Results
CD137 reporter assay
The panel of CD137 bivalent antibodies was screened in the above-mentioned
CD137 direct activation reporter assay. A representative figure of a selection
of the
antibodies is shown in Figure 11. 60% of the antibody panel was capable to
directly
activate CD137 to variable degree.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
150
Screening CD137xPD-L1 antibody panel
One limitation of CD137 bivalent antibodies in cancer drug development is
systemic activation of CD137 expressing cells. This can lead to toxicity of
the
antibody, due to non-specific targeting [Melero, 2013]. Bispecific antibodies
can
overcome this limitation by selectively targeting cells, either by targeting
cells that
co-express both targets, such as two tumor antigens or by targeting two
different
cells each expressing one of the targets. The latter can only occur when cells
are in
close proximity to one another. To investigate the possibility of selective
activation
of CD137, bispecific antibodies were generated that are composed of one Fab
arm
targeting CD137 and one Fab arm targeting PD-Li. With PD-Li representing both
an antigen present at high concentrations on tumor cells as well as an antigen
highly expressed on activated T cells present at the tumor site [Pulko et al,
20111.
As such the bispecific CD137xPD-1,1 antibody would be able to activate CD137
in
'cis' when targeting CD137 and PD-Li on the same cell or in 'trans' by
targeting
CD137 on immune cells and P11)-L1 on adjacent cells. On top of this mechanism,
the
inclusion of a PD-1 blocking Fab arm would be able to turn an inhibitory
signal
into a stimulatory signal.
VH from the CD137 and PD-Li antibody panel were recloned into the charged
engineered Fc-silenced vectors such that upon expression of the antibody heavy
chains heterodimerisation of heavy chains is forced resulting in the
generation of
bispecific antibodies after transfection. A total of 320 CD137xPD-1,1
bispecific
antibodies comprising 40 different CD137 Fab arms and the 8 different PD-Li
Fab
arms depicted in Table 3 were produced in 24-well format and IgG purified. All
antibodies were tested for their capacity to induce dose dependent luciferase
expression in the CD137-lue reporter system directly or in the presence of an
anti-
human IgG cross linking antibody. Surrogate antibodies 20H4.9 and MOR7480
were included as reference antibodies in the respective assays.
An example of the functional activity in the CD137-luc reporter assay of
several
CD137xPD-1,1 bispecific antibodies in the absence or presence of the anti-
human
IgG cross linking antibody is shown in Figure 12. The figure shows that the
capacity of the CD137xPD-L1 bispecific antibodies to activate CD137 induced
luciferase activity is highly dependent on cross linking by the anti-human IgG
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
151
antibody since this increases the magnitude of luciferase activity by 25%.
Significant enhancement of IFN-y production after CD137 ligation also has been
observed for the anti-CD137 antibody known in the art as 20H4.9
(WO 2005/035584). The top 25% CD137xPD-L1 of the bispecific antibody panel was
composed of 22 CD137 Fab arms in combination with one to seven PD-L1 Fab arms
of the total panel of eight PD-L1 Fab arms.
The top 25% CD137xPD-L1 bispecific antibody panel was next tested for their
capacity to induce IL-2 release in a primary T cell activation assay in
comparison
to the bivalent parental CD137 antibodies and parental CD137 Fab arm combined
with an irrelevant Fab arm targeting Tetanus Toxoid. In this experimental
setup
monovalent activation versus bivalent activation could be monitored. The top
panel
of Figure 13 shows an example of a set of three antibodies that induce IL-2
secretion upon CD137 activation if present in a CD137x CD137 bivalent format
in
the range of the 20H4.9 reference antibody. In contrast, as shown in the
bottom
panel of Figure 13, none of the CD137xPD-L1 bispecific antibodies was able to
induce IL-2 secretion to the level of the bivalent CD137 parental Fab. All
CD137xPD-L1 bispecific antibodies displayed the same activity as the CD137xTT
variants indicating that CD137 signaling complexes could not be formed
effectively
by binding to CD137 and PD-L1 at the same cell surface (binding in 'cis'). The
lack
of in cis T cell activation of this CD137xPD-L1 bispecific antibody panel is
advantageous, as this diminishes the potential of in cluo toxicity due to
nonspecific
T cell activation.
Transactivation assay
To test whether bispecific CD137xPD-L1 antibodies would be able to activate
CD137 in 'trans', bispecific antibodies were tested in a two cell assay
whereby
CD137 signaling in immune cells would occur through cross-linking by a second
cell. The in vitro assay was composed of two different cell lines, i.e. CHO-PD-
Li
cells mimicking tumor cells expressing P11)-Li and Jurkat CD137-luc reporter
cells
representing the immune cells. The same assay set-up was used as in the CD137-
luc reporter with coated anti-CD3 providing the first T cell activation
signal. The
effector target cell ratio used was 4:1 with target cells being either CHO
wildtype
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
159
or CHO-PD-L1 cells. Figure 14 shows an example whereby the CD137 bispecific
antibodies PB14671 and PB14580, which are composed of the same CD137 Fab
arm (MF6744) and two different PD-L1 Fab arms (MF5361 or MF5594,
respectively) were both capable of inducing CD137 reporter cell activity in
the
presence of CHO-PD-L1 cells whereas no CD137 stimulation occurred in the
presence of wild-type CHO wild-type cells. In addition, the CD137 bispecific
antibodies PB14681 and PB14590, which are composed of the same CD137Fab arm
(MF6783) and two different PD-L1 Fab arms (MF5361 or MF5594, respectively)
were both capable of inducing CD137 reporter cell activity in the presence of
CHO-
P) PD-Li cells whereas no CD137 stimulation occurred in the presence of
wild-type
CHO wild-type cells. Moreover, all CD137xPD-L1 bispecific antibodies were as
potent as the reference control antibody 20H4.9. A combination of the
CD137xP1I)-
Ll bispecific antibodies PB14580 and PB14671 (Oligoclonicsk format) induced a
high luciferase activity.
Transactivation assay with primary T-cells
The transactivation assay was reformatted to primary cells by adding CHO
wildtype or CHO-PD-Li cells in the T cell activation assay. An effector target
cell
ratio at the start of the assay of 1:1.8 for CHO-PD-Li and CHO wildtype cells
was
used. For the T cell activation assay the inner wells of 96 well plates (96
wells Flat
Bottom plates- Constar #655180) were coated overnight with 30 jughnL anti-CD3
OKT-3 in PBS. Next day, plates were washed with PBS. 50 [LI, of antibody
solution
was added followed by 25 L purified T-cell suspension of 2x106 cells/well and
25 L
purified CHO-Kl or CHO-PD-Li in the ratio's as indicated above were added per
well. Cultures were stimulated for 3 days at 37 C, 5% CO2 in 95% relative
humidity prior to being tested for IL-2 secretion. The concentration of
released IL-2
was determined by AlphaLISA (Perkin Elmer cat no #AL221C).
Two CD137xPD-L1 bispecific antibodies (PB14671 and PB14580) were tested, as
well as the Oligoclonics format and a CD137xTT format. The IL-2 release at
day 3
depicted in Figure 15 shows that the CD137xPD-L1 antibodies induced IL-2
production in T cells in the presence of CHO-PD-Li cells to a higher extend
than
control antibody 20H4.9. Moreover, the CD137xTT format failed to induce IL-2
release. In the presence of CHO wild-type cells IL-2 levels are produced at
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
153
background levels, with the exception of control antibody 20H4.9. A
combination of
the two CD137xPD-L1 bispecific antibodies (Oligoclonics format) induced a
high
luciferase activity, thereby confirming the previous experiment. The
Oligoclonics
format can be either targeting the same CD137 epitope and two different PD-Li
epitopes (as shown in Figures 14 and 15) or targeting two different CD137
domains
and two different PD-L1 domains.
SEB assay
To test the CD137xPD-L1 bispecific antibodies in a physiological setting where
APCs are present that express PD-L1, both CD137xPD-L1 antibodies (PB14671
and PB14580), the CD137xTT antibodies and the Oligoclonics format were tested
in the SEB assay. One of the CD137xPD-L1 bispecific antibodies (PB14580)
showed
a higher activation in comparison to the negative control antibodies and was
far
more potent in comparison to the reference antibodies targeting either CD137
(20H4.9) or PD-Li (MPDL3280A); see Figure 16. Induction of IL-2 by the
CD137xPD-L1 Oligoclonics format was also potent.
Additional testing
A panel of 24 anti-CD137 Fab arms representing the eleven different CD137 bins
A-K (Table 2) were combined with seven PD-Li specific, blocking Fab arms and
one
PD-Li specific, non-blocking Fab arm (Table 3) and produced in 24-well format.
The produced CD137xPD-L1 bispecific antibodies were subsequently tested in a
serial titration for their capacity to induce dose dependent luciferase
expression in
the CD137-luc reporter system in the presence of CHO-PD-Li cells or CH(L)
wildtype cells. 20H4.9 and the negative control antibody were included as
reference
antibodies (Figure 19). Antibodies (56 in total) that showed the highest
induction of
luciferase were selected and tested in a serial titration in the activated T
cell assay
in presence or absence of CHO-PD-Li cells or CHO wildtype cells. In parallel
the
antibodies were tested in the SEB assay. As a read-out for CD137 activation,
IL-2
release was measured. An overview of the characteristics and activity of the
24
bispecific antibodies tested in the T-cell-activation assay are shown in Table
7.
The twelve CD137 Fab arms that were found to be active for both PD-L1 arms in
both the activated T cell and SEB assay, were selected for combinations with 7
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
154
different PD-Li Fab arms. As well as being produced as bivalent monospecific
IgGs, the 12 CD137 arms were produced as bispecific/monovalent CD137xPD-L1
antibodies, each combined with one of the 7 different PD-L1 arms. Thus, a
total of
84 bispecific CD137xP1I)-L1 antibodies were tested in a dose dependent
titration in
a SEB assay with IL-2 release as readout. The data in Figure 20 show that when
present in a CD137xPD-L1 format; four out of the twelve CD137 Fab arms
(MF6783, MF6749, MF6737 and MF6788) showed a lower potency in the SEB
assay compared to the other Fab arms. Therefore CD137xPD-L1 bispecific
antibodies comprising these four CD137 Fab arms were excluded for further
testing. During additional SEB testing CD137xPD-L1 combinations comprising
MF6808, MF6763, MF6754, MF6785 and MF6797 induced the highest IL-2
cytokine release. (Figure 21). CD137xPD-L1 combinations comprising MF6805,
MF6744 and MF6825 induced a lesser amount of IL-2 cytokine secretion. The
potency of CD137xPD-L1 combinations comprising MF6808, MF6763, MF6754,
MF6785 and MF6797 was further analyzed during a SEB assay in a serial
titration
by measuring the induction of IL-2, IFNy and TNFa release as determined by
Luminex multiplex. Next, the antibodies were ranked upon EC50 values of IL-2
release (Table 4). A panel of 28 CD137xPD-L1 bispecific antibodies (Table 4)
comprising four different CD137 Fab arms showed the highest activity in the
SEB
assay. These four CD137 Fab arms could be mapped to the same binding region in
CD137 (binding domain 2) and moreover all were completely blocking the
interaction between CD137 and CD137L. None of them showed agonistic activity
in
the Jurkat CD137 reporter screen as a bivalent monoclonal (Figure 17). CIEX
profiles of the 28 CD137xPD-L1 bispecific antibodies demonstrated that
CD137xPD-L1 antibodies comprising a PD-Li Fab arm based on MF5553 such as
MF7702 had optimal CIEX profiles in terms of consideration as a lead candidate
antibody for manufacturing.
Example 5
Affinity ranking of anti-CD137 antibody panel
The affinity of a panel of anti-CD137 Fabs that induced T cell activation in
combination with the PD-Li Fab arms in trans was determined by Biacore.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
155
To this end, human recombinant C,D137 protein was coupled to a chip and a
Biacore T100 instrument analyzed the affinity of the difThrent anti-CD137
antibodies in monovalent bispecific format: one Fab arm was specific for CD137
and the other for an irrelevant ligand, namely tetanus toxoid (TT).
In these experiments, bispecific anti-(CD137xTT) IgG was produced by means of
transient transfection of the encoding constructs in Freestyle 293F cells in a
small
scale production (24 well format , see example 2). In each transfection, a
construct
encoding one of the selected anti-CD137 sequences was combined with MF1337
encoding the anti-TT sequence.
Surface plasmon resonance (SPR) on a Biacore T100 instrument was then used to
determine the affinities of the antibodies. To this end, huCD137-Fc protein
(RND
Systems # 838-4B) was diluted to 5 !Ag/ml in sodium acetate coupling buffer,
pH
5.0, and coupled to the surface of cell 2 of a CMS biosensor chip, to a level
of 150
resonance units (RU). Flow cell 1 served as a negative control surface. To
determine the kinetic dissociation rate constants (Koff values), test
antibodies were
diluted in HEPES buffered saline (HBS) to 15iLtg/m1 (100nM) and run over both
flow cell 1 and 2 of the CD137-coated sensor chip at 30ial/min. Regeneration
was
performed with a pulse of 10 1 of 100mM HC1. The dissociation rate constant
was
determined from the obtained sensorgrams (i.e. graphs of response vs time)
using
.. curve fitting in BIAevaluation software.
To measure binding kinetics of the antibody panel and obtain kinetic
association
and dissociation rate constants of antibody binding to CD137, different
concentrations of this subset of test antibodies were run over the surfaces of
flow
cells 1 and 2 of a newly coated chip. Antibodies were diluted in HBS to 200 nM
(i.e.
30 }fg/m1), serially diluted two-fold (4 dilutions, 100nM - 50nM -25 nM -12.5
nM)
and then tested for binding to the chip in a kinetic run at high flow rate (30
jul/min). Regeneration was performed with a pulse of 10 kfl of 100mM HC1. The
obtained sensorgrams were analyzed using BIAevaluation software, and kinetic
association (Ka) and dissociation (Kd) rate constants were determined, thereby
generating data on the affinities (Kr) values) of the different anti-CD137 Fab
arms.
For each antibody concentration, the on-rates and off-rates were determined
separately and then averaged.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
156
The results are shown in Table 6. All tested anti-CD137 Fabs had an affinity
in the
low nM range..
Example 6
Generation of Jurkat 0X40-NFkBlue
A Jurkat OX-40-NFkBluc stable reporter cell line was generated by stably
integrating a full length OX-40 construct and a NF-KB luciferase reporter
construct
in Jurkat E6 cells. Therefore the full length OX-40 MV1616
[pIRESneo3](Clontech) was transfected and stable clones expressing OX-40 were
generated following antibiotic selection. Next, the NF- KB luciferase reporter
construct pGL4.32[1uc2P/NF- KB-RE/Hygro] (Promega) was transfected in the
clone
with the highest OX-40 expression and stable clones expressing both OX-40 and
NF- KB luciferase were selected following antibiotic selection. Clones were
selected
for their capacity to respond to OX-40L after initial activation by plate
bound CD3
antibodies (clone OKT-3) and PMA/ionomycin. The clone that showed the highest
window of activation was used as a thaw and use format in the OX-40 reporter
assay.
OX-40 reporter assay
For the direct OX-40 activation assay and the OX-40 activation assay mediated
by
cross linking, 96 well plates (Costar, eat. no. 3917) were coated overnight
with 2
g/m1 anti-CD3 (OKT3) in PBS. Next day, plates were washed with PBS. Jurkat
OX-40-NFkBluc were thawed and washed with 1I)MEM/F12 medium containing
10% heat inactivated fetal bovine serum (assay medium). Cells were resuspended
at a density of 5x105cells/ml. 25 I cell suspension was plated into the inner
wells
of the coated 96 well assay plate. Test antibody was combined with a 2.5 fold
aHulgG-Fe (Bethyl, cat. no. A80-104A) antibody and serial dilutions were
prepared
(start concentration test IgG 20 g/m1). Antibody mixtures were incubated for
15
minutes at room temperature. Next 50 iLt1 antibody mixture was added to the
cells
followed by 25 1 assay medium. Each plate contained a serial dilution of
negative
(PG1337) and positive control antibody that served as reference controls.
Plates
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
157
were incubated 6H at 37 C, 5% CO, in 95% relative humidity. 50 pi of
luciferase
(Promega, Bright-GbTM, cat. no. E2610) was added and the amount of luciferase
activity was measured using aBioTek Synergy 2 Multi-Mode Microplate Reader.
The panel of OX-40 bivalent antibodies was screened in the OX-40 direct
activation
reporter assay and in the T cell activation assay. Four different OX-40 Fab
arms
were selected to test whether bispecific OX40xPD-L1 or OX40xPD-1 antibodies
would be able to activate 0X40 in 'cis' or 'trans'. Therefore the bispecific
antibodies
were tested in a two cell system, using CHO cells overexpressing P11)-Li and
Jurkat
.. OX-40-NFkBluc. PD-Li was provided in 'trans' on the CHO cells and PD-1 in
'cis'
on activated Jurkat OX-40-NFkBluc reporter cells. The same assay set-up was
used as in the Jurkat OX-40-NFkBluc assay with coated anti-CD3 providing the
first T cell activation signal. The effector target cell ratio used was 4:1
with target
cells being either CHO wildtype or CHO-PD-Li cells. Figure 18 shows an example
of four different 0X40 Fab arms combined with either a P11)-L1 (MF5561) or PD-
1
(MF6256) blocking Fab arm. OX40xPD-L1 antibodies induced OX40 reporter cell
activity in the presence of CHO-PD-L1 cells to the same level as the anti-
CTLA4
antibody based on ipilumumab. In contrast OX4OxPD-1 antibodies showed a basal
activity. In the absence of cells expressing PD-L1, the activity of OX40xPD-L1
antibodies returned to baseline.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
158
Example 7
In Example 4, it was determined that five CD137-specific Fab arms are
preferred
in view of their T cell trans activation capacity.
In this Example a panel of three bispecific antibodies was used, consisting of
three
candidate CD137 arms (6763, 6785 and 6797), and one PD-L1 arm (7702).
Bispecific antibodies were produced in 293F Freestyle cells, and purified via
protA,
CIEX and gel filtration. Subsequently, the antibodies were tested in several
assays.
We tested the four Fab arms both in parental bivalent monospecific format
(anti-
CD137 or anti-PD-L1) and in bispecific format (anti-CD137xPD-L1) and compared
these antibodies with the benchmark anti-CD137 antibody 20H4.9, the benchmark
anti-PD-Li antibody YW243.55.570, and with a negative control antibody (anti-
RSV antibody PG2708).
For the Materials & Methods of the assays described in this Example, reference
is
also made to Example 4.
The antibodies are listed below.
Antibody name MF sequences Target
PB17309 6763 x 7702 CD137 x P11)-L1
PB17310 6785 x 7702 CD137 x PD-L1
PB17311 6797 x 7702 CD137 x PD-Ll
PG6763 6763 x 6763 CD137
PG6785 6785 x 6785 CD137
PG6797 6797 x 6797 CD137
PG7702 7702 x 7702 P11)-L1
FACS analysis
Antigen specificity and affinity
Binding of the monospecific and bispecific IgGs to human (hu) and cynomolgus
(ey)
CD137 was verified by FACS analysis using 293FF stable cell clones expressing
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
159
either huCD137 or cyCD137. To this end, cells were incubated with an 8-step
serial
titration of antibody and binding intensity was analyzed through subsequent
binding of a secondary antibody, anti-human IgG bound to the fluorescent dye
phycoerythrin (PE). The binding intensity expressed as mean PE fluorescence
for
each of the antibodies tested is shown in Figure 22. Of the monospecific
parental
anti-CD137 antibodies, PG6785 bound to human C,D137 with the highest affinity,
followed by PG6797 and then PG6763. Bispecifie PB17311 (6797x7702) bound
huCD137 with the highest affinity, followed by PB17309 (6763x7702) and then
PB17310 (6785x7702). Of the parental anti-CD137 antibodies, PG6785 again
bound to cynomolgus CD137 with the highest affinity, this time followed by
PG6797 and then PG6763. Bispecific PB17311 (6797x7702) bound eyCD137 with
the highest affinity, followed by PB17309 (6763x7702) and then PB17310
(6785x7702). Of note, as shown in Figure 22, when the three CD137-specific Fab
arms are present in a bispecific, monovalent antibody, they are able to bind
both
huCD137 and cyCD137 equally well, as also observed for the monospecific,
bivalent
parental antibodies.
Binding of the monospecific and bispecific IgGs to human (hu) and rhesus
macaque
(re) PD-Li was verified by FACS analysis using C,HO-K1 stable cell clones
expressing huPD-L1 or rePD-Li. To this end, cells were incubated with an 8-
step
serial titration of antibody and binding intensity was analyzed through
subsequent
binding of a secondary antibody, anti-human IgG-PE. The binding intensity
expressed as mean fluorescence intensity (MFI) for each of the antibodies
tested is
shown in Figure 23. As expected, the parental anti-CD137 antibodies did not
bind
to human or rhesus macaque PD-L1, while the parental anti-PD-Li PG7702
antibody did.. Importantly, all three bispecific antibodies bound strongly to
PD-L1,
all with higher affinity than the positive control antibody. This means that
even
when present in a monovalent, bispecific antibody the MF7702 arm has a higher
affinity for PD-Li as compared to the bivalent control antibody YW243.55.S70.
Binding to activated T cells
We tested the binding affinity of the antibody panel for activated T cells. To
this
end, peripheral blood mononuclear cells (PBMCs) were collected from a donor
and
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
160
left to rest overnight. T cells were subsequently isolated and activated by
incubating them for 3 days on plates coated with anti-CD3 antibody OKT3. The
activated T cells were harvested and stained with a serial titration of the
IgGs in
the antibody panel and with control IgGs. Antibody binding was measured on
FACS through subsequent binding of a secondary antibody, anti-human IgG-PE.
The binding intensity expressed as MFI for each of the antibodies tested is
shown
in Figure 24, with binding of the bispecific IgGs shown on the left and
binding of
monospecific IgGs on the right. PB17311 (6797x7702) showed the most potent
binding. Importantly, the binding affinities of the positive control
antibodies were
lower than those of the bispecific antibodies. This means that the bispecific
antibodies of the present invention have a higher affinity for activated T
cells as
compared to the PD-Li specific benchmark antibody YVV243.55.S70 (based on
Atezolizumab) and the CD137 specific benchmark antibody 20H4.9 (which is based
on Urelumab).
Ligand-blocking assays
PD-1/PD-L1 competition assay
The capacity of the bispecific and monospecific IgGs to block PD-Li ligand
binding
was tested in a PD-1/PD-L1 competition ELISA, whereby increasing amounts of
antibodies containing an anti-PD-Li arm were expected to reduce the amount of
biotinylated PD-L1 that could bind to a plate coated with PD-1 Fe. To this
end,
11g/ml PD-1-Fc (R&D; #. 1086-PD) was coated to a maxisorp plate, and
biotinylated PD-Li (BPS Bioscience; cat.nr. 71105) was added in solution in
the
presence or absence of a serial dilution of each antibody starting at a
concentration
of 10 vig/ml. Bound PD-Li was detected through subsequent binding of
streptavidin
conjugated to horseradish peroxidase (HRP), and addition of colorless
substrate
which HRP catalyzes into a colored product. The optical density (OD) of the
solution, measured at 450 nm using an ELISA plate reader, is an indication of
bound PD-L1. Binding curves are shown in Figure 25, with binding of the
bispecific
IgGs shown on the left and binding of monospecific IgGs on the right. As
expected,
the positive control anti-PD-Li antibody showed a high level of blocking
activity,
and the negative control antibody showed none. The monospecific anti-CD137
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
161
antibodies were also negative for P11)-L1 blocking. For the IgGs containing at
least
one anti-PD-L1 arm, all were able to block PD-1/PD-L1 binding. The parental
monospecific anti-PD-L1 antibody PG7702 was found to be just as effective as
the
benchmark anti-PD-Li antibody YW243.55.S70 at blocking PD-L1 binding. The
bispecific IgGs all had good, similar levels of blocking activity.
Cell-based huCD137 ligand blocking assay
The capacity of the bispecific and monospecific IgGs to block CDl37 ligand
binding
was also tested. We tested the three candidate CD13i arms (6763, 6785 and
6797)
and the PD-Li arm (7702) both in parental bivalent monospecific format (anti-
CD137 or anti-PD-L1) and in bispecific format (anti-CD137xPD-Li) and compared
these antibodies with the benchmark anti-CD137 antibody 20H4.9 and PF-
05082566 and with a negative control antibody (anti-RSV antibody PG2708).
To analyze CD137 ligand blocking under conditions that are physiologically
relevant, the bispecific and monospecific IgGs were tested in a cell-based
huCD137
ligand blocking assay using flow eytometry. In this assay, increasing amounts
of
antibodies containing an anti-CD137 arm were expected to reduce the amount of
huCD137L recombinant protein that could bind to CHO-K1 cells stably expressing
huCD137. To this end CHO(huCD137) cells were co-incubated with huCD137L
protein together with serial dilutions of each antibody. Bound huCD137L was
detected with a secondary biotin-conjugated anti-huCD137L antibody, followed
by
staining with streptavidin conjugated to phyeoerythrin (PE).
Methods
CH(1) cells stably expressing huCD137 were harvested, counted and diluted in
FACS buffer to 5x105 cells/ml and 200 pi (containing 1x105 cells) was added to
each
well of a U-bottom 96-well microliter plate. Cells were kept on ice. Cells
were spun
for 3 min at 300 g at 4 C and washed by adding 200 pi ice-cold FACS buffer.
Cells
were spun again for 3 min at 300 g at 4 C and the pellet resuspended in 25 pi
antibody dilution in FACS buffer (3-fold serial dilutions from 25 to 0.034
jag/m1)
plus 25 .1 of a solution of huCD137L-FLAG protein (Adipogen # AG-40A-0198T;
end concentration 0.06 jug/m1). Plates were incubated for 60 min on ice in the
dark.
Cells were then washed twice by adding 200 pl ice-cold FACS buffer and
spinning
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
162
for 3 min at 300 g at 4 C. 50 p1/well of biotinylated polyelonal goat huCD137L
antibody (R&D Systems # BAF2295) diluted to 1 jug/m1 in ice-cold FACS buffer
was
then added. Cells were resuspended and plates incubated for 60 min on ice in
the
dark, followed by washing twice as before. 50 id/well of streptavidin-PE
diluted
1:200 in ice-cold FACS buffer was then added. Cells were resuspended and
plates
incubated for 30 min on ice in the dark, followed by washing twice as before.
Cells
were resuspended in 100 jai FACS buffer per well and fixed by the addition of
100
ill 4% paraformaldehyde (PFA) solution. Samples were measured using a BD
FACSCanto flow cytometer according to instructions in the BD manuals. The
degree of binding of huCD137 ligand was expressed as the mean fluorescence
intensity (MFI) of bound streptavidin-PE.
Results
The binding curves obtained are shown in Figure 26. As expected, the negative
control did not block CD137 ligand binding. Blocking of ligand binding by the
positive control antibodies differed: benchmark antibody PF-05082566 showed
strong blocking, while 20H4.9 showed relatively weak and incomplete blocking.
Of
the three monospeeific anti-CD137 antibodies, PG6785 was the best blocker and
PG6797 (parent of PB17311) was the second best. The three corresponding
bispecific anti-CD137 x anti-PD-L1 antibodies were also able to block CD137
ligand
binding. Since this is a cell-based assay, these results are indicative for
conditions
that are physiologically relevant.
PD-1/PD-L1 reporter assay
Another step in the characterization of the candidate anti-CD137xPD-L1
antibodies was to determine whether they could block the PD-1/PD-L1 pathway,
and to compare this with the activity of a control antibody specific for PD-
Li. This
blocking activity was tested in ultro in a physiologically relevant PD-1/PD-L1
blockade reporter assay developed by Promega based on a two-cell system: CH()
cells expressing PD-Li and a T-cell receptor activator, and a Jurkat/NFAT-RE
reporter cell line overexpressing PD-1. The Jurkat T cells contain a
luciferase
reporter gene that can become activated through the NFAT (nuclear factor of
activated T-cells) pathway. Interaction of PD-1 with PD-Li inhibits activation
of
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
163
this pathway. However, blocking the PD-1/PD-L1 interaction with antibodies
against PD-1 or PD-Li can activate the NFAT pathway. Therefore, the greater
the
degree of PD-1/PD-L1 blockade, the greater the activation of the luciferase
reporter
gene. To this end, serial dilutions of each antibody were added to PD-Li-
expressing
CHO cells before addition of Jurkat/NFAT-RE reporter cells overexpressing PD-
1.
The degree of blockade after 24 hours expressed as fold induction of the
reporter
gene is shown in Figure 27, with binding of the bispecific IgGs shown on the
left
and binding of the monospecific anti-PD-L1 IgG on the right. Again, the
bivalent
parental antibody 7702 was more potent than the positive control benchmark
antibody YW243.55.S70. The bispecific IgGs all had good, similar levels of
blocking
activity.
Example 8
Effect of PD-L1 expression level on transactivation of CD137 by
CD137xPD-L1 bispecifics
Culturing of cell lines
MDA-MB231 cells (cat. no. CRM-HTB-26) were purchased from ATCC and
routinely maintained in DMEM high glucose (Gibco) supplemented with 100 mM
sodium pyruvate (Gibco) MEM non-essential amino acids (Gibco) and 10% FBS
(Lonza). BxPC-3 cells (cat. no. CRL-1687 )were obtained from ATCC and
routinely
maintained in RPMI-1640 (Gibco) supplemented with 10% FBS (Lonza).
Mode of action CD137xPD-L1 antibodies
The Jurkat CD137-luc reporter transactivation assay was used to determine
whether CD137xPD-L1 antibody-mediated transactivation would occur at
physiological PD-Li expression levels and whether it correlates to PD-Li
expression levels. Therefore, the number of PD-L1 binding sites on various CHO-
PD-L1 cell lines and human tumor cells lines were determined by QIFIKIT
analysis (DAK0). Three CHO-PD-Li cell lines showing PD-Li expression levels
corresponding to human tumor cell lines expressing relatively high (ES-2
cells)
intermediate (MDA-MB231) or low (BxPC-3) levels of PD-Li were selected. Figure
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
164
28A shows an example of three CD137xPD-L1 bispecific antibodies in using the
three selected CHO cell lines expressing ¨6,000 to ¨72,000 PD-L1 binding sites
per
cell. The data show that CD137xPD-L1 bispecific antibodies show high
activation
when more than 3.8 10'' P11)-Li copies are present on the cell. At low P11)-Li
levels;
in the presence of CHO cells expressing merely ¨6000 PD-L1 binding sites per
cell
a low level of activation is observed. Hence, transactivation by CD137xPD-L1
bispecific antibodies will occur in the vicinity of cells expressing high
levels of PD-
L1 such as occur in an immunosuppressive tumor micro environment and therefore
provide an optimal therapeutic window for the CD137xPD-L1 bispecific antibody.
Figure 28A shows a positive correlation between CD137xPD-L1 bispecific
antibody-
mediated NF-kB activation and PD-Li expression levels on CHO cells for all
antibodies tested.
Figure 28B shows an example of the Jurkat C D137-lue reporter transactivation
assay wherein the CHO-PD-Li cells were substituted for the human tumor cell
lines expressing high, intermediate and low surface PD-Li levels. This
experiment
confirmed that CD137xPD-L1 bispecific antibody-mediated transactivation is
associated with accessory cell PD-Li expression levels, and that the CD137xPD-
L1
bispecific antibodies are capable of transactivation in the presence of tumor
cells
expressing high levels of PD-Li.
Next, it was assessed whether CD137 transactivation in the presence of P11)-L1
expressing accessory cells was a specific trait of CD137xPD-L1 bispecific
antibodies. Fig 28C shows an example wherein Jurkat CD137-lue reporter cell
transactivation in the presence of P11)-Li expressing accessory cells was
assessed
for CD137xPD-L1 bispecific antibodies, their parental monospecific bivalent
(CD137xCD137) and parental monospecific monovalent CD137 (CD137xTT) and
PD-Li (TTxPD-L1) antibodies. All IgG were tested at 10 pg/ml. The data show
that
only CD137xPD-L1 bispecific antibodies mediated transactivation in the
presence
of PD-L1 expressing CHO or ES-2 cells. As expected, reference control antibody
20H4.9 directly activated Jurkat CD137-lue reporter cells and was independent
of
PD-Li expression by accessory cells.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
165
Example 9
CHO-PD-L1 x T cell transactivation assay
To determine the added value of using a bispecific IgG, we assessed the
ability of
several bispecific anti-CD137xPD-L1 antibodies to induce cytokine release by T
cells in a transactivation assay, and compared their activation with that of
benchmark bivalent antibodies against PD-Li (YW243.55.S70) and CD137
(20H4.9). These benchmark antibodies were tested alone and in equimolar
combination. To this end, purified and activated T cells from a single healthy
donor
were co-incubated for 3 days with CHO-PD-L1 cells and a serial dilution of the
test
antibodies (see also Example 4 for a detailed description of this assay).
Levels of IL-
2, IFNy and TNFa were subsequently measured in undiluted culture supernatants.
The degree of cytokine release measured in this transactivation assay is shown
in
Figure 29. As shown in Figure 29, all three bispecific antibodies were more
potent
at inducing cytokine release than either one of the reference antibodies.
Importantly, each one of the three bispecific antibodies was also more potent
at
inducing cytokine release than a combination of the two reference antibodies,
demonstrating their superior T cell activating characteristics.
Cytokine release during T cell transactivation assay
To determine the added value of using a bispecific IgG, we compared one of the
bispecific antibodies (PB17311; 6797 x 7702) with a mix of its parental
monospecific bivalent parental IgGs and with benchmark bivalent antibodies
against PD-L1 and CD137, in terms of their ability to activate cytokine
release by
T cells in a transactivation assay. These benchmark antibodies are based on
therapeutic antibodies used in the clinic: anti-PD-L1 clone YW243.55.S70 is
based
on Atezoluzumab, anti-CD137 clone 20H4.9 is based on Urelumab and anti-CD137
clone PF-05082566 is based on Utomilumab. These benchmark antibodies were
tested alone and in equimolar combination.
In these experiments, antibodies were tested in a 6-step 10-fold titration
starting at
201.tg/ml. PBMCs from 2 donors were thawed and 9 volumes of culture medium
(RPMI1640 with L-glutamine and 10% heat inactivated FBS) was added. Cells
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
166
were centrifuged for 10 minutes at 150 g at RT. The cell pellet was
resuspended in
ml culture medium and cells were allowed to rest by incubating overnight in a
50 ml falcon tube at 37 C, 5% CO, at 95% relative humidity. In preparation for
the
transactivation assay, the inner wells of a 96-well plate (Cellstar, cat. no.
655180)
5 were coated overnight with 5 g/mL anti-CD3 antibody (clone OKT3) in PBS.
Next day, T lymphocytes were isolated using the Easy Sep T cell enrichment
(pan
CD3) purification procedure as described by the manufacturer (Stem cell
Technologies, cat. no. 19051). The EasySep procedure uses negative selection.
10 Briefly, PBMCs were centrifuged for 10 minutes at 150 g at RT. The cell
pellet was
resuspended in 2 ml PBS + 2% FBS with 1mM EDTA. The cell suspension was
filtered through a 30 m mesh nylon strainer. The cells were counted and
readjusted to 5x107 cells/m1 in PBS + 2% FBS with 1mM EDTA. 50 ml of EasySep
Human T Cell Enrichment cocktail was added to each 2 ml cell volume, mixed and
allowed to incubate for 10 minutes at RT. Next, 50 pl of EasySep D Magnetic
Particles were added to each 2 ml cell volume and allowed to incubate for 5
minutes at RT. The total volume was brought to 2.5 ml with PBS + 2% FBS with
1mM EDTA. Next, the tube was placed into the magnet allowing the undesired
cell
fraction to be bound to the magnet for 5 minutes at RT. Next, the tube was
inverted and the purified T cells fraction was poured off into a new tube,
cells were
harvested by 10 minutes centrifugation at 150 g at RT and subsequently
resuspended at a concentration of 106 cells/ml in culture medium.
The same day, the pre-coated 96-well plates were washed with PBS and 25 jil of
the prediluted antibody was added, followed by 50 I purified T cells (50,000
cells/well) and 25 I CHO-PD-L1 cells (30,000 cells/well). Cells were allowed
to
incubate for 72 hrs at 37 C. Supernatant was then collected and tested fresh
or
stored at -80 C. Levels of cytokines were measured in undiluted culture
supernatants by Luminex Multiplex assay following the manufacturers'
instructions. Results were analyzed by eBioscience analysis software.
For a subset of 16 cytokines, the levels induced by PB17311in the
transactivation
assay were higher than those induced by the benchmark anti-CD137 antibody
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
167
20H4.9 on its own or in combination with the benchmark anti-PD-L1 antibody
YW243.55.S70 (see Figure 30). The subset was composed of GM-CSF, IL-2, IL-13,
IFNy, TNFp, IL-17A, TNFa, IL-18, IL-la, IL-22, IL-4, IL-31, IL-6, IL-5, IL-21
and
IL-9. The greatest increase in cytokine levels induced by PB17311was seen for
GM-CSF, IL-2, IL-13, IL-17A, IFNy, TNF-a, TNF-6, IL-18, IL-22, and IL-4. No
notable antibody-mediated cytokine release was observed for IL-16, IL-1RA, IL-
7,
IL-10, IL-12p70, IL-15, IL-23, or IL-27. No increase in cytokine release was
seen
when cells were incubated with the anti-PD-Li antibody YW243.55.S70 only, or
with the anti-CD137 antibody PF-05082566 only, or with the parental 6797
(CD137) or PD-L1 (7702) bivalent antibodies.
In conclusion, this experiment shows that the bispecific antibody PB17311 has
an
improved T cell activation ability as compared to the benchmark anti-CD137
antibody 20H4.9 on its own or in combination with the benchmark anti-PD-L1
antibody YW243.55.S70.
An important advantage of PB17311 is that this bispecific antibody is more
potent
at activating T cells than a mixture of two benchmark antibodies.
Example 10
SEB assay
To further characterize the three CD137xPD-L1 bispecific antibodies PB17309,
PB17310 and PB17311, their ability to enhance cytokine release by PBMCs in the
presence of staphylococcal enterotoxin B (SEB) was determined. To this end,
purified PBMCs from 3 donors were incubated for 3 days in the presence of SEB
(2000 or 125 ng/ml) and a serial dilution of the three candidate bispecific
antibodies
or control antibodies. The reference control antibody in this experiment was
anti-
CTLA4 antibody 10D1 that has been shown to induce a potent cytokine release in
this assay.
Cytokine levels were measured in culture supernatants by Luminex Multiplex
assay. The results of IL-2 release by PBMCS from three different donors at the
two
different SEB concentrations are shown in Figure 31. This comparison
demonstrates that the activity profiles of all 3 bivalent CD137xPD-L1
antibodies
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
168
were consistent among the three donors. They also show that PB17309 and
PB17311 were the most effective of the bispecific antibodies. All three of
PB17309
(6763x7702), PB17310 (6785x7702) and PB17311 (6797x7702) were more potent
than the positive control antibodies. The results for levels of IL-2, IFNy and
TNFa
released by PBMCs from a single donor (no. 1038) at a SEB concentration of
2000
ng/ml is shown in Figure 32, whereby the cytokine release induced by the
CD137xPD-L1 bispecific antibodies was compared with that induced by benchmark
bivalent antibodies against CD137 (20H4.9) or PD-L1 (YW243.55.S70), either
alone
or in an equimolar mix. This comparison demonstrates that the CD137xPD-L1
bispecific antibodies are clearly more efficient at activating PBMCs than each
of
the benchmark bivalent antibodies. Importantly, each of the CD137xPD-L1
bispecific antibodies was also more efficient at activating PBMCs than a
mixture of
YW243.55.S70 and 20H4.9, again demonstrating the superior T cell activating
characteristics of these bispecific antibodies in the presence of cells
expressing PD-
L1 that can provide activation in trans of the bispecific molecules.
Example 11
Effect of PB17309, PB17310 and PB17311 on M2 macrophage-mediated
suppression of anti-CD3/CD28-stimulated PBMCs
Classically activated macrophages (M1 macrophages) can kill tumors during the
early steps of carcinogenesis. However, during the transition from early
transformation to advanced tumor stages, dynamic changes in the tumor
microenvironment gradually drive the switch from M1 to M2 macrophages. Tumor-
associated M2 macrophages secrete immunosuppressive cytokines and induce
immune suppression by ligation to PD-1. As such, M2 macrophages inhibit T cell
proliferation and cytokine production.
An M2 macrophage suppression assay developed by Aquila Biomedical has been
used to demonstrate that an anti-PD-1 antibody can partially reverse the
inhibitory effect of M2 macrophages on T cell proliferation. We used this
assay to
test the effect of PB17309, PB17310 and PB17311 on the repolarization of M2
macrophages, using IFN-y expression as the read-out, and compared it with the
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
169
effects mediated by a negative isotype control (anti-RSV-G antibody P(I2708)
and
two reference antibodies (anti-CD137 benchmark antibody 20H4.9 and anti-PD-Li
benchmark antibody YW243.55.570).
r
ivi2 suppression assay
Peripheral blood mononuclear cells (PBMCs) were isolated from fresh blood
collected from five healthy volunteers. Magnetic cell sorting was used to
isolate
monocytes by negative selection (without CD16 depletion). A subset of PBMCs
from
each of the 5 donors was also cryopreserved for use later in the assay for
PBMC/M2
co-culture. M2 macrophages were generated by culturing isolated monocytes with
M-CSF (50 ng/mL) in RPMI-10 (RPMI-1640, 10% heat inactivated FBS, 100 U/mL
penicillin, 100 [tg/mL streptomycin and 2mM L-glutamine, 50[tM 6-
mercaptoethanol) for 8 days in 96-well round-bottom plates. During the culture
period, cells were replenished with fresh RPMI-10 supplemented with M-CSF on
day 3 and 6. On day 8, medium was removed, fresh medium (without M-CSF)
added and the cells were activated with LPS (0.1 gg/mL) for 2 hours. The
macrophages were then washed to remove LPS and replenished with fresh media
(without M-CSF). The M2 macrophages were co-cultured with autologous PBMCs
(thawed and washed) at a 4:1 ratio (PBMC:M2) in the presence or absence of
test
antibodies or isotype controls (10 gg/m1), in triplicate. After 24 hours of
cross-talk,
the cultures were stimulated with anti-CD3 (1 ilig/mL) and anti-CD28 (2 g/mL)
for
three days to activate T cells via the TCR receptor complex. IFN-y was then
measured in culture supernatant by ELISA with supernatants diluted 1:10 or
1:20
in the appropriate ELISA diluent to bring values within the detection range of
the
kits. Statistical analyses were made between test substance and appropriate
control groups using either a ratio paired t-test, or one way-ANOVA for
multiple
comparisons with either post-hoc Dunnett's (for comparisons between a control
and
multiple groups) or Holm-Sidak (for comparisons between all groups) multiple
comparisons test. Statistical significance was assumed when P<0.05.
Results
The results are shown in Figure 33, with data presented as the mean levels of
IFN-
y of the triplicates detected by ELISA after anti-CD3/CD28 stimulation of
PBMCs.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
170
It is clear from these results that PBMCs cultured in the absence of M2
macrophages produced higher levels of IFN-y after stimulation with CD3 and
CD28 (compare "PBMC only" with "Unstimulated" condition; * indicates P<0.05).
Despite the heterogeneity of the results obtained for the different donors, it
is
concluded that all three bispecific antibodies increased the production of IFN-
y in
M2:PBMC co-cultures. Although not statistically significant, PB17309 and
PB17310 show a tendency of increased IFN-y production relative to those
treated
with PG2708 isotype control. Importantly, the addition of PB17311
significantly
increased the production of IFN-y in M2:PBMC co-cultures relative to those
treated
with PG2708 isotype control (' indicates P<0.01). The results that are
obtained
with PB17309 and PB17310 are comparable with the results obtained with anti-
CD137 benchmark antibody 20H4.9 and with anti-PD-Li benchmark antibody
YW243.55.570. The results that are obtained with PB17309 and PB17310 are also
comparable with the results obtained with a combination of both reference
antibodies.
Example 12
Effect of PB17311 on naïve human CD8+ T cell priming
CD137 x PD-Li bispecific antibodies according to the present invention induce
activation of T cells by bridging CD137 on the T cell and PD-L1 on accessory
cells.
This is thought to result in CD137 signaling and to enhance antigen-dependent
TCR activation by blocking the PD-1/PD-L1 pathway. In the presence of PD-Li
expressing tumors, CD137 x PD-L1 bispecific antibodies according to the
present
invention facilitate (re)activation of antigen-specific T cells, as shown in
the
current Examples. This is consistent with the fact that it is known that CD137
co-
stimulation allows expansion, cytokine production and survival of T cells
(Bertram
et al 2004). However, we also wanted to demonstrate that CD137 x PD-L1
bispecific antibodies according to the present invention facilitate de novo
effective T
cell responses against tumor neoantigens. Priming of naive CD8+ T cells in
mouse
infection models has shown that CD137 co-stimulation facilitates the formation
of
central memory and effector T cell populations (Zhao et al 2012). We therefore
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
171
assessed the effects mediated by one of our bispecific antibodies (PB17311;
6797 x
7702) on the priming of naïve human CD8+ T cells.
Due to the low numbers of naïve T cell precursor cells antigen-specific
priming of
human T cells is difficult to assess. However, an antigen overexpressed in
melanoma ¨ the tumor-associated antigen Melan-A ¨ has been found to be
particularly suitable for assessing naive T-cell responses in human T cells.
This is
because levels of T cells specific for this HLA-A0201-restricted Melan-A 27-35
peptide epitope are about 10-fold higher than levels of T cells against other
self- or
tumor-associated antigens; the epitope is recognized by about 1 in 1000 naïve
T
cells. Based on this epitope,lfl and Greenberg (2014) have developed an in
uitro
priming system that reliably assesses priming conditions for CD8+ T cells. The
method is known as antigen-specific activation and priming of human CD8 T
or ASAP-T8. In an ASAP-T8 assay, isolated naïve CD8+ T cells are co-cultured
with peptide antigen-loaded autologous monocyte-derived dendritic cells for 10
days, followed by quantitative and qualitative analysis of antigen-specific T
cells.
In this Example the ASAP-T8 assay was performed in accordance with the
detailed
methods described in WWII and Greenberg (2014) using peripheral blood
mononuclear cells (PBMCs) from two independent donors (no. 1064 and 1066). The
antibodies and controls tested in the assay were anti-CD137xPD-L1 antibody
PB17311, anti-CD137 benchmark antibody 20H4.9, anti-PD-L1 benchmark
antibody YW243.55.570, an equimolar mix of both benchmark antibodies and
negative control anti-RSV-G antibody PG2708. Test antibodies were added from
the start of the DC:T cell culture and again during the first feeding.
Generation of monocyte-derived mature dendritic cells (mDCs)
Monocyte-derived mature dendritic cells were generated using a protocol
following
the detailed methods as described in Wolfl and Greenberg (2014). To this end,
four
days before the start of the ASAP-T8 assay, PBMCs from HLA-A2+ donors were
thawed, spun at 300 g for 5 min at RT, and resuspended in culture medium
(CellGro Dendritic Cell Medium (CellGenix, cat. no. 2005) + 1% human serum) to
lx107/ml. 2 ml of this cell suspension was then added to each well of a 6-well
plate.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
172
After an incubation of 2-3 hrs at 37 C to allow adherence to plastic, medium
was
removed and non-adherent cells removed through washing with PBS. 3 ml of warm
culture medium supplemented with 10 ng/ml IL-4 and 1600 IU/ml GM-CSF was
added to each well, followed by incubation for 2 days at 37 C. After further
addition
of L5 ml of fresh culture medium supplemented with IL-4 and GM-CSF, cells were
incubated for an additional 24 hrs.
Immature DCs were then harvested by removal of 3 ml supernatant followed by
vigorous resuspension of cells in remaining medium, and washing with ice-cold
PBS to remove any remaining cells. Cells were pooled and counted and spun at
300
g for 5 min at RT. The pellet was resuspended at lx106 cells/ml in pre-warmed
culture medium, supplemented with GM-CSF (800 IU/ml), IL-4 (10 ng/ml), LPS (10
ng/ml) and IFNy (100 III/m1). 2 ml cell suspension (2x106 cells) was added to
the
wells of a new 6-well plate. Melan-A antigen peptide (JPT, cat. no. SP-MHCI-
0006)
dissolved in DMSO to 5 lig/p1 was added to the appropriate wells at 2.5 lig/m1
and
cells were incubated at 37 C for 16 hrs.
After a check for DC morphology, mDCs were harvested through vigorous
resuspension with a pipette and flushing of empty wells with ice-cold PBS to
ensure removal of all adherent cells. mDC that had been pulsed with peptide
and
those that had not were pooled separately and live cells counted. Tubes with
mDC
were kept on ice at all times and irradiated with 30 Gy (3000 Rad) to prevent
potential proliferation of contaminating cells during subsequent prolonged co-
culture of the cells. Cells were then spun at 300 g for 5 min at RT, and
resuspended
in CellGro DC medium + 5% human serum (HS) at 5x105 cells/ml.
Generation of naive CD8 T cells
One day before the start of the ASAP-T8 assay, PBMCs from the same HLA-A2+
donors as those used to generate mDCs were thawed, spun at 300 g for 5 min at
RT, and resuspended in cold PBS/HS/EDTA buffer (PBS containing 2% HS and 1
mM EDTA at 5x107 cells/ml. Cells were used for naive CD8 T cell isolation
using
the EasySEP Human Naive CD8+ T Cell Isolation Kit (STEMCELL, cat. no.
19258).
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
173
Per ml of cell sample, 50 pl EasySep Isolation Cocktail was added, followed by
mixing and incubation at RT for 10 minutes. EasySep magnetic particles were
then
vortexed for 30 sec and 100 pi particles added per ml of sample to target
unwanted
cells for removal. After incubation at RT for 10 min, the cell suspension was
made
up to a total volume of 2.5 ml by addition of EasySep buffer, and cells were
mixed
by gentle pipetting followed by transfer to a 5 ml Falcon tube. The cap was
removed and the tube placed into the EasySep magnet. After 5 minutes at RT,
the
desired fraction was poured off into a new 5 ml Falcon tube by inverting
magnet
and tube in one continuous motion, leaving magnetically labeled unwanted cells
bound inside the original tube. The magnet and tube were left in an inverted
position for 3 seconds before returning to an upright position, leaving any
drops
that remained hanging from the mouth of the tube. The old tube with unwanted
cells was removed from the magnet and the new tube with the negatively
enriched
cell fraction was placed into the magnet for a second separation. After 5
minutes at
RT, the desired fraction was poured off in the same manner.
The negatively selected enriched cells were counted and then spun at 300 g for
5
min at RT and resuspended at a final cell concentration of 3x10" cells/ml in
CellGro
DC culture medium supplemented with 5% HS, and containing 5 ng/ml IL-7 to
allow for optimal T cell priming. The cells were transferred to 6-well plates
at 2
ml/well and incubated overnight.
ASAP-T8 assay
This assay was performed in triplicate for each donor, following the detailed
methods as described in Wolfl and Greenberg (2014). T cells that had been pre-
incubated with IL-7 were harvested, pooled and counted, then spun at 300 g for
5
min at RT. The pellet was resuspended in culture medium at 2x106 cells/ml and
IL-
21 added at 60 ng/ml to enhance C1I)8+ T cell priming. Two DOT cell mixes were
prepared by mixing peptide-pulsed mDC or non-pulsed DC with T cells at a 1:1
v/v
ratio, resulting in a 4:1 T cell:DC ratio and a final IL-21 concentration of
30 ng/ml.
Test antibodies were added at a final concentration of 10 pg/ml. 500 ill of
each cell
mix was then transferred to individual wells of 48-well plates.
The cells were co-cultured at 37 C for a total of 10 days, which involved two
feeding
steps and a transfer to fresh plates. The cells were first fed after 72 hrs
with an
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
174
additional 500 ill warm culture medium containing 5% HS and 10 ng/ml IL-15 and
ng/ml IL-7 (final concentration of cytokines 5 ng/ml) in the presence or
absence
of 20 pg/ml test antibody (final IgG concentration 10 pg/m1) and incubated for
48
hrs. To allow more room for expansion and reduce the number of residual
(plastic-
5 adherent) myeloid cells from the DC preparation, the cells and medium
were then
transferred to fresh wells in a 24-well plate, to which 1 ml of medium
containing
5% HS and 10 ng/ml IL-15 and IL-7 had already been added. After a further 120-
hr
incubation cells were ready for analysis.
10 On day 10 of co-culture, cells from individual wells were harvested and
counted to
determine absolute cell counts per well. T cells were then stained with a
fluorescently-labeled Melan-A-specific dextramer (Immudex, cat. no. WB2162-
APC). In this dextramer, the dextran polymer backbone carries >10 MHC-peptide
complexes and fluorochrome molecules (allophycocyanin), thereby allowing for
the
detection of Melan-A-peptide-specific C1I)8+ T cells by FACS analysis. The
cells
were also stained with other antibodies against markers on specific T cell
subsets.
To this end, cells derived from individual wells were transferred to wells of
a 96-
well FACS plate at 50,000 cells/well. Cells were spun for 5 min at 300 g, the
supernatant was removed, followed by the addition of 40 ill dextramer (1:50
dilution in PBS + 5% FBS) and incubation in the dark for 20 min at RT.
Additional
antibodies specific for CD8, CD45RA and CCR7 (5x concentrated) were then added
in 10 Id FACS buffer. Cells were incubated in the dark for 20 min at 4 C then
washed twice with FACS buffer. After incubation for 10 min at 4 C, cells were
ready for analysis by FACS.
Results
T cell expansion
The dextramer-positive population represents antigen-specific cells that had
expanded upon priming and constituted 5-24 % of the total CD8 T cell
population.
The relative size of the dextramer-positive, CD8-positive T cell population
and the
absolute cell numbers were used to calculate the number of antigen-specific
CD8+
T cells per well and the data from each donor was expressed as the number of
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
175
antigen-specific CD8+ T cells in culture relative to the sample containing no
antibody (see Figure 34). The data shown is from an experiment performed in
triplicate and error bars represent the standard deviation.
It is clear from these results that the population of dextramer-positive
antigen-
specific CD8+ T cells expanded when peptide antigen was present during priming
(compare "No peptide ctrl" and "No Ab" conditions in Figure 34).
The anti-CD137 reference antibody 20H4.9 enhanced expansion of antigen-
specific
CD8+ T cells relative to the negative control antibody, but only in one donor
(PBMC1064).
Anti-PD-Li reference antibody YW243.55.S70 did not affect expansion.
CD137xPD-L1 antibody PB17311 significantly enhanced expansion of antigen-
specific CD8+ T cells in both donors relative to the negative control
antibody.
PB17311 enhanced expansion of antigen-specific CD8+ T cells to a higher extent
than the anti-CD137 reference antibody 20H4.9. PB17311 had a higher CD8+ T
cell expansion activity as compared to a combination of anti-PD-Li antibody
YW243.55.S70 and anti-CD137 reference antibody 20H4.9. This means that this
CD137 x PD-Li bispecific antibody is more potent in priming naive CD8+ T cells
than the CD137-specific and PD-Li-specific benchmark antibodies.
T cell differentiation
Upon antigen-specific priming, naive T cells start to differentiate. During
this
differentiation process, the expression of CCR7 and CD45RA on the surface of
the
cells is downregulated, with CD45RA being re-expressed on terminally
differentiated effector T cells. Downregulation of CCR7 and CD45RA expression
is
therefore an indication of differentiation. Expression of the differentiation
markers
CCR7 and CD45RA was analyzed by gating on CD8+dextramer+ cells and then
determining the relative numbers of cells within the different T cell subsets.
Subsets were defined as T naive / memory stem cells (TN/Tscm): CD45RA+CCR7+;
central memory T cells (Tem): CD45RA-CCR7+; effector memory T cells (TEm):
CD45RA-CCR7-; and terminally differentiated effector T cells (TTE):
CD45RA+CCR7-. Data from each donor were expressed as the percentage of each T
cell subset within the CD8+dextramer+ T cell population (see Figure 35).
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
176
CD137xP1I)-L1 antibody PB17311 enhanced differentiation of antigen-specific
CD8+ T cells in both donors relative to the negative control antibody. When we
compared T cells that had been primed in the presence of the negative control
antibody and those primed in the presence of antibody, we found that PB17311
reduced the relative numbers of antigen-specific CD8+ T cells with a naive
cell
phenotype (TN/Tscs) and increased the relative numbers of effector memory and
terminally differentiated effector cell populations (TEm and TTE in Figure
35).
PB17311 enhanced differentiation of antigen-specific CD8+ T cells to a higher
extent than reference antibody 20H4.9, as shown by the increase in the
relative
numbers of effector memory and terminally differentiated effector cell
populations
within the PB17311 incubated CD8+ T cell population as compared to the 20H4.9
incubated CD8+ T cell population. PB17311 even enhanced differentiation of
antigen-specific CD8+ T cells to a higher extent as compared to a combination
of
anti-PD-L1 antibody YW243.55.S70 and anti-CD137 reference antibody 20H4.9.
This means that this CD137 x PD-Li bispecific antibody is more potent in
enhancing differentiation of naïve T cells upon priming than the CD137-
specific
and PD-L1-specific benchmark antibodies.
Without being bound to any theory, it is thought that the potent effects of
CD137xPD-L1 antibody PB17311 on CD8+ T cell priming primarily depends on
induction of CD137 signaling in T cells. By binding CD137 expressed on the T
cell
surface after antigen recognition and PD-Li on mature DCs, PB17311 allows thr
C,D137 receptor clustering required for CD137 signaling.
In summary, these results demonstrate that the CD137/PD-L1 bispecific antibody
PB17311 enhances both the expansion and differentiation of naïve CD8+ T cells
in
vitro.
PB17311 has an increased expansion and differentiation potential as compared
to
(a combination of) anti-PD-L1 benchmark antibody Wr243.55.S70 and anti-CD137
benchmark antibody 20H4.9. This demonstrates that PB17311 is more effective in
inducing or enhancing novel T cell responses against existing tumors.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
177
Example 13
Effect of PB17311 on CD107a and cytokine expression by T cells
As demonstrated in Example 10, CD137xPD-L1 bispecific antibodies can enhance
IL-2, TNFa and IFNy production in the supernatant of SEB-activated PBMCs.
Here we used intracellular cytokine staining and FACS analysis to identify the
T
cell subsets that are responsible for the enhanced cytokine production upon
treatment with CD137xPD-L1 bispecifie antibody PB17311. We also assessed
CD107a expression as a marker for CD8+ T cell cytotoxicity. We compared the
effect of PB17311 with that of anti-CD137 benchmark antibody 20H4.9, anti-PD-
Li
benchmark antibody YW243.55.570, an equimolar mix of both reference
antibodies,
and negative control anti-RSV-G antibody PG2708.
To this end, PBMCs were stimulated with SEB (320 ng/ml) in the presence or
absence of antibodies for 24 hrs, and stained for the markers CD3, CD4, CD8,
CCR7, CD45R0 and CD107a, for the cytokines IL-2, IFNy and TNFa, and using a
viability dye. PBMCs cultured in the absence of SEB and antibodies were
included
as a control for SEB stimulation (Unstimulated). The expression of CD107a and
cytokines was analyzed in the total T cell population (CD3+ cells) and in the
following CD4 and CD8 T cell subsets: naïve T cells (CD45RO-CCR7+), central
memory T cells (CD45RO+CCR7+), effector memory T cells (CD45RO+CCR7-) and
terminally differentiated effector T cells (CD45RO-CCR7-). Results are only
shown
for the subsets for which the most pronounced differences were observed: CD4
effector memory (EM) cells, CD8 EM cells and CD8 terminally differentiated
effector (TE) cells.
Methods
List of antibodies used to detect intracellular and extracellular targets in
FACS
analysis.
Target Conjugate Supplier Cat. no.
CCR7 BV605 Biolegend 353224
CD45R0 BV785 Biolegend 304234
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
178
CD3 APC-H7 BD 560176
CD4 PerCP/Cy5.5 BD 560650
CD8 FITC BD 555634
IFNy BV421 BD 562988
IL-2 PE eBioscience 12-7029-42
TNFa Pe-Cy7 Biolegend 502930
CD 107a* AF647 Biolegend 328612
* added to cells during SEB stimulation
Cryopreserved PBMCs derived from a single healthy donor were thawed and left
to
rest overnight. The cells were then counted, centrifuged at 200 g for 12 min
and the
pellet resuspended to a concentration of 2x106 cells/nil in PBMC medium
(RPMI1640, 10% heat inactivated FBS and 1 Penicillin-Streptomycin). 100}il
cell
suspension was added to the wells of two 96-well round-bottom plates to which
100
PBMC medium containing SEB and test antibody had already been added. The
final SEB concentration was 320 ng/ml. Each antibody was tested in triplicate
at a
single concentration of 1 jug/m1 (except for the combination of YW243.55.570
and
20H4.9 which was tested at 0.5+0.5 jug/m1). Control wells without SEB or
antibody
were also included. Stimulation was for 24 hours at 37 C, 5% CO2, 95%
humidity.
Anti-CD107a and a mixture of Brefeldin A (Golgiplug, BD) and Monensin
(Golgistop, BD) were added to each well during the last 12 hours of
incubation.
Duplicate plates were then pooled and PBMCs stained with antibodies specific
for
the relevant markers and cytokines (overview provided in the above list of
antibodies). Since detection of CD3, CD4, and CD8 is not compromised after
fixation, antibodies against these targets were added at the intracellular
staining
step, together with antibodies against the intracellular cytokines. Because of
their
known sensitivity to fixation, the extracellular targets CCR7 and CD45R0 were
stained before the fixation step. To this end, the plates were centrifuged at
350 g
for 3 minutes, cells were resuspended in 100 p1 PBS per well, and cells from
the
duplicate plates pooled. Plates were centrifuged as before and cells
resuspended in
100 pi per well of 1:1000 diluted Fixable Viability Dye (eBioscience, cat. no.
65-
0866). After a 10-min incubation at RT in the dark, 150 .1 of FACS buffer
(PBS pH
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
179
7.4, 0.5% BSA, 0.5mM EDTA) was added to each well. Plates were centrifuged and
cells resuspended in 25 gl of anti-CCR7 antibody diluted in FACS buffer. After
a
15-min incubation at 37 C, 5% CO2, 95% humidity, 25 pi of anti-CD45R0 antibody
diluted in FACS buffer was added. After a 30-min incubation at RT in the dark,
150 I of FACS buffer was added to each well. Plates were centrifuged as
before
and cells resuspended in 200 1 of FACS buffer. Plates were centrifuged and
cells
resuspended in 100 Jul of BD Fixation/Permeabilization solution (BD
Bioseiences,
cat. no. 554714). After a 10-min incubation at RT in the dark, 100 I of BD
Perm/Wash buffer (BD Biosciences, cat. no. 554714) was added. Plates were then
centrifuged at 350 g for 3 min and cells resuspended in 200 1 BD Perm/Wash
buffer.
After this fixation and permeabilization step, plates were centrifuged at 500g
for 3
min and cells resuspended in 50 I of a solution of BD Perm/Wash buffer
containing antibodies specific for intracellular targets. This solution
contained
antibodies against the intracellular targets IFNy, IL-2, and TNFct, and
against
CD3, CD4, and CD8. Plates were incubated for 1 hour at RT in the dark and 150
gl
BD Perm/Wash buffer was then added to each well. Plates were then centrifuged
at
350 g for 3 min and cells resuspended in 200 1 BD Perm/Wash buffer. Plates
were
again centrifuged at 350 g for 3 min, the cells resuspended in 100 gl fixative
solution (PBS pH 7.4, 0.5% BSA, 0.5 mM EDTA, 1% formaldehyde) and stored at
4 C until acquisition the next day.
Samples were measured using a BD Fortessa flow cytometer and the data analyzed
using FlowJo software version 10. Cell populations were analyzed as follows:
singlets were discriminated from doublets by plotting FSC-A versus FSC-H. Dead
cells were excluded by gating on the population negative for viability
staining. T
cells were identified as CD3+ and divided into CD4+ and CD8+ subsets. These T
cell subsets were further divided into naïve, central memory, effector memory,
and
terminally differentiated effector cells, based on the expression of CCR7 and
CD45RO. The expression of cytokines and CD107a was assessed within the total T
cell population and within the subpopulations and expressed as a percentage of
the
total population of T cells.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
180
Results
The intracellular levels of CD107a, IFNy, IL-2 and TNFa in the total T cell
population are shown in Figure 36, with levels expressed by the three
individual
T cell subsets (CD4 TEM, CD8 TEM and CD8 TTE) shown in Figure 37. In these
.. figures, the dotted lines represent the mean percentage of cells positive
for the
indicated marker when stimulated with SEB and negative control antibody
PG2708. The bars represent mean values SD of an experiment performed in
triplicate using cells derived from a single donor. To test for significant
differences,
each condition was compared to the negative control antibody PG2708 (Neg Ctrl
.. Ab) by one-way AN(L)VA, followed by Dunnett's multiple comparisons test. P
values
are indicated with asterisks as follows: * P<0.05, ** P<0.01, *** P<0.001.
Relative to the negative control antibody, PB17311 enhanced CD107a, IL-2 and
IFNy production in the total T cell population (Figure 36). Of note, CD107a
production was more enhanced by PB17311 as compared to anti-CD137 benchmark
antibody 20H4.9, anti-PD-Li benchmark antibody YW243.55.570, and also as
compared to an equimolar mix of both reference antibodies. From this it is
concluded that CD8+ T cell cytotoxicity is more enhanced after incubation with
PB17311 as compared to 20H4.9, YW243.55.570 or a mixture thereof. The
production of IL-2 and IFNy also appears to be higher after incubation with
PB17311 as compared to 20H4.9 and YW243.55.570.
When we looked in more detail at the individual T cell subsets, we found that
PB17311 enhanced expression of all three cytokines in CD4 TEm cells. PB17311
also boosted expression of CD107a in the CD8 TEAT and TTE populations to a
higher
extent than the benchmark antibodies 20H4.9, YW243.55.570 and a mixture
thereof, indicating that it enhances CD8 T cell cytotoxicity better than a
mixture of
these benchmark antibodies.
Conclusion
These results are in line with the earlier observation that CD137xPD-L1
bispecific
antibodies enhance IL-2, TNFa and IFNy production by PBMCs upon SEB
stimulation. They demonstrate that PB17311 causes a significant increase in
the
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
181
numbers of T cells expressing cytokines, and that PB17311 induces expression
of
the cytotoxicity marker CD107a on CD8 TKM and TTE subsets more potently than
the 20H4.9 and YW243.55.S70 benchmark antibodies. Of note, the IFNy and TNFa
production of the CD8 TEm and TTE populations were also higher after
incubation
with PB17311, as compared to the IFNy and TNFa production after incubation
with 20H4.9, YW243.55.570 or a mixture thereof, indicating that PB17311 has a
higher potential of activating CD8+ T cells. The IL-2 production of the CD4
TEM
population also appeared to be higher after incubation with PB17311, as
compared
to incubation with 20H4.9 and to a lesser extent YW243.55.570.
Example 14
Effect of PB17311 on the proliferation of tumor-infiltrating T cells
The initial screening of the anti-CD137xPD-L1 bispecific antibodies made use
of
assays based on primary T cells. However, such assays lack the complexity of
the
cellular interactions that drive the co-evolution of the tumor and its
microenvironment. To test our bispecific antibodies in a tumor-related
setting, we
also made use of recently developed assays based on T cells isolated from
patient
tumor material. Zhou et al. have developed a method of obtaining fresh tumor
material from patients with hepatocellular carcinoma (HCC) or colorectal
cancer
(CRC) and isolating tumor infiltrating cells (myeloid and lymphocytic cells)
to test
the effects of antibodies that target immune checkpoint inhibitors on the
functions
of tumor-infiltrating T cells (Zhou et al., 2017). Here we obtained material
from
patients with HCC or liver metastasis in CRC (LM-CRC) to test whether the anti-
CD137xPD-L1 bispecific antibody PB17311 could reactivate tumor-infiltrating
CD4
and CD8 T cells derived from these patients.
[Methods]
To this end, fresh tumor material was obtained from four patients with LM-CRC,
and from three patients with HCC eligible for surgical resection of the tumor.
None
of the patients received chemotherapy or immunosuppressive treatment at least
three months before surgery. The method as described by Zhou et al. (2017) was
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
182
the following: tumor-infiltrating myeloid and lymphocytic cells were isolated
from
fresh tissue by cutting it into small pieces followed by digestion for 20-30
minutes
at 37 C in 0.5 mg/ml eollagenase IV (Sigma-Aldrich, St. Louis, MC)) and 0.2
mg/ml
DNAse I (Roche, Indianapolis, IN). The resulting cell suspension was filtered
through 100-tim pore cell strainers (BD Biosciences, Erembodegem, Belgium),
and
mononuclear leukocytes were obtained by Fico11 density gradient
centrifugation.
Viability was determined by trypan blue exclusion. The cells were then labeled
with 0.1 1iM of the fluorescent dye carboxyfluorescein diacetate suecinimidyl
ester
(CFSE, Invitrogen) and suspended in RPMI medium supplemented with 10%
human AB serum, 2mM L-glutamine, 50 mM HEPES Buffer, 1% penicillin-
streptomycin, 5mM Sodium Pyruvate and 1% minimum essential medium non-
essential amino acids (MEM NEAA). For HCC 1x105 cells and for LM-CRC 1-2x105
cells in 100 id were then transferred to each well of a 96-well round-bottom
plate.
The tumor-infiltrating lymphocytes (TILs) were then stimulated to induce
.. activation in the absence or presence of test antibody as follows: to wells
containing
TILs derived from HCC patients, 100 id was added of the same medium containing
test antibodies and 1x105 autologous CD40-activated B cell blasts that had
been
expanded and subsequently transfected with mRNA encoding the full-length tumor
antigens glypican-3 (GPC3) or melanoma-associated antigen C2 (MAGEC2). These
cells were co-incubated for six days. To the wells containing TILs derived
from LM-
CRC patients 100 ml of the same medium was added containing test antibodies
and
dynabeads coated with anti-human CD3/CD28 (Gibeo-Life Technologies AS,
Norway) for four days. After incubation, CFSE-labeled cells were harvested and
stained with CD8, CD4, C'D3 antibodies. Dead cells were excluded using 7-
.. Aminoactinomycin D (7AAD; Invitrogen, Paisley UK), and T cell proliferation
was
determined based on CFSE dilution by flow cytometry analysis. Cells were
measured by a FACSCanto II flow cytometer (BD Biosciences, San Diego, USA)
and analyzed using FlowJo software.
CD137xPD-L1 bispecific antibody PB17311 was compared with its monospecific
bivalent parental antibodies PG6797 and PG7702, and with anti-CD137 reference
antibody 20H4.9, anti-PD-Li reference antibody YW243.55.S70, and negative
control antibody PG2708 against the irrelevant RSV-G antigen. Samples without
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
183
antibody were included as controls and all conditions were tested in duplo at
an
IgG concentration of 10 [ig/m1 .
For the samples derived from LM-CRC, CD4 T cell proliferation in the presence
of
antibodies could only be determined in three out of the four donors because
the
fourth donor's baseline level of CD4 T cell proliferation was already
exceptionally
high (>60% proliferating cells). CD8 T cell proliferation could be determined
in
samples from all four LM-CRC donors. Regarding the samples derived from HCC,
autologous B cells expressing GPC3 were generated for all three donors, but
MAGEC2 expression was only possible for two out of three. This resulted in a
total
of 5 proliferation experiments using the cells from the three HCC donors.
Results were presented as the means SEM.
Results
The results are shown in Figure 38. Baseline proliferation of CD4 TILs (upper
right
panel) and CD8 TILs (lower right panel) was determined by measuring the
percentage of proliferating T cells (low levels of CFSE) in the presence of
negative
control antibody. CD4 (upper left) and CD8 (lower left) proliferation of
samples was
calculated as the percentage increase in proliferation over baseline. Values
are
mean SEM (LM-CRC: CD4 n=3, CD8 n=4; HCC: CD4 and CD8 n=5).
CD137xPD-L1 bispecifie antibody PB17311 clearly enhanced the proliferation of
both CD4 and CD8 TILs in both tumor types, and the results indicate that it
outperformed its parental antibodies PG6797 and PG7702. The results also
indicate that YW243.55.S70 stimulated CD4 and CD8 T cell proliferation to the
same level. PB17311 and 20H4.9 also enhanced proliferation of CD4 T cells, but
more potently enhanced CD8 T cell proliferation.
These experiments demonstrate the added value of using a bispecific CD137 x PD-
Li antibody and that PB17311 enhances the proliferation of CD4 and CD8 TILs
derived from patients with HCC and LM-CRC. Importantly, this means that a
bispecifie antibody according to the present invention can restimulate both
antigen-
specific CD4+ T cells and antigen-specific CD8+ T cells of a cancer patient,
and
that it can stimulate proliferation of CD8+ TILs more potently than the
benchmark
antibody YW243.55.S70.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
184
Example 15
PB17311 epitope analysis via alanine-scanning
Epitope analysis was perthrmed to identify the sets of residues that comprise
or are
part of the epitopes recognized by the anti-CD137 Fab arm (MF6797) present in
PB1731I.
Analysis of the potentially non-linear epitope of the CD137 antigen to which
PB17311 binds requires knowledge of the three-dimensional protein structure of
CD137. CD137 is a relatively small protein of 25.4 kDa (17.3 kDa
extracellular)
with no clear distinct domains. However, defined 'repetitive regions' or
cysteine-
rich domains (CRDs) have been described for CD 137. Reports in the literature
concerning the protein structure of CD 137 are limited. Yi et al. (2014) have
described the ligand binding site of CD 137 to be located in region 3 of
CD137,
based on binding studies with truncated expression constructs. While no
crystal
structure is available for CD137, a homology model has been published based on
TNFRI (Won et al., 2010). TNFRI is a membrane-bound protein in the tumor
necrosis factor receptor superfamily of which CD 137 is also a member. The
results
of domain/swap experiments involving human/mouse CD137 chimeric constructs
suggest that the anti-CD 137 Fab arm (MF6797) binds to CRD 1 and/or 2. CD137L
blocking data also suggest that the MF6797 epitope is near to or overlapping
with
the CD137 ligand binding site.
PD-Li is also a relatively small protein of 31.1 kDa (25.2 kDa extracellular),
for
which no distinct regions or domains have been defined. However, the crystal
structure of PD-Li is known, as is that of its complex with PD-Li.
In these experiments, shotgun mutagenesis was used to generate a series of
mutant proteins in which a single residue was mutated through substitution
with
an alanine residue. The mutant CD137 proteins were then expressed in human
cells, allowing for the analysis of complex proteins, or proteins that can
only be
expressed and properly folded in human cells. Functional binding to the
antibody
was measured by fluorescent staining, resulting in binding maps and the
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
185
identification of residues critical for antibody binding. The shotgun
mutagenesis
experiments and analysis were performed by Integral Molecular using methods
described in Davidson and Doranz (2014).
First, based on a plasmid carrying wild-type CD137 cDNA, mutation libraries
(Xxx
to Ala, Ala to Ser) were generated for the target proteins. This resulted in
163
mutant cDNA clones for CD137, all of which were sequenced to verify the
mutation. These mutant cDNA clones were consequently transfected into HEK-
293T cells, along with wild-type (WT) constructs for comparison. HEK-293T
cells
expressing each of the mutant clones were subsequently analyzed by flow
cytometry, whereby binding of each mutant protein to PB17311 was compared with
binding to a control antibody specific for CD137 (mouse IgGl, BD Biosciences
cat.
no. 555955). This control antibody does not compete with PB17311 for binding.
Fluorescently-labeled secondary antibodies against human or mouse IgG were
used
to detect binding of PB17311 or control antibody.
.. To identify clones that had high CD137 expression but gave low binding with
PB17311, we compared PB17311 binding with that of the relevant control
antibody
(see Figure 39A). For each clone, the mean binding value was plotted as a
function
of the clone's mean expression value as measured by control antibody binding.
To
identify preliminary critical clones, we applied thresholds of >70% WT binding
to
control antibody and <20% WT reactivity to PB17311 Ab. Preliminary critical
clones identified using these thresholds are shown as black circles in Figure
39A.
The results indicate that important residues in CD137 for binding of PB17311
are
Arg66, Gly70, and Phe72. Va171 also appears to be involved with binding of
PB17311 (see Figure 39B). While Cys133 was initially identified as a critical
residue based on the binding thresholds, it is relatively distant from the
other
critical residues, and cysteine mutations tend to cause slight aberrations in
protein
conformation due to disruption of disulfide bonds. Cys133 was therefore not
considered part of the PB17311 epitope. The low reactivities with PB17311 of
the
proteins mutated at Arg66, Gly70 and Phe72 indicate that these residues are
the
major energetic contributors to PB17311 binding, with lesser contribution by
Va171.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
186
Example 16
Anti-tumor efficacy of CD137xPD-L1 bispecific antibody in a xenograft
mouse model
To test the anti-tumor efficacy of an exemplary one of the clones, the
CD137xPD-L1
bispecific antibody PB17311, in experimental animals and compare it with
reference antibodies, antibody PB17311 was administered to mice bearing
xenografted tumors. The mouse model chosen is one in which immunocompromised
mice are humanized by engraftment with human peripheral blood mononuclear
cells (PBMCs) before injection with a human cancer cell line. Subcutaneous
solid
tumor growth is then assessed over a period of 3 weeks.
The anti-C11)137 and anti-PD-Li Fabs of the CD137xPD-L1 bispecific antibody
cross-react with human and cynomolgus orthologs, but not with mouse proteins.
The above model was chosen because it allows for the antibody's in vivo
activity to
.. be tested in a humanized system, whereby the antibody's anti-tumor response
is
mediated by human T cells and not mouse T cells. This type of model has been
successfully used to evaluate various immunomodulatory targeted therapies,
including several anti-C11)137 monoclonal antibodies For example, the efficacy
of
20H4.9 has been assessed in PBMC-humanized Rag2-/-IL2Rgnull mice bearing
HT29 cells (Sanmamed et al 2015), Utomilumab efficacy has been assessed in
SCID-beige mice xenografted with a mixture of PBMCs and human tumor cells
PC3, LoVo or WM-266 (Fisher et al., 2012). In both models, the anti-CD137
monoclonal antibodies showed significant T-cell mediated anti-tumor activity
compared to control IgG-treated animals.
In the xenograft mouse model used here, the cancer cells injected into the
PBMC-
humanized mice were RKO cells, a well-established human colon carcinoma cell
line that expresses relatively high levels of P11)-Li but no CD137. The fact
that
PBMCs injected into immunocompromised mice have been shown to express
CD137 as early as 5 days post-implantation and continuing to at least until
day 22
(Sanmamed et al 2015) indicates that PBMC-humanized mice bearing RKO cells
are an ideal model for expressing the targets of the CD137xPD-L1 bispecific
antibody in a "trans" configuration (P11)-L1 on RKO cells and CD137 on T
cells). In
addition, the PBMC donor does not lead to graft versus host disease for at
least 40
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
187
days post-engraftment. This model is therefore robust for evaluating the
efficacy of
immunomodulatory agents.
Methods
Nine-week-old female NOD SCID Gamma (NSG) mice were engrafted with 3 x 107
human PBMCs by tail-vein injection. 7 days later, each test mouse received a
subcutaneous injection of 5 x 106 RK0 tumor cells in 0.1 mL 50% Matrigel in
the
right flank. Tumor growth was monitored by calipers as mean tumor volume
approached the target range of 50 to 80 mm3. Four days after tumor cell
implantation, designated as Day 1 of the study, animals with individual tumor
volumes from 40 to 63 mm3 were sorted into four groups of eight animals.
Tumor-bearing animals in each group received six intraperitoneal injections of
antibody at a dose of 100 mg in 100 pL PBS on days 1, 4, 8, 11, 15 and 18. The
four
different groups received negative control (IgG), or benchmark antibody 20H4.9
(anti-CD137) or YW243.55.570 (anti-PD-L1), or PB17311 (anti-CD137xPD-L1).
Calipers were used to measure tumor volumes three times a week until the end
of
the study on Day 19, when inhibition of tumor growth was assessed.
Tumor growth inhibition (TGI) was defined as the percent difference between
Day
19 median tumor volumes (MTVs) of treated and control mice, with differences
between groups deemed statistically significant at P < 0.05 using the Mann-
Whitney test. Treatment tolerability was assessed by body weight measurements
and frequent observations for clinical signs of treatment-related adverse
events.
Figure 40 provides a box and whisker plot of tumor volume distribution by
group.
On Day 19, the median tumor volumes (MTVs) of the mice in IgG control was 517
mm3, with an individual tumor volume range of 429 to 807 mm3. Among the three
treatment groups, PB17311 was as effective (with an MTV of 264 mm3, 49% TGI),
as YW243.55.S70, with an MTV of 283 mm3, 45% TGI and 20H4.9, with an MTV of
339 mm3 and 34% TGI). All treatments resulted in MTVs significantly lower than
those in the control Group (P < 0.05 for 20H4.9; P <0.001 for PB17311 and
YW243.55.570). One animal receiving 20H4.9 died on Day 8; necropsy revealed
pink lungs and a mottled liver. Animals in this group also experienced the
largest
mean BW loss (-8.0% at the lowest point on Day 15). Otherwise, treatments were
well-tolerated.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
188
In summary, the CD137xP1I)-L1 bispecific antibody PB17311 provided a
statistically significant survival benefit as treatment for human RK0 colon
carcinoma in NSG mice engrafted with human PBMCs. Treatment results with
PB17311 were better, with less side effects, as compared to 20H4.9.
Example 17
Interference of sCD137 with agonistic activity of CD137 targeting antibodies
Soluble CD137 interferes less with agonistic activity of bispecific
CD137xPD-L1 antibody than with bivalent CD137 antibody
CD137 expression is regulated by antigen shedding from the cell surface. The
shed
antigen (sCD137) is found in the blood as well as in the extra-cellular space
and
could therefore act as a competing sink for clearance of CD137 targeting
antibodies.
Studies have shown that sCD137 is shed from immune cells expressing high
levels
of CD137, such as regulatory T cells (Ridgway et al., 2014), and that both
sCD137
and sCD137L are produced by cancer cells of colorectal patients (Dimberg et
al.,
2006). In addition, exposure of tumor cell lines to hypoxic conditions
promotes
CD137 expression, the most predominant form being the soluble variant (Labiano
et al, 2016). While average serum levels of sCD137 in healthy donors range
from
0.02 to 0.2 ng/ml, levels are known to be higher in various disease states,
ranging
from 0.2 to 3.6 ng/ml (Michel et al, 1998; Shao et al, 2012). sCD137 appears
to
regulate activated T cells: when shed into the tumor microenvironment it
dampens
the activity of the immune system, thereby mediating immune escape. It is
thought
that sCD137 competes with membrane-bound CD137 for binding to CD137L,
thereby blocking signaling through CD137 expressed on T cells.
Given the mechanisms described above, it was determined whether sCD137 would
affect the ability of bispecific CD137xP1I)-L1 antibody PB17311 and reference
antibodies to activate human primary T cells in vitro. Such activation was
measured in a Jurkat reporter/CHO-PD-L1 trans-activation assay in the absence
or presence of excess amounts of sCD137. In this assay, the Jurkat reporter T
cell
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
189
line expresses CD137 and the reporter gene is activated by antibodies specific
for
CD137. The T cells are co-cultured with CHO cells overexpressing PD-L1, which
mimic tumor cells expressing PD-L1 and are required for activation of the T
cells
by the bispecific CD137xPD-L1 antibody.
To this end, flat-bottomed 96-well plates (Costar, cat. no. 3917) were coated
overnight with 21.tg/mL anti-CD3 antibody OKT-3 (eBioscience, cat.no. 16-0037-
85)
in PBS. The next day, Jurkat CD137-NFkBlue reporter cells were thawed and
washed with DMEM/F12 medium containing 10% heat inactivated fetal bovine
serum (assay medium). Cells were resuspended at a density of 2x106 cells/ml.
The
pre-coated 96 well plates were washed twice with PBS before addition of 25 !AL
test
antibody (end concentration 200 ng/mL), followed by 25 t1_, of a mix of sCD137
(R&D, cat. no. 9220-4B) in a five-step, three-fold dilution starting at 20
!,ig/mL (end
concentration). Then 25 !AL Jurkat NFKBlue (50000 cells/well, 2x106 cells/ml)
were
added, followed by 25 IAL CHO-K1/CHO.huPD-L1 cells (12500 cells/well, 5x105
cells/m1). The next day, plates were equilibrated to room temperature and
100g1
Bright-Glo/well (room temperature) was added (maximum 4 plates at a time)
followed by 5 minutes incubation at room temperature. Plates were measured on
the Biotek Synergy 2 Multi-Mode Mieroplate Reader (luminescence mode).
Activation in terms of luciferase activity was expressed as a percentage of
that
obtained without addition of recombinant protein.
The results are shown in Figure 41 and indicate that high concentrations of
soluble
CD137 can indeed interfere with the agonistic activity of both test
antibodies.
However, importantly, sCD137 competition appears to have a much greater effect
on the anti-CD137 reference antibody (clone 20H4.9) than on the bispecific
CD137xPD-L1 antibody PB17311. From this it is concluded that the in uluo
effect
of PB17311 will be less sensitive to immune suppressive mechanisms as compared
to benchmark antibody 20H4.9
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
190
Tables
Table 1: Expression constructs for each target that were used for DNA
immunization (pVAX1 vector based) and for generation of stable Freestyle 293F
or
CHO-Kl cell lines (pIRES-neo3 vector based or similar)
Target Vectors Stable cell line
CD137 pVAX1_huCD137 NA
pVAX1_raCD137 NA
pIRES-neo3_huCD137 Freestyle 293F_huCD137
pIRES-neo3_maCD 137 Freestyle 293F_maCD137
0X40 pVAX1_hu0X40 NA
pVAX1_ra0X40 NA
pVAX1_ma0X40 NA
pIRES-neo3_hu0X40 Freestyle 293F_hu0X40
pIRES-neo3_ma0X40 Freestyle 293F_ma0X40
PD-Li pVAXl_huPD-L1 NA
pIRES-neo3_huPD-L1 CHO-Kl_huPD-L1
pIRES-neo3_maPD-L1 CHO-Kl_maPD-L1
hu = human, ma = macaque, NA = not applicable
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
191
Table 2.
Panel of CD137 Fab arms describing binning based on FAGS profiles, domain
binding, agonistic activity as bivalent antibody and CD137 blocking activity.
Agonistic ----------------------------------------------------
MF no. Bin Domain bivalent % CD137L block Denotation
MF6783 A 1/2 X 44 Partially blocking
MF6860 A 1/2 X 6 Non-blocking
MF6848 B 1/2 -126 Enhancing ..
MF6856 B 2 24 Non-blocking
MF6861 B 1/2 50 Partially blocking
MF6847 C 4 24 Non-blocking ..
MF6795 D ND 32 Partially blocking
M F6808 D ND 77 Blocking ...
MF6798 E 1 44 Partially blocking
M F6805 E 1 2 Non-blocking
MF6832 E 1 X 8 Non-blocking ..
MF6754 F 2 101 Blocking
MF6763 F 2 101 Blocking
MF6744 G 2/3 X 67 Partially blocking
MF6785 G 2 99 Blocking
MF6825 G 2 X 89 Blocking
MF6737 H 3 X 76 Blocking
MF6749 H 3 X 81 Blocking
MF6870 I 4 -16 Non-blocking
MF6862 J ND X -80 Enhancing
MF6875 J 1 -22 Non-blocking
MF6788 K 1 X 55 Partially blocking
MF6797 K 1/2 102 Blocking
r MF6873 K 1/2 -100 Enhancing
o
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
192
Table 3.
Functional activity of PD-Li Fab arms as measured in the PD-1 /PD-L1 blockade
reporter assay as a monovalent antibody expressed in AUC. Antibody affinities
were determined by Biacore analysis. MF5361 is a non-blocking Fab, therefore
AUC was not applicable (NA)
ID AUC Affinity nM
MF5594 4.8 0.6
MF5553 4.5 ND
MF5424 3.6 4.6
MF5561 3.6 4.1
MF5426 3.4 2.5
MF5439 3.2 5.5
MF5442 3.1 6.0
MF5361 NA 19.4
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
193
Table 4.
Functional activity (IC50 IL-2 release in SEB assay) of lead CD137xPD-L1 panel
(indicated using the PB prefix; each PB comprises a CD137 and a PD-L1 Fab arm
as indicated in the table) compared to ipilumumab. Based on binding profiles
using
chimeric constructs CD137 could be distributed over different domain bins.
ID CD137 Fab arm PD-L1 Fab arm CD137 domain AUC IC50 (ng/ml)
PB14593 6797 5594 1/2 4.8 14.75
PB14591 6785 5594 2 4.8 15.44
PB14584 6754 5594 2 4.8 15.76
PB15184 6754 5424 2 3.6 22.82
PB15142 6754 5426 2 3.4 34.06
PB17101 6754 5553 2 4.5 56.24
PB17089 6754 5442 2 3.1 74.35
PB17095 6797 5442 1/2 3.1 89.42
PB17103 6785 5553 2 4.5 92.27
PB14814 6754 5561 2 3.6 167.4
PB15149 6785 5426 2 3.4 188.1
PB14815 6763 5561 2 3.6 195.6
PB14585 6763 5594 2 4.8 198
PB14821 6785 5561 2 3.6 202.2
PB15151 6797 5426 1/2 3.4 219.3
PB15191 6785 5424 2 3.6 284.2
PB15143 6763 5426 2 3.4 331.1
PB15185 6763 5424 2 3.6 363
PB14823 6797 5561 1/2 3.6 367.9
PB17091 6785 5442 2 3.1 428.2
PB17088 6763 5442 2 3.1 545.9
PB17115 6785 5439 2 3.2 664.3
PB17107 6797 5553 1/2 4.5 852.6
PB17119 6797 5439 1/2 3.2 1030
PB17112 6763 5439 2 3.2 1043
PB17100 6763 5553 2 4.5 1382
PB15193 6797 5424 1/2 3.6 1556
PB17113 6754 5439 2 3.2 8145
1pilumumab 9388
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
194
Table 5 Ligand blocking ability and domain specificity of the 0X40 clones.
Blocking
ability was determined in two separate experiments. NA = not analyzed; ND =
not
determined (domain specificity could not be determined because of binding to
both
rat and human 0X40.
MF nr CDR3 VH Blocking Blocking 0X401 Domain
.
germline Exp.1 (%) Exp.2 (%) blocking spec.
MF6629 GWDF VHS-51 -1 NA no NA
MF6630 GGTMVRGVIDDWFDP VH1-46 4 NA no 1/2
MF6637 VGGLRQAWYFDL VH1-69 9 NA no NA
MF6643 GGWELLFNYFQQ VH7-4-1 11 NA no 3
MF6645 SPPYYMDV VH4-59 20 NA no 3
MF6646 GFDWYFTL VH3-15 47 62 yes 3
MF6648 GWGYSGYGPEGFDI VH3-15 22 NA no 2
MF6655 IGGTGTTDWYFDL VH1-69 NA 10 no 1/2
MF6658 VGGYTSSSWFFDL VH1-69 9 NA no 1/2
MF6660 VDGGNSDWYFDL VH1-69 14 NA no NA
MF6675 VDGRSSGGNWHFDL VH1-69 5 NA no 1/2
MF6686 DPYYFDSNGYPPFDD VH1-69 NA 97 yes NA
MF6690 GWDFFDS VH7-4-1 7 NA no NA
MF6692 VGGLGTTPHWYFDL VH1-69 NA 16 no 1/2
MF6700 PSYNWNRLYYYYMDV VH1-69 7 NA no 3
MF6706 SQPNLDFWSGYHFDY VH2-5 99 97 yes NA
MF6714 DPFFYDRSGYPPFDY VH1-69 36 57 yes 2
MF6721 GWGSG VH3-15 NA 9 no 4
MF6722 VGGYGNNYNFDY VH1-69 24 NA no NA
MF6724 DPSGSYFYHYYMDV VH3-15 75 92 yes 2
MF6728 RRPNYDSWSGYYEDY VH2-5 97 101 yes 3
MF6729 GGWGLLREYFLQ VH7-4-1 66 74 yes NA
MF6826 HTGHYSGFDY VH3-30 1 NA no NA
MF6940 VDGTGISNWYFDL VH1-69 78 93 yes 2
MF6942 GYSSIWHGENFQY VH7-4-1 28 48 yes 3/4
MF6943 DMDNWNYEGYYVMDV VH7-4-1 90 87 yes 2
MF6944 VEGWGSQWYFDL VH1-69 18 NA no 1/2
MF6947 VEGTDSNWGWDF VH1-69 22 41 no/yes 1/2
MF6949 DDGTGTGDYVWGRYRYTLDF VH7-4-1 NA 90 yes 3
MF7331 DGYKLYAADGFDY VH1-18 NA 18 no 1
MF7332 DMDSYPFYRGFDY VH1-18 NA 3 no ND
MF7334 DDNTMWYSRPYAFDY VH3-30 4 NA no 1/2
MF7341 DSPYWSLPGGFDY VH1-18 15 NA no 1/2
MF7345 DQRWWYMDPGAGFDY VH3-30 5 NA no 1/2
MF7350 DYSYSGTGSSSAFDY VH1-18 -8 NA no 2/3
MF7351 DYLHGSYYRGSAFDY VH3-30 NA 11 no 2/3
MF7352 DSWHGQYYYGKGFDY VH3-30 NA 34 yes 2/3
MF7353 DGLGWDPGYGFDY VH3-30 19 NA no 2
MF7356 DNYQGMYYFGTGFDY VH3-30 3 NA no 2/3
MF7358 DNHYYSPPTYWGFDY VH3-30 2 NA no 1/2
MF7365 GGQSQYHSYPFGFDY VH3-23 NA 46 yes 2
MF7366 DWWQGHWYRSGGFDY VH3-30 NA 35 yes 2/3
MF7371 GQMDYYDDWYSAFDY VH3-30 NA 1 no 1
MF7372 DYYQGSHYFGPAFDY VH3-30 NA -4 no 2/3
MF7374 GDDNRMYSNPKGFDY VH3-30 21 NA no 2
MF7378 DNTQGNYYRSRGFDY VH3-30 2 NA no 2/3
MF7382 DGLQGSNYHLGGFDY VH3-30 NA 5 no 2/3
MF7383 GYDMYGGWGAWGFDY VH3-23 -6 NA no 2
MF7394 DYPAWAYSAFDY VH1-18 NA 67 yes 2
MF7395 DYWYYLSDAFDY VH3-30 NA 8 no 2
MF7397 DHWGSFYGDFDY VH3-23 NA 0 no 2
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
195
Table 6
MF ID 100nM Ab KD (nM)
kon koff KD
MF6797 2.49E+05 7.76E-04 3.11E-09 3.0 +/- 0.3nM
MF6754 1.45E+06 0.001856 1.28E-09 2.1 +1- 1.1nM
MF6763 3.54E+05 0.001033 2.92E-09 5.5 +/- 2.3nM
MF6749 8.26E+05 0.002419 2.93E-09 2.7 +/- 1.1nM
MF6737 1.56E+06 0.008839 5.68E-09 3.7 +/- 1.8nM
MF6805 3.41E+05 6.29E-04 1.84E-09 2.2 +/- 0.5 nM
MF6785 3.48E+06 0.01575 4.52E-09 4.0 +/- 0.9nM
MF6808 2.51E+05 3.98E-04 1.59E-09 1.4 +/-0.5nM
MF6744 ND
MF6788 ND
MF6825 ND
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
196
Table 7. Activity of CD137xPD-L1 bispecific antibodies composed of 24 CD137
Fabs and 2 PD-Li Fabs
p,gonistie Reporter T
cell
ME no. #1 (083 VH germline Bin Domain bivalent %
CD1371 block PD-1.1 NB PD-Li B PD-1.1 NB PD-L1 B
M F6783 . DVVGV1GG HYM DV VH7-4-1 A 1/2 X 44 +
++ + 4-
MF6862 GLLWGKTOWSGFDY. VHS-51 A 1/2 X 6 +/-=
+
MF68.61 :DSDGYGPKAFDY V11-13 B in 50 _
ND ND
mF6850: ovvcsys,DYGSS4PDY VH3-23 B 1/2 24. - -.
ND ND
M.F.6648. DWSGVVGSAYAFEW v1.11-i4 a .1./2 -us
. - Ntl ND
M F6847 D5GYDSAYLAFDY VH148 C .4. 24 .- .
ND NO =
MF6808 , GATYYYGSGTD/51NWFDP VH1-69 b ND 77 +
M F6795 ENIGIVGATGAFDV VH5.-51 D ND = 52
- ND ND
MFE7.98. 1316/A.S.VM µIRciOLDY. VH744 6 1 44.
+/- +/- ND ND
M F6832 6WHA FIAT DY VH3'23 1 i x 8 +1_
4. -
woos. TosyGyvvy .vH7-44 .1 1. z +1- + +
4
MF6754. EG FDNYG SU I RG NWFDP VH1-24 F 2. 101.
+ ++ .++ =*++
M F6763: EGVGV1RGNWFDP. VH1-24 F 2 .101 +
++. ++ +++
M.F6185 DLRL.GASYYYSYMDV Vel1,24 6 2/3 99:
.+ 4+ +. ++
ME6825 TLVVG5DDVFDV VHM p 2. .X. 89 * 4 *
4
N1F6.744 LGGYSGYAEDEVDF VHS-61 G 2 X 67 + 4-t-
.4. +4
N1F6749 'HA6FlITSQNIDDY VH5-51 H 3. X 81 + ++
+ +++
MF6737 HQPYSFSG5 HIDDY VH5-51 H 3 X 76 + ++
+ ++
M F6870 :GSGHRFYQYRSGFOY V+13-23 I .4 -16
- ND ND
M F587.5 GRWWFTYDGFDY VH3,23 1 ND -22 +/-
+'
MF6862: GRGW RNYFQWWPFDY Vt18730 2 NO .X. -80
ilk = .4.=
M.F87.97. 66116 FLGGNWPDP VH2i.5 K .1/2 102. +
;1+ + 4
rviF6788 DWG1VAIGYFDY V.f17-4-1. K 1/2 X 55. + ++
+ ++
M F6873: .DRW5VOQ6RGEGFDY VH148 K 1/2 -100 .-
ND ND
KV, unique ID Fab; CDR3, sequence of CDR3; WI germline, derived VI-I; Bin,
specific grouping into bin (P1306-S33); Domain, CD137 domain to which antibody
was mapped using mouse human swapped-domain constructs (1 or 2 means that
the antibody could not be clearly mapped to one of the two domains); Agonistic
bivalent, capacity of bivalent antibody to activate Jurkat-NFKB-luc-CD137; %
CD137L block, capacity of Fab arm to block interaction with CD137; Reporter,
data from reporter assay; T cell, data from T cell assay; PD-Li NB, CD137 Fab
in
combination with PD-L1 non blocking Fab arm; PD-L1 B, CD137 Fab in
combination with PD-L1 blocking Fab arm.
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
197
References
Akbay, E. A., Koyama, S., Carretero, J., Altabef, A., Tchaicha, J. H.,
Christensen,
C. L., Mikse, 0. R., Cherniack, A. D., Beauchamp, E. M., Pugh, T. J., et al.
(2013).
Activation of the PD-1 Pathway Contributes to Immune Escape in EGFR-Driven
Lung Tumors. Cancer Discov 3, 1355-1363
Arch, R. H., & Thompson, C. B. (1998). 4-1BB and 0x40 are members of a tumor
necrosis factor (TNF)-nerve growth factor receptor subfamily that bind TNF
receptor-associated factors and activate nuclear factor kappaB. Mol Cell Biol,
18(1),
558-65. littp:llei.oi..or gi 10. 10 1 b an.2015.03.022
Bernstein, M. B., Garnett, C. T., Zhang, H., Velcich, A., Wattenberg, M. M.,
Gameiro, S. R., Kalnicki, S., Hodge, J. W., and Guha, C. (2014). Radiation-
induced
modulation of costimulatory and coinhibitory T-cell signaling molecules on
human
prostate carcinoma cells promotes productive antitumor immune interactions.
Cancer Biother Radiopharm 29, 153-161
Bertram et al. Role of T cell costimulation in anti-viral immunity. Seminars
in
Immunology, 16(3), 2004
Boland, J. M., Kwon, E. D., Harrington, S. M., Wampfler, J. A., Tang, H.,
Yang, P.,
and Aubry, M. C. (2013). Tumor B7-H1 and B7-H3 expression in squamous cell
carcinoma of the lung. Clin Lung Cancer 14, 157-163.
Compaan, D.M., Hymowitz, S.G. (2006). The crystal structure of the
costimulatory
0X40-0X4OL complex. Structure 14, 1321-1330.
Davidson, E. and Doranz, B.J. (2014) A high-throughput shotgun mutagenesis
approach to mapping B-cell antibody epitope. Immunology 143, 13-20.
Dong, H., Strome, S. E., Salomao, D. R., Tamura, H., Hirano, F., Flies, D. B.,
Roche, P. C., Lu, J., Zhu, G., Tamada, K., et al. (2002). Tumor-associated B7-
H1
CA 03038020 2019-03-22
WO 2018/056821
PCT/NL2017/050634
198
promotes T-cell apoptosis: a potential mechanism of immune evasion. Nat Med 8,
793-800.
Makkouk A, Chester C, Kohrt H. Rationale for anti-CD137 cancer immunotherapy.
Eur J of Cancer 54(2016): 112-119
McNamara J, Kolonias D, Pastor F, Mittler R, Chen L, Giangrande P, Sullenger
B,
Gilboa E. Multivalent 4-1 BB binding aptamers costimulate CD8+ T cells and
inhibit tumor growth in mice.
Melero I, Hirschhorn-Cymerman D, Morales-Kastresana A, Sanmamed MF,
Wolchok JD. Agonist antibodies to TNFR molecules that costimulate T and NK
cells. Clin Cancer Res 2013.
Michel, J., et al., A soluble form of CD137 (ILA/4-1BB), a member of the TNT'
receptor family, is released by activated lymphocytes and is detectable in
sera of
patients with rheumatoid arthritis. European Journal of Immunology, 1998.
28(1):
p. 290-295.
Fisher et al. Targeting of 4-1BB by monoclonal antibody PF-05082566 enhances T-
cell function and promotes anti-tumor activity. Cancer Immunology
Immunotherapy, 61, 2012.
Pollok, K. E., Kim, Y. J., Zhou, Z., Hurtado, J., Kim, K. K., Pickard, R. T.,
& Kwon,
B. S. (1993). Inducible T cell antigen 4-1BB. Analysis of expression and
function.
Journal of Immunology (Baltimore, Md. : 1950), 150(3), 771-81. Retrieved from
.nc bi JSOVII5 ubm.e da678621
Pulko V, Harris KJ, Liu X, Gibbons RM, Harrington S1\/I, Krco CJ, Kwon ED,
Dong
H J. B7-H1 expressed by activated CD8 T cells is essential for their survival.
Immunol. 2011.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
199
Sanmamed et al. Nivolumab and 20H4.9 enhance antitumor activity of human T
lymphocytes engrafted in Rag2-/-IL2 Ryna immunodeficient mice. Cancer
Research,
75(17), 2015.
Schwarz H. Biological activities of reverse signal transduction through
C1i)137
ligand. J Leukoe Biol 77 (2005): 281-286
Shao, Z., et al., Admission levels of soluble CD137 are increased in patients
with
acute pancreatitis and are associated with subsequent complications.
Experimental and Molecular Pathology, 2012. 92(1): p. 1-6.
Shao, Z., & Schwarz, H. (2011). CD137 ligand, a member of the tumor necrosis
factor family, regulates immune responses via reverse signal transduction.
Journal
of Leukocyte Biology, 89(1), 21-29. http://doi.org/10.1.189/j1h.05.10315
Sharma, P., Hu-Lieskovan, S., Wargo, J. A., and Ribas, A. (2017). Primary,
Adaptive, and Acquired Resistance to Cancer Immunotherapy. Cell 168, 707-723.
Simon, H. U. (2001). Evidence for a pro-apoptotic function of CD137 in
granulocytes. Swiss Medical Weekly, 131(31-32), 455-458.
bttp://doi.org/2001/al/smw-096GS
Sznol, M., and Chen, L. (2013). Antagonist antibodies to PD-1 and B7-1d1 (PD-
L1)
in the treatment of advanced human cancer. Clin Cancer Res 19, 1021-1034.
Thompson, R. H., Gillett, M. D., Cheville, J. C., Lohse, C. M., Doug, H.,
Webster,
W. S., Chen, L., Zincke, H., Blute, M. L., Leibovich, B. C., and Kwon, E. D.
(2005).
Costimulatory molecule B7-H1 in primary and metastatic clear cell renal cell
carcinoma. Cancer 104, 2084-2091.
Tumeh, P. C., Harview, C. L., Yearley, J. H., Shintaku, I. P., Taylor, E. J.
M.,
Robert, L., Chmielowski, B., Spasic, M., Henry, G., Ciobanu, V., et al.
(2014). P1)-1
blockade induces responses by inhibiting adaptive immune resistance. Nature
515,
568-571.
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
200
Velcheti, V., Schalper, K. A., Carvajal, D. E., Anagnostou, V. K., Syrigos, K.
N.,
Sznol, M., Herbst, R. S., Gettinger, S. N., Chen, L., and Rimm, D. L. (2014).
Programmed death ligand-1 expression in non-small cell lung cancer. Lab Invest
94, 107-116.
Vinay, D. S., & Kwon, B. S. (2011). 4-1BB signaling beyond T cells. Cellular &
Molecular Immunology, 8(4), 281-4. http://doi.org/10.1038/cmi.2010.82
Wolf B., Morgan H., Krieg J., et al. A whole blood in vitro cytokine release
assay
with aqueous monoclonal antibody presentation for the prediction of
therapeutic
protein induced cytokine release syndrome in humans. Cytokine 60:828-831,
2012.
Wolfl and Greenberg. Antigen-specific activation and cytokine-facilitated
expansion
of naive, human CD8+ T cells. Nature protocols 9(4), 2014
Won, E. Y., Cha, K., Byun, J. S., Kim, D. U., Shin, S., Ahn, B., ... Cho, H.
S. (2010).
The structure of the trimer of human 4-1BB ligand is unique among members of
the tumor necrosis factor superfamily. Journal of Biological Chemistry,
285(12),
9202-9210. littp s 0,:1074/jb c.M109.084442
Yi, L., Zhao, Y., Wang, X., Dai, M., Hellstrom, K. E., Hellstrom, I., & Zhang,
H.
(2014). Human and mouse CD137 have predominantly different binding CRDs to
their respective ligands. PLoS ONE, 9(1).
.https://doi..org110.1371.1jgurnal.pone.0086.337
Zhang, F., Wei, H., Wang, X., Bai, Y., Wang, P., Wu, J., Jiang, X., Wang, Y.,
Cai,
H., Xu, T., Zhou, A. (2017). Structural basis of a novel PD-Li nanobody for
immune
checkpoint blockade. Cell Discovery 3, 17004.
Zhao et al. Targeting 4-1BB (CD137) to enhance CD8 T cell responses with
pox-viruses and viral antigens. Frontiers in Immunology 3, 2012
CA 03038020 2019-03-22
WO 2018/056821 PCT/NL2017/050634
201
Zhou et al. Antibodies Against Immune Checkpoint Molecules Restore Functions
of
Tumor-infiltrating T cells in Hepatocellular Carcinomas. Gastroenterology 2017
doi: 10.1053/ j.gastro.2017.06.017.
