Note: Descriptions are shown in the official language in which they were submitted.
CA 03143242 2021-12-10
[DESCRIPTION]
[TITLE OF INVENTION]
BISPECIFIC ANTIBODY TO A-SYN/IGF1R AND USE THEREOF
[TECHNICAL FIELD]
The present invention relates to a bispecific antibody against alpha-synuclein
and IGF1R,
a pharmaceutical composition for prevention and/or treatment of
synucleinopathies (a-
synucleinopathies) including the bispecific antibody, and a method of
detecting alpha-synuclein
aggregates or providing information for diagnosing alpha-synucleinopathies
including the
bispecific antibody.
[RELATED ART]
Alpha-synuclein (a-Synuclein, a-syn) is expressed primarily in the presynaptic
terminals
of neurons, and is a naturally unfolded monomer in normal conditions. Alpha-
synuclein helps to
regulate the release of dopamine that is a kind of important neurotransmitter
controlling initiation
and stop of voluntary or involuntary movements. Particularly, the function of
alpha-synuclein is
important with increased synaptic activity and aging, and is an important
factor of
neuro deg enerati on.
However, in the pathological state, alpha-synuclein undergoes structural
changes
through binding and interaction with droplets, phospholipid bilayers, or lipid
membranes to form
a folded or folded cc-helical secondary structure. Such a secondary structure
forms aggregate
comprise molecules in the form of dimers, oligomers and/or fibers.
1
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
These alpha-synuclein aggregates have been known to induce toxicity to cells,
and are
the major component of an abnormal protein aggregate of Lewy bodies that are
found in neurons
of Parkinson's disease (PD), Parkinson's disease dementia (PDD), multiple
system atrophy
(MSA), Dementia with Lewy bodies (DLB), and various diseases. It is also known
that post-
translational modifications of alpha-synuclein, such as phosphorylation, or
ubiquitination, are
also associated with aggregation and neurotoxicity of alpha-synuclein. Alpha-
synuclein has been
known to kill dopamine neurons and cause inflammatory reactions in animal
experiments and
cell experiments, and to cause motor symptoms similar to Parkinson's disease
in experimental
animals . In addition, alpha-synuclein aggregation has been known to be
related to an etiology of
a group of neurodegenerative diseases called u-synucleinopathies, including
Parkinson's disease,
Parkinson's disease dementia, Lewy body dementia, multiple system atrophy and
many other
neuro-axonal diseases.
Antibodies to alpha-synuclein or fragments of alpha-synuclein to induce such
antibodies
have been proposed as methods of immunotherapy against synuclein disease.
However, brain
penetration of antibodies may be limited by the blood brain barrier (BBB).
In addition, the deficiency of highly-specific BBB carriers has delayed the
development
of new therapeutics and diagnostics for diseases originating in the brain,
including brain tumors
and neurodegenerative diseases. There is clearly a need for a method for
delivering therapeutic
and diagnostic molecules at a pharmaceutically effective dose to the brain
without disrupting the
physiology and homeostasis of BBB.
[DETAILED DESCRIPTION]
2
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
[TECHNICAL PROBLEM]
An embodiment of the present invention provides an antibody comprising an
antigen-
binding region against alpha-synuclein (a-Syn) and an antigen-binding region
against IGF1R, or
a method for preparing the antibody.
Another embodiment provides a polynucleotide encoding the antibody, a
recombinant
vector comprising the same, and a recombinant cell comprising the same.
Further embodiment provides a pharmaceutical composition for prevention and/or
treatment of alpha-synucleinopathies, comprising the bispecific antibody
against a-Syn and
IGF1R and a pharmaceutically acceptable excipient.
Provided is a method for delivering drugs used for diagnosis, treatment or
prevention of
alpha-synucleinopathies to brain, using the antibody or antigen-binding
fragment of the present
invention.
An embodiment of the present invention provides an antibody against IGF1R
(Insulin-
like Growth Factor 1 Receptor) or an antigen-binding fragment thereof, which
can specifically
recognize IGF1R without affecting the binding of IGF1R ligand, and perform
transcytosis
without inhibiting signal transduction through IGF1R.
In another embodiment, there is provided an isolated polynucleotide encoding
an anti-
IGF1R antibody or antigen-binding fragment thereof according to the present
invention.
In another embodiment, there is provided a composition for delivery of a
physiologically
active substance to pass through the blood-brain barrier, comprising an anti-
IGF1R antibody or
antigen-binding fragment thereof according to the present invention.
Another embodiment of the present invention is to provide a blood brain
barrier
3
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
transporter in which an anti-IGF1R antibody or antigen-binding fragment
thereof according to
the present invention delivers a physiologically active substance, for example
a physiologically
active substance acting in a brain to pass through the blood-brain barrier
through IGF1R to a
brain.
In another embodiment, there is provided a protein complex delivering to pass
through
the blood-brain barrier through to a brain, where an anti-IGF1R antibody or
antigen-binding
fragment thereof according to the present invention forms a conjugate with a
physiologically
active substance, for example a physiologically active substance acting in a
brain.
In another embodiment, there is provided a method of detecting IG1R in a
biological
sample, comprising a step of providing an anti-IGF1R antibody or antigen-
binding fragment
thereof according to the present invention, and contacting the anti-IGF1R
antibody or antigen-
binding fragment with a biological sample to be detected for IGF1R expression.
An embodiment provides a method of delivering a physiologically active
substance used
for diagnosis, treatment or prevention of brain disease to pass through BBB
into inner brain, by
using an anti-IGF1R antibody or antigen-binding fragment thereof according to
the present
invention.
[TECHNICAL SOLUTION]
Hereinafter, the present invention will be described in more detail.
Herein, -antibody" means a complete immunoglobulin in any isotype, or an
antigen-
binding fragment which can compete with a complete antibody for binding to a
target antigen.
For example, it includes chimeric, humanized, complete human or bispecific
antibodies, or their
4
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
antigen-binding fragments. The antibody is one kind of antigen binding
proteins by itself.
Generally, the complete antibody comprises at least two (2) full-length heavy
chains and two (2)
full-length light chains, but in some cases, the antibody may comprise only
heavy chains. The
antibodies include monospecific antibodies that specifically bind to one
target, and multispecific
antibodies (e.g., bispecific antibodies and trispecific antibodies) that
specifically bind multiple
targets.
The antibody also includes a monoclonal antibody and a polyclonal antibody,
and the
monoclonal antibody may be an isolated antibody that specifically binds to
IGF1R, such as
human antibody, a humanized antibody, or a chimeric antibody. The monoclonal
antibody is an
isolated antibody that specifically binds to IGF1R, in a form of of IgGl,
IgG2, IgG3 or IgG4
subtype.
Herein, -light chain" includes a full-length light chain and its fragments
having a
variable region sequence to sufficiently provide binding specificity to an
antigen or epitope. The
full-length light chain comprises a variable region domain VL and a constant
region domain CL.
The variable region domain of light chain is present in an N terminus of a
light chain polypeptide.
The kinds of light chain include kappa and lambda chains.
As used herein, the term "complementarity-determining regions (CDR)" refers to
a
region that imparts antigen-binding specificity among variable regions of an
antibody.
Herein, -heavy chain" includes a full-length heavy chain and its fragments
having a
variable region sequence to sufficiently provide binding specificity to an
antigen or epitope. The
full-length heavy chain comprises a variable region domain VH and three (3)
constant region
domains of CH 1, CH2 and CH3. The VH domain is present in N-terminus of a
heavy chain
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
polypeptide and the CH domain is present in a carboxyl-terminus, and CH3 is
positioned closest
to C-terminus. The heavy chain includes IgG (including IgGl, IgG2a, IgG2b,
IgG3 and IgG4
subtypes), IgA (including IgAl and IgA2 subtypes), and isotypes of IgM and
IgE.
The antibody may be selected from all subtypes of immunoglobulins (e.g., IgA,
IgD, IgE,
IgG (IgGl, IgG2, IgG3, IgG4), IgM, etc.). The IgG form of the antibody may be
of the IgGl,
IgG2, IgG3, or IgG4 subtype, for example IgG1 or IgG2 subtype. The IgG type
antibody
comprises two heavy chains and two light chains, and each heavy chain and
light chain are
combined through disulfide bonds to form two heavy chain-light chain dimers,
and the formed
two heavy chain-light chains are linked through a disulfide bond at the Fc
region of the heavy
chain. The IgG form of the antibody comprises a single target antibody
targeting one antigen,
including antigen binding sites for the same antigen in both heavy chain-light
chain constructs,
or bispecific antibody targeting two antigens, including antigen-biding sites
for different antigens
in heavy chain-light chain constructs.
Antibodies according to the present invention include bispecific antibodies,
whole
antibodies, minibodies, domain antibodies, antibody mimetics (or synthetic
antibodies), antibody
fusions (or antibody conjugates), fragments thereof and combinations thereof,
but not limited
thereto. The structures of various antibodies are further disclosed herein
below.
In the present invention, for example, "variant" of a polypeptide, such as an
antigen-
binding fragment, protein, or antibody, is a polypeptide in which insertion,
deletion, addition,
and/or substitution occurs at one or more amino acid residues compared to
other polypeptide
sequences, and includes fusion polypeptides. For example, some of the
antibodies include
6
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
conservative amino acid substitutions in one or more residues of the heavy or
light chain,
variable region or CDR sequence.
The term -derivative" of a polypeptide in the present invention means a
polypeptide that
is chemically modified through conjugation with other chemical moieties, and
is different from
insertion, deletion, addition or substitution variants.
The antibodies of the present invention can be generated and selected from
transgenic
mice, e.g. those described above, where the mice is introduced by the gene
encoding the antigen-
specific human mAbs having the desired specificity using hybridoma technology.
Such
antibodies can be cloned and expressed using appropriate vectors and host
cells, or the antibodies
can be harvested from cultured hybridoma cells. In addition, the antibody may
be derived from a
phage-display library. Phage display technology is a method that mimics a sort
of immune
selection by selecting an antibody repertoire on the surface of a filamentous
bacteriophage and
selecting phage binding to a desired antigen therefrom. Such a technique may
refer to an
embodiment of the present application or W01999/010494. In an embodiment, the
humanized
IGF1R antibody of the present invention is selected through a phage display
method.
The antibody or its antigen-binding fragment may be derived from only one
source or be
chimeric antibody. The chimeric antibody comprises a part derived from two
kinds of different
antibodies, and is described in more detail below. The antibody or its antigen-
binding fragment
can be produced by hybridoma, recombinant DNA technique, or enzymatic or
chemical cutting
of an intact antibody. Unless otherwise stated herein, the term of antibody
includes antibodies
comprising 2 full-length heavy chains and 2 full-length light chains, and
their derivatives,
variants, fragments, and mutants, and the examples thereof are as described
below.
7
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
As used herein, -antigen-binding fragment" includes a part of an antibody
which can
specifically bind to an antigen, or a polypeptide including the part. For
example, the antigen
binding fragment includes a part of an antibody containing amino acid residues
that gives the
specificity and affinity to the antibody by interacting with antigen (e.g.,
epitope), and a
polypeptide including the part. Such fragments comprise at least one CDR
present within a full
length light or heavy chain, and in some embodiments comprise a single heavy
and/or light chain,
or a portion thereof. This biologically-active fragment may be produced by a
recombinant DNA
technique or may be produced for example, by cutting an intact antibody
enzymatically or
chemically.
An immunologically-functional immunoglobulin fragment includes Fab, Fab',
F(ab')2,
Fv, domain antibody and single chain antibodies (e.g., scFv, scFv-Fc etc.) but
not limited thereto,
and may be derived from any mammal including human, mouse, rat, camelid or
rabbit, but not
limited thereto. The functional part of the antibody such as one or more CDRs
described herein
may be linked with a secondary protein or small molecular compound by a
covalent bond, and be
used as a target therapeutic agent to a specific target.
Herein, -single chain antibody" is a single polypeptide chain of the antigen-
binding
region formed by connecting heavy chain variable region and light chain
variable region via
flexible linker. For example, the single chain antibody may be at least one
selected from the
group consisting of a scFv in which the heavy chain variable region and the
light chain variable
region are linked in a single chain form, a scFv-Fc in which the heavy chain
variable region, a
light chain variable region, and Fc are linked in a single chain form, and the
like. The single
chain antibody may refer to for example, U.S. patent No. 5,260,203.
8
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Herein, -affinity" or -affinity degree is the strength of interaction between
an antibody
or its antigen-binding fragment and an antigen, and can be determined by
properties of the
antigen such as size, shape and/or charge of antigen, and CDR sequences and/or
physiochemical
properties (hydrophilic/hydrophobic properties, electrostatic property and
etc.) of the antibody or
antigen-binding fragment. The methods for determining the affinity are known
in the art, and
generally indicated as dissociation constant (KD), but not limited thereto.
In the full length forms of light chain and heavy chain, the variable region
and the
constant region are joined by a -J" region in about 12 or more amino acid
length, and the heavy
chain also includes a ``D" region in about 10 or more amino acid length. For
example,
Fundamental Immunology, 2nd ed., Ch. 7 (Paul, W., ed.) 1989, New York: Raven
Press can be
referred. Typically, the variable regions of the light chain and heavy chain
pair in the antibody
can form an antigen binding region.
An embodiment of the present invention relates to an antibody comprising an
antigen-
binding region for alpha-synuclein (a-syn) and an antigen-binding region for
IGF1R, specifically
a bi-specific antibody against alpha-synuclein (a-syn) and IGF1R (hereinafter,
anti-a-syn/anti-
IGF1R bispecific antibody). Accordingly, the bispecific antibody according to
the present
invention can recognize and bind both alpha-synuclein and IGF1R as antigens.
The anti-a-syn/anti-IGF1R bispecific antibody according to the present
invention
includes anti-a-syn antibody and an antigen-binding fragment thereof, and can
recognize and
bind to alpha-synuclein, especially C-terminal region of alpha-synuclein, and
thus can be used
for prevention, treatment and/or diagnosis of synuclienopathies which is
associated with alpha-
9
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
synuclein or aggregates of alpha-synuclein.
Herein, -bivalent antigen-binding protein" or -bivalent antibody" comprises
two
antigen-binding sites. Two antigen-binding sites comprised in this bivalent
antibody may have
the same antigen specificity or may be a bispecific antibody binding to
different antigens
respectively. Herein, -multi-specific antigen-binding protein" or -multi-
specific antibody" is
targeting two or more of antigens or epitopes.
Herein, -bispecific" or -dual-specific" antigen-binding protein or antibody is
a hybrid
antigen-binding protein or antibody having 2 different antigen-binding sites.
This bispecific
antibody is one kind of multi-specific antigen-binding protein or multi-
specific antibody, and it
can be produced by known various methods, for example, methods such as fusion
of hybridoma
or linking of Fab' fragment. For example, Songsivilai and Lachmann, Clin. Exp.
Immunol. 1990,
79:315-321; Kostelny et al.,J. Immunol. 1992, 148:1547-1553 and the like may
be referred. The
two epitopes being different each other to which twos antigen-binding sites of
the bispecific
antigen-binding protein or antibody bind may be positioned on the same or
different target
protein. In one embodiment, the antibody of the present invention may be in
the form of a
bispecific antibody which additionally comprises the binding to a delivery
carrier for delivering
the antibody through the blood brain barrier. One method for delivering drugs
through the blood
brain barrier includes the use of delivery systems such as receptor-mediated
transcytosis such as
glucose transporter, amino acid transporter, insulin receptor or transferrin
receptor in a cell.
According to the present invention, the term -synucleinopathies" include all
neurodegenerative disorders characterized by pathological synuclein
aggregates. Parkinson's
disease, Parkinson's disease dementia (PDD), Dementia with Lewy body (DLB),
Lewy body
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
disease, Dementia accompanied with Lewy bodies, Parkinson's syndrome with
Dementia,
Multiple system atrophy (MSA), multiple nervous system atrophy, and
neurodegeneration type I
with brain iron accumulation (NBIA Type I), are collectively grouped as
synucleinopathies. In
addition, the aggregations of alpha-synucleins have been also found secondary
in Alzheimer's
disease (Kim et al. Alzheimer's Research & Therapy 2014, 6:73).
The synucleinopathies is a diverse group of neurodegenerative disorders that
share
common pathological properties: In neuropathic experiments, distinct lesions
can be detected by
detecting abnormal aggregation of alpha-synuclein in the selected populations
of neurons and
oligodendrocytes. Alpha-synuclein (formerly known as PARK1 and PARK4) is a
protein
composed of 140 amino acids that is extensively expressed in the neocortex,
hippocampus,
dentate gyms, posterior neurosphere, striatum, thalamus and cerebellum. Alpha-
synuclein is also
highly expressed in hematopoietic cells including monocytes such as B cells T
cells and NK cells
and platelets. The exact role in these cells has been unknown, but associated
with differentiation
of megakaryocytes (platelet precursors).
Herein "a disease associated with alpha-synuclein aggregates" is a group of
neurodegenerative diseases called as synucleinopathies, in which alpha-
synuclein aggregates are
found in lesions including neurons and glia, and has characteristics. These
diseases include
Parkinson's disease, Parkinson's disease dementia, Lewy body dementia, Lewy
body variant of
Alzheimer's disease, combined Alzheimer's and Parkinson's disease, multiple
system atrophy,
and many other neuroaxonal diseases, but are not limited to. In one
embodiment, the antibody
according to the present invention is effectively used for treating
Parkinson's disease.
In addition, the anti-a-Syn/anti-IGF1R bispecific antibody of the present
invention
11
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
includes an anti-IGF1R antibody or antigen-binding fragment thereof, so that
the anti-a-Syn
antibody or antigen-binding fragment thereof can penetrate the blood brain
barrier to exert its
action, and extend the half-life to maintain an efficacy for a long time.
Moreover, the anti-a-Syn/anti-IGF1R bispecific antibody of the present
invention binds
to IGF1R on the cell surface without affecting the binding of the ligand, and
has properties of no
effect on the signaling pathway through IGF1R. Because it does not inhibit the
binding of IGF1R
to its ligand and signaling through IGF1R, it can be used as a shuttle mean to
penetrate the blood
brain barrier.
Particularly, the anti-IGF1R antibody or antigen-binding fragment thereof of
the present
invention specifically recognizes IGF1R (Insulin-like Growth Factor 1
Receptor) and binds to
IGF1R, particularly human IGF1R, mouse IGF1R, rat IGF1R, and monkey IGF1R.
However, it
does not interfere with the binding of IGF1R ligand such as IGF-1, IGF-2
and/or insulin to
IGF1R and does not inhibit signal transduction through IGF1R, and can be used
for transcytosis
to pass through BBB. It does not have antibody-dependent cell-mediated
cytotoxicity (ADCC),
and thus does not decrease IGF1R levels in the brain even when administered to
animals
repeatedly, thereby having no toxicity.
In particular, the anti-IGF1R antibody of the present invention binds to IGF1R
located
on the surface of brain endothelial cells constituting BBB and internalizes
into the inner part of
the cell.
For example, the anti-IGF1R antibody may have a form of scFv, and may be
combined
to therapeutic antibody in various ways. For example, the scFv of an anti-
IGF1R antibody can be
prepared in a bispecific antibody, for example a bivalent form of a bispecific
antibody in which
12
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
two scFvs bind to C-terminus of the therapeutic antibody, for example, cc-syn
antibody, or a
monovalent form of a bispecific antibody in which one scFv binds to C-terminus
of the
therapeutic antibody. Both of these bispecific antibodies can internalize into
the cells expressing
IGF1R. The IGF1R antibody has a high binding affinity to the antigen on the
cell surface, which
enhances the internalization effect and lead to BBB-passing ability. If an
antibody has the ability
to pass BBB and interfering with the signaling of IGF1R, it can cause side
effects. However, the
antibody of present invention is characterized in both the binding capacity
suitable for BBB
shuttle and non-blocking property for the IGF1R signaling.
The anti-IGF1R antibody or antigen-binding fragment thereof has excellent
property to
be developed easily. In this aspect, the post-translational modification, such
as deamidation, that
occurs in the CDR region of the anti-IGF1R antibody and reduces the stability
and efficacy of
the antibody is to be removed.
Alternatively, at least one of the amino acids located on both sides of the
deamidation
site of the antibody may be substituted, and preferably, the amino acid
immediately adjacent to
the C-terminal side of the deamidation site of the antibody may be
substituted. For example, by
substituting with A for G located next to Asn located at the deamidation site
of the antibody or
substituting with V for S located next to Asn, it is possible to produce
deamidated antibodies
having a similar binding affinity to that of parental anti-IGF1R antibody, and
at the same time
has excellent stability and BBB penetrating ability.
Additionally, when linked to a bioactive substance acting in the brain, the
anti-IGF1R
antibody of the present invention can induce improved BBB-penetrating ability
and efficacy
compared to the bioactive substance alone.
13
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
The anti-IGF1R antibody according to one aspect of the present invention may
be used
as a bispecific antibody including various second therapeutic antibodies. It
showed that the BBB
penetrating property is about 15-fold higher than the single antibody composed
of only a
therapeutic antibody, in the penetrating experiment using in vitro BBB system
derived from
human. The anti-IGF1R antibody may be bound to the second antibody in the
bispecific antibody
in a monovalent or bivalent form. For example, when analyzing the amount of
antibody in blood
and CSF after single administration of bispecific antibody with monovalent
form or bivalent
form anti-IGF1R antibody to a normal rat, the monovalent form and the bivalent
form of anti-
IGF1R antibodies showed up to 5-fold increased amount in blood and up to 5-
fold increased
amount in CSF, compared to parental anti-IGF1R antibody (clone 1564). They
showed about 3-
fold increased amount in CSF and about 4.5-fold increased amount of brain
penetrating
properties, compared to the parental anti-IGF1R antibody (clone 1564).
Therefore, the bispecific
antibody including the anti-IGF1R antibody improved by the above method is
expected to show
up to about 15 times amount in CSF and about 23 times capacity of antibody to
penetrate brain
compared to the single antibody composed of the therapeutic second antibody
alone.
The anti-IGF1R antibody of the present invention has been identified to bind
to IGF1R,
particularly IGF1R of mammals including humans, monkeys, rats, and mice, and
thus can be
useful for screening for drug development, clinical trials, and the like.
The anti-IGF1R antibody or antigen-binding fragment of the present invention
is an
antibody or antigen-binding fragment thereof that specifically recognizes
IGF1R (Insulin-like
Growth Factor 1 Receptor).
The anti-IGF1R antibody or antigen-binding fragment of the present invention
means
14
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
-specifically bind" to its target, such as an antigen, when it binds to at the
dissociation constant
(KD) of 10-6 M. The antibody specifically binds to the target with high
affinity, when KB is
1 x 104 M or when the effective concentration 50 (EC50) is 2 nM or less. In
one embodiment,
the antibody or antigen-binding fragment thereof is capable of binding to
IGF1R or human
IGF1R with a KD lx 10-8.
As used herein, the term "epitope" is an antigenic determinant, which is
interpreted to
mean a portion of the antigen recognized by the antibody. According to one
embodiment, the
binding site of the anti-IGF1R antibody of the present invention may be an
extracellular domain
of IGF1R protein, for example, a human IGF1R protein (SEQ ID NO: 99). More
specifically, the
binding sites of the anti-IGF1R antibody of the present invention, for
example, 1564 clone
antibody for the human IGF1R protein are binding site 1 including Y775, P776,
F778, R650,
S791, L798 and Glu779, binding site 2 including L641, H808, E809 and L813, and
binding site 3
including V397, D435, W434, Y460 and C488, in human IGF1R protein. Thus, the
epitope of
the IGF1R antibody of the present invention may be the conformational epitope
that include all
or part of the three binding sites.
The anti-IGF1R antibody or antigen-binding fragment of the present invention
does not
prevent the binding of IGF1R ligands such as IGF-1, IGF-2, and/or insulin to
IGF1R.
Specifically, the anti-IGF1R antibody or antigen-binding fragment does not
interfere with
binding of the IGF1R ligand to the IGF1R located on the membrane of the cells
expressing
IGF1R, or neither inhibit signal transduction through IGF1R nor affect the
expression of IGF1R
on the cell surface advantageously. Thus, the anti-IGF1R antibody or antigen-
binding fragment
of the present invention can be effectively used to penetrate the blood brain
barrier through
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
transcytosis. IGF1R has been shown to have a relatively high expression level
in the brain
compared to other transcytosis targets which have been used currently and have
known to be
expressed in endothelial cells of the brain for improving the ability to
penetrate BBB. In one
embodiment of the present invention, when IGF1R is compared to other targets
currently being
developed for the purpose of improving the BBB-penetrating capacity of
therapeutic antibodies,
for example, transferrin receptor, or insulin receptor, it has been shown to
have a relatively low
expression level in peripheral tissue such as the liver, lungs, or large
intestine.
IGF1R is a target of Receptor Mediated Transcytosis (RTM), which can deliver
useful
substances through the blood brain barrier (BBB) into brain. However, in order
to be used as a
drug delivery target for penetrating the blood-brain barrier, it is desirable
to have a property
binding to IGF1R on the cell surface without affecting the binding of the
ligand and the signaling
pathway through IGF1R. Thus, the anti-IGF1R antibody and antigen-binding
fragment thereof of
the present invention does not inhibit the binding of IGF1R to its ligand and
signaling through
IGF1R, and thus can be used as a shuttle mean to penetrate the blood brain
barrier.
The anti-IGF1R antibody or antigen-binding fragment of the present invention
is capable
of transcytosis and can pass through endothelial cells of brain. In addition,
the antibody of the
present invention is located in the same place as the brain blood vessels of
the mouse, when it is
injected into a blood vessel of mouse. These results indicate that the
antibody or antigen-binding
fragment of the present invention can be effectively used as a drug carrier
that crosses the blood
brain barrier.
Therefore, the anti-IGF1R antibody or antigen-binding fragment of the present
invention
allows the bioactive substance acting in brain to pass through the blood brain
barrier. In the
16
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
present invention, the biological barrier refers to cells, tissues, membranes,
or a cell, membrane,
or structure that prevents effective passage, diffusion, or transfer of
biological molecule. These
biological barriers include nerve cells/tissues, connective tissue, muscle,
membrane or epithelial
(e.g. mucosal or vascular) cells. A typical example is the blood brain
barrier.
In the present invention, the term -blood brain barrier" or BBB is a barrier
formed by
tight junctions in the capillary endothelial membrane of the brain existing
between the brain and
spine and its surrounding circulatory system. This barrier is so sturdy that
it also limits the
passage of molecules having low molecular weight of about 60 Da to the brain.
The blood brain
barrier of the brain, the vascular spinal cord barrier of the spine and the
vascular retinal barrier of
the retina are continuous capillary barriers in the central nervous system,
commonly referred to
as BBB.
In the present invention, the term "blood brain barrier transporter" may pass
through the
blood brain barrier and deliver an antibody or an antigen-binding fragment
thereof according to
the present invention, and for example, include a protein including g peptide
and polypeptide, a
nucleic acid, an antibody, or a small molecular compound.
The present invention relates to an isolated antibody or antigen-binding
fragment thereof
that specifically binds to IGF1R, wherein the antibody or antigen-binding
fragment may be a
polypeptide, protein or antibody or antigen-binding fragment thereof by
including a
complementarity determining region of a heavy chain and a complementarity
determining region
of a light chain, and specifically binds to IGF1R.
In specific examples, the anti-IGF1R antibody or antigen-binding fragment
thereof can
include:
17
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
(i) one or more heavy chain complementarity determining regions selected from
the
group consisting of H-CDR1, H-CDR2 and H-CDR3 described in Table 1, or a heavy
chain
variable region comprising the one or more heavy chain complementarity
determining regions;
(ii) one or more light chain complementarity determining regions selected from
the
group consisting of L-CDR1, L-CDR2 and L-CDR3 described in Table 1, or a light
chain
variable region comprising the one or more light chain complementarity
determining regions;
a combination of one or more heavy chain complementarity determining
regions(CDRs)
and one or more light chain complementarity determining regions(CDRs); or
a combination of the heavy chain variable region and the light chain variable
region.
Additionally, in the heavy chain variable region, the light chain variable
region, or a
combination of the heavy chain variable region and the light chain variable
region, the heavy
chain variable region may include one or more heavy chain framework selected
from the group
consisting of H-FR1, H-FR2, H-FR3 and H-FR4, and the light chain variable
region may include
one or more light chain framework selected from the group consisting of L-FR1,
L-FR2, L-FR3,
and L-FR4.
In one embodiment of the present invention, the elimination of amino acids
associated
with the occurrence of deamidation in an anti-IGF1R antibody, can reduce the
risk of antibody
degradation, which is unfavorable to process development, storage, and etc.,
without changing
the binding affinity to ECD of IGF1R as an antigen. In the anti-IGF1R
antibody, the positions
deleted amino acids may be, for examples, N51D, N51Q or S52V in a light chain
L-CDR2 and
N95aK, N95aH, N95aR, N95aD or G95bA in a light chain L-CDR3, or N54D, N54Q or
G55A
in a heavy chain H--CDR2 of 1564 (IgG), 1564 (scFv) or 1564-3. The elimination
of
18
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
deamidation is not limited to the clones described above, but may be applied
to other clones
according to the method of Table 14.
[Table 1]
CDR of a light chain variable region and a heavy chain variable region in anti-
IGF1R
antibody
clone ID/
H-CDR1 H-CDR2 H-CDR3 L-CDR1 L-CDR2 L-CDR3
SEQ ID No
1564 (IgG) 1 2 8 20 21 24
1564 (scFv) 1 2 8 20 21 24
1564-3 1 2 8 20 21 24
1564-DM 1 3 8 20 22 25
1564-DMP 1 3 8 20 22 25
VHS-DM 1 4 8 20 22 25
VHS-DMP 1 4 8 20 22 25
F06-DM 1 3 8 20 22 26
F06-DMP 1 3 8 20 22 26
F06 (de2)(StoP) 1 5 8 20 23 27
VH5(de2)(StoP) 1 6 9 20 23 28
VH16(de2)(StoP) 1 7 8 20 23 28
1564(de2)(StoP) 1 5 8 20 23 28
VH2 (scFv) 10 11 19 20 21 24
VH2-3 10 11 19 20 21 24
VH2-DM 10 12 19 20 22 25
VH2-DMP 10 12 19 20 22 25
VHS (scFv) 1 13 9 20 21 24
VHS-3 1 13 9 20 21 24
VH7 (scFv) 10 14 8 20 21 24
VH7-3 10 14 8 20 21 24
VH7-DM 10 15 8 20 22 25
VH7-DMP 10 15 8 20 22 25
VH9 (scFv) 1 16 8 20 21 24
VH9-3 1 16 8 20 21 24
VH9-DM 1 17 8 20 22 25
VH9-DMP 1 17 8 20 22 25
VH16 (scFv) 1 11 8 20 21 24
VH16-3 1 11 8 20 21 24
VH16-DM 1 12 8 20 22 25
VH16-DMP 1 12 8 20 22 25
VH32 (scFv) 10 18 19 20 21 24
19
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
VH32-3 10 18 19 20 21 24
VH32-DM 10 3 19 20 22 25
VH32-DMP 10 3 19 20 22 25
VH35 (scFv) 1 14 9 20 21 24
VH35-3 1 14 9 20 21 24
VH35-DM 1 15 9 20 22 25
VH35-DMP 1 15 9 20 22 25
C04 (scFv) 1 18 8 20 21 29
C04-3 1 18 8 20 21 29
C04-DM 1 3 8 20 22 30
C04-DMP 1 3 8 20 22 30
F06 (scFv) 1 18 8 20 21 31
F06-3 1 18 8 20 21 31
[Table 2]
CDR of a light chain variable region and a heavy chain variable region in main
anti-
IGF1R antibody
clone ID H-CDR1 H-CDR2 H-CDR3 L-CDR1 L-CDR2 L-CDR3
GFTFSSY AISYDQ GVLTTL
TGSSSNI AQSNRP GTWAGS
F06-DMP DMS GNTYYA MNWFD
GSNDVS S LHGYV
DSVKG Y
SEQ ID
1 3 8 20 22 26
NO
F06 AISYDN GVLTTL
GFTFSSY TGSSSNI ANVNRP GTWAGS
(de2)(StoP ANTYYA MNWFD
DMS GSNDVS S LNAYV
) DSVKG Y
SEQ ID 1
8 20 23 27
NO
AISGSNA GVLTTL
VH16(de2 GFTFSSY TGSSSNI ANVNRP GAWDD
NTYYAD MNWFD
)(StoP) DMS GSNDVS S SLNAYV
SVKG Y
SEQ ID
1 7 8 20 23 28
NO
AISYDN GVLTTL
1564(de2) GFTFSSY TGSSSNI ANVNRP GAWDD
ANTYYA MNWFD
(StoP) DMS GSNDVS S SLNAYV
DSVKG Y
SEQ ID
1 5 8 20 23 28
NO
The anti-IGF1R antibody comprises a heavy chain variable region and a light
chain
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
variable region, wherein the heavy chain variable region comprises a heavy
chain CDR1 (H-
CDR1) comprising an amino acid sequence elected from the amino acid sequences
of SEQ ID
NO: 1 or SEQ ID NO: 10, a heavy chain CDR2 (H-CDR2) comprising an amino acid
sequence
selected from the amino acid sequences of SEQ ID NOs: 2 to 7 and SEQ ID NOs:
11 to 18, and a
heavy chain CDR3 (H-CDR3) comprising an amino acid sequence selected from the
amino acid
sequences of SEQ ID NOs: 8 to 9 and SEQ ID NO: 19, and
the light chain variable region comprises a light chain CDR1 (L-CDR1)
comprising an
amino acid sequence selected from the amino acid sequences of SEQ ID NO: 20, a
light chain
CDR2 (L-CDR2) comprising an amino acid sequence selected from the amino acid
sequences of
SEQ ID NOs: 21 to 23, and a light chain CDR3 (L-CDR3) comprising an amino acid
sequence
selected from the amino acid sequences of SEQ ID NOs: 24 to 28 and SEQ ID NOs:
29 to 31.
In an embodiment of the present invention, the anti-IGF1R antibody or antigen
binding
fragment thereof comprises a heavy chain variable region and a light chain
variable region,
the heavy chain variable region comprises a heavy chain CDR1 (H-CDR1)
comprising
an amino acid sequence elected from the amino acid sequences of SEQ ID NO: 1,
a heavy chain
CDR2 (H-CDR2) comprising an amino acid sequence selected from the amino acid
sequences of
SEQ ID NO: 3, and SEQ ID NOs: 5 to 7, and a heavy chain CDR3 (H-CDR3)
comprising an
amino acid sequence selected from the amino acid sequences of SEQ ID NOs: 8 to
9, and
the light chain variable region comprises a light chain CDR1 (L-CDR1)
comprising an
amino acid sequence selected from the amino acid sequences of SEQ ID NO: 20, a
light chain
CDR2 (L-CDR2) comprising an amino acid sequence selected from the amino acid
sequences of
SEQ ID NOs: 22 and 23, and a light chain CDR3 (L-CDR3) comprising an amino
acid sequence
21
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
selected from the amino acid sequences of SEQ ID NOs: 26 to 28.
The heavy chain variable region of the anti-IGF1R antibody according to the
present
invention can include H-CDR1, H-CDR2 and H-CDR3 described in Table 1, or
further include
H-FR1 comprising an amino acid sequence of SEQ ID NO: 32, H-FR2 comprising an
amino acid
sequence of SEQ ID NO: 33 or SEQ ID NO: 34, H-FR3 comprising an amino acid
sequence of
SEQ ID NO: 35, and H-FR4 comprising an amino acid sequence of SEQ ID NO: 36.
The light chain variable region of the anti-IGF1R antibody according to the
present
invention can include L-CDR1, L-CDR2 and L-CDR3 described in Table 1, or
further include L-
FR1 comprising an amino acid sequence selected from SEQ ID NO: 37, L-FR2
comprising an
amino acid sequence of SEQ ID NO: 38, L-FR3 comprising an amino acid sequence
of SEQ ID
NO: 39 or SEQ ID NO: 40, and L-FR4 comprising an amino acid sequence of SEQ ID
NO: 41 or
SEQ ID NO: 42.
In the frameworks of the heavy chain and the light chain, the framework 1
(FR1) is
located at N-terminus of CDR1, framework 2 (FR2) is located between CDR1 and
CDR2,
framework 3 (FR3) is located between CDR2 and CDR3, and framework 4 (FW4) is
located at
C-terminus of CDR3.
Specifically, the framework sequences in a heavy chain variable region of 1564
(IgG)
include amino acid sequences of SEQ ID Nos: 32, 33, 35 and 36, and those of
other clones than
1564 (IgG) in Table 1 include amino acid sequences of SEQ ID Nos: 32, 34, 35
and 36.
Specifically, the framework sequences in a light chain variable region of the
anti-IGF1R
antibodies according to the present invention are shown in Table 3.
[Table 3]
22
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
The framework sequences in a light chain variable region of the anti-IGF1R
antibodies
L-FR1 L-FR2 L-FR3 LFR4
clone ID
SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO
1564 (IgG) 37 38 39 41
1564 (scFv) 37 38 40 42
1564-3 37 38 39 42
1564-DM 37 38 40 42
1564-DMP 37 38 39 42
VH05-DM 37 38 40 42
VH05-DMP 37 38 39 42
F06-DM 37 38 40 42
F06-DMP 37 38 39 42
F06(de2)(StoP) 37 38 39 42
VH5(de2)(StoP) 37 38 39 42
VH16(de25top) 37 38 39 42
1564(de2)(StoP) 37 38 39 42
VH2 (scFv) 37 38 40 42
VH2-3 37 38 39 42
VH2-DM 37 38 40 42
VH2-DMP 37 38 39 42
VHS (scFv) 37 38 40 42
VHS-3 37 38 39 42
VH7 (scFv) 37 38 40 42
VH7-3 37 38 39 42
VH7-DM 37 38 40 42
VH7-DMP 37 38 39 42
VH9 (scFv) 37 38 40 42
VH9-3 37 38 39 42
VH9-DM 37 38 40 42
VH9-DMP 37 38 39 42
VH16 (scFv) 37 38 40 42
VH16-3 37 38 39 42
VH16-DM 37 38 40 42
VH16-DMP 37 38 39 42
VH32 (scFv) 37 38 40 42
VH32-3 37 38 39 42
VH32-DM 37 38 40 42
VH32-DMP 37 38 39 42
VH35 (scFv) 37 38 40 42
VH35-3 37 38 39 42
VH35-DM 37 38 40 42
VH35-DMP 37 38 39 42
C04 (scFv) 37 38 40 42
23
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
C04-3 37 38 39 42
C04-DM 37 38 40 42
C04-DMP 37 38 39 42
F06 (scFv) 37 38 40 42
F06-3 37 38 39 42
The anti-IGF1R antibody according to the present invention may be an antibody
comprising a heavy chain variable region and a light chain variable region,
and various heavy
and light chain variable regions disclosed herein are exemplarily described in
Tables 4 and 5.
The heavy chain variable regions and light chain variable regions described in
Tables 4 and 5
below can be freely combined for the production of various types of
antibodies. Each of these
variable regions may be linked to the heavy and light chain constant regions
to form each heavy
chain and each light chain of an intact antibody.
[Table 4]
Heavy chain variable regions and light chain variable regions of the anti-
IGF1R
antibodies
clone ID clone ID
VH VL VH VL
/SEQ ID No /SEQ ID No
1564 (IgG) 43 88 VH9 (scFv) 66 111
1564 (scFv) 44 89 VH9-3 67 112
1564-3 45 90 VH9-DM 68 113
1564-DM 46 91 VH9-DMP 69 114
1564-DMP 47 92 VH16 (scFv) 70 115
VH05-DM 48 93 VH16-3 71 116
VH05-DMP 49 94 VH16-DM 72 117
F06-DM 50 95 VH16-DMP 73 118
F06-DMP 51 96 VH32 (scFv) 74 119
F06(de2)(StoP) 52 97 VH32-3 75 120
VH5(de2)(StoP) 53 98 VH32-DM 76 121
VH16(de2Stop) 54 99 VH32-DMP 77 122
1564(de2)(StoP) 55 100 VH35 (scFv) 78 123
VH2 (scFv) 56 101 VH35-3 79 124
VH2-3 57 102 VH35-DM 80 125
24
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
VH2-DM 58 103 VH35-DMP 81 126
VH2-DMP 59 104 C04 (scFv) 82 127
VHS (scFv) 60 105 C04-3 83 128
VH5-3 61 106 C04-DM 84 129
VH7 (scFv) 62 107 C04-DMP 85 130
VH7-3 63 108 F06 (scFv) 86 131
VH7-DM 64 109 F06-3 87 132
VH7-DMP 65 110 ** ** **
[Table 5]
Heavy chain variable regions and light chain variable regions in main anti-
IGF1R
antibodies
clone ID VH VL
F06-DMP EVQLLESGGGLVQPGGSLRLSCA QSVLTQPPSASGTPGQRVTISCTGS
ASGFTFSSYDMSWVRQAPGKCLE SSNIGSNDVSWYQQLPGTAPKLLI
WVSAISYDQGNTYYADSVKGRFT YAQSNRPSGVPDRFSGSKSGTSAS
ISRDNSKNTLYLQMNSLRAEDTA LAISGLRSEDEADYYCGTWAGSL
VYYCAKGVLTTLMNWFDYWGQ HGYVFGCGTKLTVL
GTLVTVSS (SEQ ID NO: 96)
(SEQ ID NO: 51)
F06(de2)(St EVQLLESGGGLVQPGGSLRLSCA QSVLTQPPSASGTPGQRVTISCTGS
oP) ASGFTFSSYDMSWVRQAPGKCLE SSNIGSNDVSWYQQLPGTAPKLLI
WVSAISYDNANTYYADSVKGRFT YANVNRPSGVPDRFSGSKSGTSAS
ISRDNSKNTLYLQMNSLRAEDTA LAISGLRSEDEADYYCGTWAGSL
VYYCAKGVLTTLMNWFDYWGQ NAYVFGCGTKLTVL
GTLVTVSS (SEQ ID NO: 97)
(SEQ ID NO: 52)
VH 16 (de2 S EVQLLESGGGLVQPGGSLRLSCA QSVLTQPPSASGTPGQRVTISCTGS
top) ASGFTFSSYDMSWVRQAPGKCLE SSNIGSNDVSWYQQLPGTAPKLLI
WVSAISGSNANTYYADSVKGRFTI YANVNRPSGVPDRFSGSKSGTSAS
SRDNSKNTLYLQMNSLRAEDTAV LAISGLRSEDEADYYCGAWDDSL
YYCAKGVLTTLMNWFDYWGQG NAYVFGCGTKLTVL
TLVTVSS (SEQ ID NO: 99)
(SEQ ID NO: 54)
1564(de2)( EVQLLESGGGLVQPGGSLRLSCA QSVLTQPPSASGTPGQRVTISCTGS
StoP) ASGFTFSSYDMSWVRQAPGKCLE SSNIGSNDVSWYQQLPGTAPKLLI
WVSAISYDNANTYYADSVKGRFT YANVNRPSGVPDRFSGSKSGTSAS
ISRDNSKNTLYLQMNSLRAEDTA LAISGLRSEDEADYYCGAWDDSL
VYYCAKGVLTTLMNWFDYWGQ NAYVFGCGTKLTVL
GTLVTVSS (SEQ ID NO: 100)
(SEQ ID NO: 55)
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
The heavy chain variable region of the anti-IGF1R antibody or antigen-binding
fragment
thereof according to the present invention may include one selected from the
group consisting of
amino acid sequences of SEQ ID NO: 43 to SEQ ID NO: 87. The light chain
variable region of
the anti-IGF1R antibody or antigen-binding fragment thereof according to the
present invention
may include one selected from the group consisting of the amino acid sequences
of SEQ ID
NOs: 88 to 132. Examples of the heavy chain variable region and the light
chain variable region
are described in Tables 4 and 5 above.
The anti-IGF1R antibody or an antigen binding fragment thereof that
specifically
recognizes and binds to at least one amino acids selected from the group
consisting of Y775,
P776, F778, R650, S791, L798, Glu779, L641, H808, E809, L813, V397, D435,
W434, Y460
and C488 in human IGF1R having an amino acid sequence of SEQ ID NO: 174.
Specifically,
anti-IGF1R antibody or an antigen binding fragment thereof of the present
invention can bind to
at least one selected from Binding site 1 to Binding site 3 of a human IGF1R
protein including
an amino acid sequence of SEQ ID NO: 174. The binding site 1 comprise at least
one amino acid
selected from the group consisting of Y775, P776, F778, R650, S791, L798 and
Glu779, the
binding site 2 comprise at least one amino acid selected from the group
consisting of L641, H808,
E809 and L813, and the binding site 3 comprises at least one amino acid
selected from the group
consisting of V397, D435, W434, Y460 and C488.
Each of the heavy chain variable regions and the light chain variable regions
disclosed in
Tables 4 and 5 can be used as separate domain antibodies, can be freely
combined with each
other to form various antibodies, and are linked in a single chain form to
obtain single chain
26
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
antibodies such as scFv.
Herein, -domain antibody" is an immunologically functional immunoglobulin
fragment
comprising a variable region of heavy chain and/or a variable region of light
chain only. In one
embodiment, two or more of VH regions are linked by a covalent bond by a
peptide linker, to
form a bivalent domain antibody. Two VH regions of this bivalent domain
antibody may target
the same or different antigen.
Antigen-binding fragments of anti-IGF1R antibodies of the present invention
may be
one selected from the group consisting of scFv, (scFv)2, scFv-Fc, Fab, Fab', F
(ab')2, minibody
and diabody include antibody fragments comprising one or more complementarity
determining
regions.
In the antigen-binding fragments, Fab includes a light chain variable region,
a heavy
chain variable region, a light chain constant region, and a first constant
region (CH1) of the
heavy chain, and has one antigen binding site. Fab' has a hinge region in the
Fab that contains
one or more cysteine residues at the C-terminus of the heavy chain CH1 domain.
The F (ab')2
antibody is produced by linking two Fab's are with forming disulfide bond
between cysteine
residues of the Fab' hinge region.
Fv is a minimal antibody fragment having only a heavy chain variable region
and a light
chain variable region, and includes single-chain variable fragments (scFv) and
double-chain
variable fragments (Fv). In the double chain Fv, a heavy chain variable region
and a light chain
variable region may be linked by non-covalent bonds. In the single-chain Fv,
the heavy-chain
variable region and the light-chain variable region are covalently linked
directly or via a peptide
linker, or linked directly at the C-terminus to form a scFv dimer-like
structure (di-scFv), such as
27
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
a double-chain Fv. In the present invention, the single-chain Fv is a single
polypeptide chain of
an antigen-binding region in which heavy and light chain variable regions are
directly or linked
by a linker, and can be at least one selected from the group consisting of
scFy having single
chain linked with the heavy chain variable region and the light chain variable
region, a form of
scFy dimer-like structure (di-scFv), skFv-Fc in which the heavy chain variable
region, the light
chain variable region and Fc is linked as a single chain form, and the like.
The peptide linker may be as described above, and may be, for example, 1 to
100, such
as 2 to 50 amino acids length or 5 to 25 amino acids length, and the peptide
linker can be in a
various length within a limit that does not affect the function of the
antibody. The kinds of amino
acids included in the peptide linker may be composed of one or more amino
acids selected from
the group consisting of, for example, Gly, Ser and Leu, and specific examples
include Gly and
Ser residues, or Leu and Ser residues. In a specific example, the peptide
linker may be (G4S)n in
which n is a repetition number of (G4S) represented by an integer of 1 to 10,
such as 2 to 5,
especially 3 or 4. An example of the peptide linker may be a peptide
consisting of amino acids of
SEQ ID NOs: 133 or 134.
SEQ ID NO 133: GGGGSGGGGSGGGGS
SEQ ID NO 134: GGGGSGGGGSGGGGSGGGGS
The single chain Fv (scFv) can be produced by fusing DNA encoding a peptide
linker
between DNAs encoding two variable domain polypeptides (VL and VH). The
prepared
polypeptide can form antigen-binding monomer or multimers (e.g., dimers,
trimers or tetramers)
depending on the length of the flexible linker between the two variable
domains, with folding.
By combining polypeptides containing different VLs and VHs, multimeric scFy
that bind to
28
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
different epitopes can be formed.
The antigen-binding fragments can be obtained using proteolytic enzymes (e.g.,
a
restriction digestion of the entire antibody with papain to obtain Fab, and
digestion with pepsin
to obtain F(ab')2 fragment), or using the genetic recombination technology.
The single-chain antibodies disclosed herein include, but are not limited to,
scFvs
comprising domain combinations of heavy and light chain variable regions, or
combinations of
light and heavy chain variable domains comprising CDRs.
The antigen-binding fragment of the anti-IGF1R antibody may be linked with or
without
a linker, such as a peptide linker. In addition, the heavy and light chain
portions in the antigen-
binding fragment, such as the heavy chain variable region and the light chain
variable region in
the scFv fragment, can also be linked with or without a peptide linker. The
peptide linker may be
as described above.
In the bispecific antibody, the anti-IGF1R antibody and antigen-binding
fragments
thereof may perform a function of delivering a second antibody or antigen-
binding fragment
targeting different antigens or epitopes that are bound to it, through the
blood brain barrier to
brain. The second antibody may be an antibody that exerts efficacy in brain,
but is not
particularly limited, it may be an anti-alpha-synuclein antibody or a binding
fragment thereof
according to the present invention.
The anti-IGF1R antibody or antigen-binding fragment thereof of the present
invention
may share a specific region or sequence with a different second antibody. For
example, the anti-
IGF1R antibody may share the constant region or the Fc region of the antibody
or antigen-
binding fragment of the second antibody.
29
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
In addition, the structure of the bispecific antibody in the present invention
includes a
bivalent form of bispecific antibody, in which the scFv of anti-IFG1R antibody
is linked to each
Fc of two heavy chains of a complete immunoglobulin, for example at the ends
of the heavy
chain directly or via a linker and a monovalent form of bispecific antibody,
in which a scFv of an
anti-IGF1R antibody linked to only one end of the two heavy chains of a
complete
immunoglobulin directly or via a linker, but a monovalent double antibody is
preferred.
Specifically, in one embodiment of the present invention, there is a case in
which the
monovalent form clone has an improved half-life than the bivalent form clone,
and the structure
of the monovalent form clone is form that domain antibody (scFv) against IGF1R
is bound to
only an end of one heavy chain in the intact immunoglobulin via a linker.
Specifically, the
antibody is a heterodimer applied by Knob-In-Hole method that includes two
different heavy
chains of the intact immunoglobulin in which one heavy chain has domain
antibody (scFv)
against IGF1R bound to C-terminus thereof, and the other heavy chain has not
any at the C-
terminus thereof.
In the bispecific antibody, the second antibody that binds to an anti-IGF1R
antibody or
antigen-binding fragment thereof may be a human antibody, a humanized
antibody, a chimeric
antibody, or an isolated antibody specifically binding to IGF1R. The second
antibody includes,
but is not limited to, complete antibodies, bispecific antibodies, minibodies,
domain antibodies,
antibody mimetics (or synthetic antibodies), antibody fusions (or antibody
conjugates), and
fragments thereof. In the bispecific antibody, an example of the second
antibody that binds to the
anti-IGF1R antibody or antigen-binding fragment thereof may be the anti-syn
antibody or
antigen-binding fragment thereof according to the present invention.
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Hereinafter, the present invention relates to an anti-syn antibody and an
antigen-binding
fragment thereof.
The alpha-synuclein which can be recognized by the antibody provided herein
can be
selected from the mammal alpha-synucleins of human alpha-synuclein, monkey
alpha-synuclein
(e.g. Rhesus alpha-synuclein), mouse alpha-synuclein, rat alpha-synuclein, and
the like. For
example, the human alpha-synuclein can be alpha-synuclein (NCBI ID: NP
000336), but not
limited thereto. Unless otherwise stated herein, the alpha-synuclein may refer
to human alpha-
synuclein, and the antibodies or antigen-binding fragments provided herein
have a specific
binding property to not only human alpha-synuclein, but also monkey (e.g.,
Rhesus) alpha-
synuclein, rat alpha-synuclein, and/or mouse alpha-synuclein.
The antibody or antigen binding fragment thereof can bind to C-terminal region
of
alpha-synuclein, specifically C-terminal region including the peptide
comprised of at least 11 or
12 consecutive amino acids including 110 to 120 residues or 111 to 122
residues in SEQ ID NO:
173 of human alpha-synuclein. It has been confirmed that the antibody or
antigen binding
fragment of present invention can recognize the antigen recognition region and
bind to the alpha-
synuclein aggregate with a high binding affinity.
Herein, -specifically binding to alpha-synuclein protein or alpha-synuclein
aggregate"
means that the binding affinity to alpha-synuclein protein or alpha-synuclein
aggregate is
relatively high compared to other antigens, and for example, may be the
affinity of 0.1 x 10' M
to 2 x 10' M, or 0.05 x 10' M to 0.3x10' M to alpha-synuclein aggregates,
specifically
amyloid fibrils, protofibrils and oligomers, particularly amyloid fibrils, as
measured by the Octet
31
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
analysis or the SPR analysis, but not limited thereto.
The humanized alpha-synuclein antibodies including light chain and heavy chain
according to an embodiment of the present invention, for examples, Hul 1F11
(ver.2), and
Hul 1F11 ABL2-4, exhibit a high activity to promote phagocytic uptake compared
to the
chimeric alpha-synuclein antibodies. Compared to the chimeric alpha-synuclein
antibody,
Hul 1F11 (ver.1), Hul 1F11 (ver.2), Hul 1F11 (ver.3), Hul 1F11 (ver.4), and
ABL2-4 shows high
activity of inhibiting the binding of fibril to nerve cell membrane compared
to the chimeric
alpha-synuclein antibody. Hul 1F11 (ver.2), HullF11 (ver.4) and ABL2-4 have
high activity of
inhibiting the propagation of alpha-synuclein secreted from the cells
overexpressing alpha-
synuclein to other nerve cells compared to the chimeric alpha-synuclein
antibody, and show the
binding affinity to the alpha-synuclein aggregate, for example, which is has a
similar or superior
activity to the chimeric alpha-synuclein antibody in a cell-based assay.
The alpha-synuclein antibody according to the present invention can inhibit
the function
of alpha-synuclein aggregates secreted out of nerve cell in the nervous system
of a subject to
transfers to other normal cells in an extracellular space and to infect the
nerve cells (inhibit cell-
to-cell transmission of aggregates), and have an ability of promoting the
phagocytic action of
microglia to alpha-synuclein aggregates in the extracellular space. The alpha-
synuclein
aggregates propagates from one cell to other cell like prions, and the alpha-
synuclein, especially
alpha-synuclein aggregates spread throughout the brain, resulting in
synucleinopathies in normal
cells. Therefore, alpha-synuclein aggregates are toxic to brain neurons and
are well known to
cause brain neuron death (neurodegeneration) and neuro-inflammation.
Accordingly, as alpha-
synuclein aggregates spread to various parts of the brain, the brain cell
death and the neuro-
32
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
inflammation reactions increase and results in occurrence of the brain cell
death and the resulting
behavior and cognitive impairments which are found with the progression of
synucleinopathies
such as Parkinson's disease.
Accordingly, the alpha-synuclein antibody of the present invention can prevent
the
spreading phenomenon of alpha-synuclein aggregates to various regions of the
brain by
inhibiting the transmission of the alpha-synuclein or alpha-synuclein
aggregate between the
nerve cells, and reduce the level of the alpha-synuclein aggregates which is
an important cause of
synucleinopathies by reducing or eliminating the alpha-synuclein aggregates
themselves in
extracellular region of the nerve cells of subject nerve system with the
promotion of the
microglia phagocytosis of, resulting in reduction of brain nerve cell death
and the neuro-
inflammatory reaction and further being expected to improve, alleviate or
prevent the symptoms
and the progress of synucleinopathies such as Parkinson's disease.
In addition, the alpha-synuclein antibody according to the present invention
has
excellent activities of performing both of two functions of (i) inhibition of
the transmission of the
alpha-synuclein or alpha-synuclein aggregate between the nerve cells (see the
result of cell-based
assay disclosed herein), and (ii) reduction of alpha-synuclein aggregates
level in the brain
nervous system through the promoted phagocytosis of microglial cells. In
particular, since the
alpha-synuclein antibodies which have been currently in clinical trials or
published in the
scientific paper have one of the two activities (i) and (ii), it suggests that
the alpha-synuclein
antibody of the present invention have an advantage in superior prevention or
treatment of
synucleinopathies to the the known alpha-synuclein antibodies. Therefore, the
alpha-synuclein
antibody according to the present invention have more excellent efficacies of
reduction and
33
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
elimination of alpha-synuclein aggregates and inhibition of the action of
alpha-synuclein
aggregates as etiology, and thus is more effective for synucleinopathies or a
symptomatic disease
related thereto (e.g., cognitive impairment disorder).
The antibodies or antigen-binding fragments according to the present invention
having a
high affinity for alpha-synuclein aggregates can reduce the formation of alpha-
synuclein
aggregate, thereby lowering the concentration of aggregates in the brain. In
addition, the
antibody or antigen-binding fragment according to the present invention with a
high affinity for
alpha-synuclein aggregates can reduce the formation of alpha-synuclein
aggregates outside the
central nervous system and finally, change the equilibrium state between the
alpha-synuclein
forms bounded by of BBB, thereby bringing the effect of lowering the
concentration of alpha-
synuclein aggregates inside the central nervous system.
The antibody or antigen-binding fragment according to the present invention
can inhibit
formation of aggregates by removing monomers, or eliminates both monomers and
aggregates.
The antibodies or antigen-binding fragments thereof of the present invention
that
specifically binds to alpha-synuclein proteins or alpha-synuclein aggregates
may not be
naturally-occurring product (it can be non-naturally occurring product, for
example, by chemical
synthesis or recombinant method). The recombination techniques are well known
in the art.
The anti-alpha-synuclein antibody or the bispecific antibody including the
anti-alpha-
synuclein antibody may be used for prevention or treatment of a-
synucleinopathy, and the a-
synucleinopathy can include Parkinson's disease (PD), Parkinson's disease
dementia (PDD),
dementia with Lewy bodies, (DLB), Lewy body variant of Alzheimer's disease
(LBV)),
Combined Alzheimer's and Parkinson disease, or multiple system atrophy( MSA),
but not limited
34
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
thereto.
The antibody or antigen-binding fragment thereof that specifically binds to
alpha-
synuclein or an aggregate thereof according to the present invention includes
a heavy chain
variable region comprising a complementarity determining region of CDRH1,
CDRH2 and
CDRH3; and a light chain variable region comprising a complementarity
determining region of
CDRL1, CDRL2 and CDRL3.
In one embodiment, the anti-alpha-synuclein antibody or antigen-binding
fragment
thereof may comprise the following CDR sequences:
a heavy chain CDR1 (H-CDR1) including an amino acid sequence of SEQ ID NO:
135,
a heavy chain CDR2 (H-CDR2) including an amino acid sequence of SEQ ID NO: 136
or SEQ ID NO; 137,
a heavy chain CDR3 (H-CDR3) including an amino acid sequence of SEQ ID NO:
138,
a light chain CDR1 (L-CDR1) including an amino acid sequence of SEQ ID NO:
139,
a light chain CDR2 (L-CDR2) including an amino acid sequence of SEQ ID NO:
140,
and
a light chain CDR3 (L-CDR3) including an amino acid sequence of SEQ ID NO:
141.
The amino acid sequences of the heavy chain CDR1 to CDR3 and the amino acid
sequences of the light chain CDR1 to CDR3 are summarized in Tables 6 and 7. In
the light
chains of HullF11-VLy3 4c and HullF11-VL4 shown in Table 7, the amino acid
sequences of
light chain CDR1 to CDR3 are the same, but the framework sequences are
different.
[Table 6]
Amino acid sequences of heavy chain CDR1 to CDR3 of anti cc-syn antibodies
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
SE SE SE
Clone VH CDR1 VH CDR2 VH CDR3
Q Q Q
ID ID ID
Hul 1F11-VH- 135 136 138 GFTFSDFY ASRNKANDYTTEYSA
DAHGKPF
vi ME SVKG AY
Hu11F11-VH- 135 136 138 GFTFSDFY ASRNKANDYTTEYSA
DAHGKPF
v2 ME SVKG AY
Hu11F11-VH- 135 136 138 GFTFSDFY ASRNKANDYTTEYSA
DAHGKPF
v3 ME SVKG AY
Hu11F11-VH- 135 136 138 GFTFSDFY ASRNKANDYTTEYSA
DAHGKPF
v4 ME SVKG AY
GFTFSDFY AIRNKANDYTTEYAA DAHGKPF
HullF11-VH2 135 137 138
ME SVKG AY
[Table 7]
Amino acid sequences of light chain CDR1 to CDR3 of anti a-syn antibodies
SEQ SEQ SEQ
Clone ID VL CDR1 ID VL CDR2 ID VL CDR3
NO NO NO
HullF11- 139 140 141 KSSQSLLYSSNQKNY WASTRE
QQYYSYPW
VLv3 4c LA S T
Hu 1 1F11-VL4 139 140 141
KSSQSLLYSSNQKNY WASTRE QQYYSYPW
LA S T
The various heavy and light chain variable regions disclosed herein can be
linked to the
heavy and light chain constant regions to form each heavy chain and light
chain of an intact
antibody. In addition, each of the heavy and light chain sequences generated
in this way can also
be combined to form a complete antibody structure.
For example, the anti-alpha-synuclein antibody or antigen-binding fragment
thereof
according to the present invention comprises a heavy chain variable region
comprising an amino
acid sequence selected from the group consisting of amino acid sequences of
SEQ ID NO: 142 to
SEQ ID NO: 146, and a light chain variable region comprising an amino acid
sequence selected
36
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
from the group consisting of an amino acid sequence of SEQ ID NO: 147 to SEQ
ID NO: 148,
and exemplary sequences of the heavy chain variable regions and the light
chain variable regions
are shown in Table 8 below.
[Table 8]
Heavy chain variable region and light chain variable region of anti-a-syn
antibody
clone Chain SEQ Amino acid sequence
ID
NO
EVQLVESGGGLVQPGGSLRLSCATSGFTFSDFY
HullF11-VH-v1 VH 142 MEWVRQPPGKRLEWIAASRNKANDYTTEYSAS
VKGRFTISRDDSKSSLYLQMNSLRAEDTAIYYCA
RDAHGKPFAYWGQGTTVTVSS
EVQLVESGGGLVQPGGSLRLSCATSGFTFSDFY
Hul 1F11-VH-v2 VH 143 MEWVRQPPGKRLEWIAASRNKANDYTTEYSAS
VKGRFTVSRDDSKSSLYLQMNSLRAEDTAIYYC
ARDAHGKPFAYWGQGTTVTVSS
EVQLVESGGGLVQPGGSLRLSCATSGFTFSDFY
Hu11F11-VH-v3 VH 144 MEWVRQPPGKRLEWIAASRNKANDYTTEYSAS
VKGRFTISRDTSKSSLYLQMNSLRAEDTAIYYCA
RDAHGKPFAYWGQGTTVTVSS
EVQLVESGGGLVQPGGSLRLSCATSGFTFSDFY
Hul 1F11-VH-v4 VH 145 MEWVRQPPGKRLEWIAASRNKANDYTTEYSAS
VKGRFTVSRDTSKSSLYLQMNSLRAEDTAIYYC
ARDAHGKPFAYWGQGTTVTVSS
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDFY
Hu11F11-VH2 VH 146 MEWVRQAPGKGLEWIAAIRNKANDYTTEYAAS
VKGRFTISRDTSKNSLYLQMNSLKTEDTAVYYC
ARDAHGKPFAYWGQGTLVTVSS
DIVMTQSPSSLAVSLGERVTMSCKSSQSLLYSSN
Hul 1F11-VLv3 4c VL 147 QKNYLAWYQQKPGQSPKLLIYWASTRESGVPD
RFTGSGSGTDFTLTISSVKAEDVAVYYCQQYYS
YPWTFGGGTKLEIK
DIQMTQSPSSLSASVGDRVTITCKSSQSLLYSSNQ
KNYLAWYQQKPGKAPKLLIYWASTRESGVPSRF
Hu11F11-VL4 VL 148
SGSGSGTDFTLTISSLQPEDFATYYCQQYYSYPW
TFGQGTKVEIK
In addition, exemplary antibodies through a combination of the heavy chain
variable
37
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
region and the light chain variable region of the antibody or antigen-binding
fragment according
to one embodiment are described in Table 9.
[Table 9]
Exemplary anti-a-syn antibodies of the present invention
Clone ID Heavy chain variable region and light SEQ ID NO
chain variable region of each clone
Hu11F11-VH-v1 142
hullF11(ver.1)
Hu11F11-VLv3 4c 147
Hul 1F11-VH-v2 143
hul 1F11(ver.2)
Hul 1F11-VLv3 4c 147
Hul 1F11-VH-v3 144
hul 1F11(ver.3)
Hul 1F11-VLv3 4c 147
Hul 1F11-VH-v4 145
hul 1F11(ver.4)
Hul 1F11-VLv3 4c 147
Hul 1F11-VH2 146
hul 1F1 1 (H2L4)
Hul 1F11-VL4 148
In another embodiment, the anti-alpha-synuclein antibody may consist of only
the light
chain or heavy chain described above. In another embodiment, the anti-alpha-
synuclein antibody
may consist of only the light chain variable region or the heavy chain
variable region.
In further embodiment, the heavy chain variable region and the light chain
variable
region described in Table 8 above may be combined to form various antibodies,
or may be linked
in a single chain form to form a single chain antibody such as scFv.
Antibodies disclosed herein may share certain regions or sequences with other
antibodies disclosed herein. In one embodiment, the constant region of the
antibody or antigen-
binding fragment may be shared. In other embodiments, they may share an Fc
region.
It may include a heavy chain including the heavy chain variable region and a
light chain
including the light chain variable region. Specifically, the heavy chain
variable region and the
38
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
light chain variable region may be linked to the heavy chain constant region
and the light chain
constant region, and the heavy chain and light chain sequences may also be
combined to form an
intact antibody structure.
The constant region sequences that can be combined with the variable region
according
to the present invention are exemplary, and the constant region may be
appropriately selected
from the heavy chain constant region and the light chain constant region of an
immunoglobulin
(eg, human immunoglobulin). For example, the heavy chain constant region may
be an IgG1
heavy chain constant region, an IgG3 heavy chain constant region, or an IgG4
heavy chain
constant region, and the light chain constant region may be a kappa constant
region or a lambda
light chain constant region, but is not limited thereto.
As an exemplary antibody comprising a variable region and a constant region of
an anti-
ct-syn antibody or antigen-binding fragment according to one embodiment, the
anti-alpha-
synuclein antibody of hul1F11 (ver.2) clone may be an antibody including a
heavy chain
including an amino acid sequence of SEQ ID NO: 149 and a light chain including
an amino acid
sequence of SEQ ID NO: 150.
The anti-alpha-synuclein antibody according to the present invention may be
used alone
as a therapeutic antibody, but may be used as a bispecific antibody in
combination with other
antibodies capable of delivering it to the brain though passing the blood-
brain barrier. An
example of an antibody capable of delivering it to the brain though passing
the blood-brain
barrier may be an anti-IGF1R antibody and an antigen-binding fragment thereof.
The anti-IGF1R
antibody and antigen-binding fragment thereof, which can form a bispecific
antibody, may
include all of the above-described anti-IGF1R antibody and antigen-binding
fragment thereof.
39
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
For example, the anti-IGF1R antibody may be a complete antibody, or the
antigen-binding
fragment may be one selected from the group consisting of domain antibody,
scFv, (scFv)2,
scFvFc, Fab, Fab' and F(ab')2.
The antigen-binding fragment of the anti-IGF1R antibody may be linked through
or
without a linker, for example, a peptide linker. Also, the heavy chain region
and the light chain
region in the antigen-binding fragment, such as the heavy chain variable
region and the light
chain variable region in the scFv fragment, may be linked via or without a
peptide linker. The
peptide linker may be as described above.
The anti-alpha-synuclein antibody or antigen-binding fragment thereof
according to the
present invention can be used in the preparation of heavy chain combinations
for the production
of bispecific antibodies, and examples of heavy chains of the anti-alpha-
synuclein antibodies
used for producing a heavy chain combination for the bispecific antibody are
associated with an
anti-alpha-synuclein antibody of hullF11 (ver.2), and include hullF11 (ver.2)
(IGG) having an
amino acid sequence of SEQ ID NO: 149, and hul 1F11 (ver.2)(IGG) WITH HOLE
MUTATION AT FC having an amino acid sequence of SEQ ID NO: 151.
Examples of heavy chains of anti-alpha-synuclein antibodies used in the
preparation of
heavy chain combinations for the production of bispecific antibodies,
including the above-
described anti-alpha-synuclein antibody hullF11 (ver.2) are shown in Table 10
below, and the
heavy chain sequences are shown in SEQ ID NO: 151 to SEQ ID NO: 172, but not
limited
thereto. In addition, Table 10 below shows the specific components of the
bispecific antibody
clone in which the heavy chain combination using the heavy chain of the anti-
alpha-synuclein
antibody and the light chain are combined. The bispecific antibodies presented
below are
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
described as examples, and the construction is clear from the description of
the heavy chain
combination of bispecific antibody, even if it is not indicated by SEQ ID No.
Exemplary
bispecific antibodies are specifically shown in Table 10 below.
[Table 10]
Description of the
Light chain Heavy chain
Clone ID of SEQ componets in the heavy
of bispecific combination of
bispecific antibody ID chain combination of
antibody bispecific antibody
bispecific antibody
hul 1F11(ver.2 (IGG)
WITH HOLE
hul 1F11(ver.2)- MUTATION AT FC,
1564-2 monovalent 158 (G45)3,
hul 1F11(ver.2)-
HullF11- (HC 1, -hole) 1564 (scFv) VL,
1564 (scFv)
VLv3 4c (G45)4,
monovalent
1564 (scFv) VH
hul 1F11(ver.2)-1564 hul 1F11(ver.2 (IGG)
monovalent (HC 2, - 152 WITH KNOB
knob) MUTATION
hul 1F11(ver.2 (IGG),
(G4S)3,
hul 1F11(ver.2)- HullF11- hul 1F11(ver.2)-VH5 *
VHS VL,
VHS bivalent VLv3 4c bivalent (HC)
(G4S)4,
VHS VH
hul 1F11(ver.2 (IGG),
(G4S)3,
hul 1F11(ver.2)- HullF11- hul 1F11(ver.2)-
* VH16 VL,
VH16 bivalent VLv3 4c VH16 bivalent (HC)
(G4S)4,
VH16 VH
hul 1F11(ver.2 (IGG),
M428L, HOLE
hul 1F11(ver.2)(M42 MUTATION,
8L)-F06-DM
165 (G45)3,
monovalent (HC 1, -
hul 1F11(ver.2)- F06-DMP VL,
HullF11- hole)
F06- (G4S)4,
VLv3 4c
DM monovalent F06-DMP VH
hul 1F11(ver.2
hul 1F11(ver.2)(M42
(IGG),M428L
8L)-F06 monovalent 155
MUTATION, KNOB
(HC 2, -knob)
MUTATION
hul 1F11(ver.2 (IGG),
hul 1F11(ver.2)- hul 1F11(ver.2) -F06- HOLE MUTATION,
HullF11-
F06-DMP DMP monovalent * (G45)3,
VLv3 4c
monovalent (HC 1, -hole) F06-DMP VL,
(G4S)4,
41
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
F06-DMP VH
hul 1F11(ver.2) -F06
hul 1F11(ver.2 (IGG),
monovalent (HC 2, - *
KNOB MUTATION
knob)
hul 1F11(ver.2 (IGG),
M428L, HOLE
hul 1F11(ver.2)(M42 MUTATION,
8L)-F06-DMP
164 (G4S)3,
monovalent (HC 1, -
hul 1F11(ver.2)(M4 F06-DMP VL,
HullF11- hole)
28L)-F06-DMP (G4S)4,
VLv3 4c
monovalent F06-DMP VH
hul 1F11(ver.2
hul 1F11(ver.2)(M42
(IGG),M428L
8L)-F06 monovalent 155
MUTATION, KNOB
(HC 2, -knob)
MUTATION
hul 1F11(ver.2 (IGG),
M428L, HOLE
hul 1F11(ver.2)(M42 MUTATION,
8L)-F06-DM
165 (G4S)3,
monovalent (HC 1, -
hul 1F11(ver.2)(M4 F06-DM VL,
HullF11- hole)
28L)-F06-DM (G4S)4,
VLv3 4c
monovalent F06-DM VH
hul 1F11(ver.2)(M42 hul 1F11(ver.2
8L)-F06 monovalent, 155 (IGG),M428L
deamidated, S->P MUTATION, KNOB
(HC 2, -knob) MUTATION
hul 1F11(ver.2)
(IGG)
hul 1F11(ver.2)- HOLE MUTATION
F06(de2)(StoP)-
(G4S)3
(monovalent,
166 F06(de2)(StoP)
deamidated,
VL
S->P
hul 1F11(ver.2)- (G4S)4
HullF11- (HC 1,-hole)
F06(de2)(StoP)F06(de2)(StoP)
VLv3 4c
monovalent VH
hul 1F11(ver.2)-
F06(de2)(StoP)-(de2)
monovalent, hul 1F11(ver.2 (IGG),
152
deamidated, KNOB MUTATION
S->P
(HC 2, -knob)
hul 1F11(ver.2 (IGG)
hul 1F11(ver.2)-
hul 1F11(ver.2)- (G4S)3,
HullF11- VH5(de2)(StoP) 167
VH5(de2)(StoP) VH5(de2)(StoP)VL
VLv3 4c deamidated,
bivalent (G4S)4
S->P bivalent(HC)
VH5(de2)(StoP)VH
hul 1F11(ver.2)- hul 1F11(ver.2)- hul 1F11(ver.2 (IGG)
Hu11F11-
VH VLv3 VH16(de2)(StoP) 168 (G4S)3,
VLv3 4c
bivalent deamidated, VH16(de2)(StoP)VL
42
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
S->P bivalent(HC) (G4S)4
VH16(de2)(StoP)VH
hul 1F11(ver.2)
(IGG) M428L,
hul 1F11(ver.2)(M42 HOLE MUTATION
8L)-F06(de2)(StoP)-
(G4S)3
(monovalent, 169
deamidated, F06(de2)(StoP)
VL
hul 1F11(ver.2)(M4 S->P
28L)- HullF11- (HC 1, -hole) (G4S)4
F06(de2)(StoP) VLv3 4c F06(de2)(StoP)
VH
monovalent
hul 1F11(ver.2)(M42
8L)- F06(de2)(StoP)- hul 1F11(ver.2
(de2) monovalent, 155 (IGG),M428L
deamidated, MUTATION, KNOB
S->P MUTATION
(HC 2, -knob)
hul 1F11(ver.2) (IGG)
2)-
hul 1F11(ver.2)- hul 1F11(ver. (G4S)3,
HullF11- F06(de2)(StoP)
F06(de2)(StoP) * F06(de2)(StoP)VL
VLv3 4c deamidated,
bivalent (G4S)4
S->Pbivalent(HC)
F06(de2)(StoP)VH
hul 1F11(ver.2 (IGG)
hul 1F11(ver.2)(M4 hul 1F11(ver.2)(M42 M428L mutated
28L)- HullF11- 8L)-F06(de2)(StoP) * (G4S)3,
F06(de2)(StoP) VLv3 4c deamidated, F06(de2)(StoP)VL
bivalent S->Pbivalent(HC) (G4S)4
F06(de2)(StoP)VH
hul 1F11(ver.2)
hul 1F11(ver.2)- (IGG)
1564(de2)(StoP)- HOLEMUTATION
monovalent,
* (G4S)3
deamidated,
1564(de2)(StoP) VL
S->P
hul 1F11(ver.2)- (G4S)4
HullF11- (HC1,-hole)
1564 (de2)(StoP) VLv3 4c 1564(de2)(StoP) VH
monovalent hul 1F11(ver.2)-
1564(de2)(StoP)-
hul 1F11(ver.2) (IGG)
(de2) monovalent, *
WITH KNOB
deamidated,
MUTATION
S->P
(HC2,-knob)
hul 1F11(ver.2 (IGG)
hul 1F11(ver.2)(M4 hul 1F11(ver.2)(M42 M428L mutation
28L)- HullF11- 8L)-VH5(de2)(StoP)
170 (G4S)3,
VH5(de2)(StoP) VLv3 4c deamidated, VH5(de2)(StoP)VL
bivalent S->P bivalent(HC) (G4S)4
VH5(de2)(StoP)VH
hul 1F11(ver.2)(M4 HullF11- hul 1F11(ver.2)(M42 171 hul
1F11(ver.2 (IGG)
28L)- VLv3 4c 8L)- M428L mutation
43
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
VH16(de2)(StoP) VH16(de2)(StoP) (G4S)3,
bivalent deamidated, VH16(de2)(StoP)VL
S->P bivalent(HC) (G4S)4
VH16(de2)(StoP)VH
hul 1F11(ver.2)
hul IF 11(ver.2)(M42 (IGG) M428L,
8L)- HOLE MUTATION
1564(de2)(StoP)- (G4S)3
monovalent, 172 1564(de2)(StoP)
deamidated, VL
hul IF 11(ver.2)(M4 S->P (G4S)4
28L)- Hu 1 1F11- (HC 1, -hole) 1564(de2)(StoP)
1564(de2)(StoP) VLv3 4c VH
monovalent hul IF 11(ver.2)(M42
8L)-
1564(de2)(StoP)-
Hu 1 1F11(ver2)(M428L)
(de2) monovalent, 155
-knob
deamidated,
S->P
(HC 2, -knob)
The pharmaceutical composition for preventing or treating alpha-synuclein
disease,
comprising the alpha-synuclein antibody or antigen-binding fragment thereof,
or a bispecific
antibody comprising the same according to the present invention, comprises an
alpha-synuclein
antibody or bispecific antibodies at a pharmaceutically effective amount.
As used herein, -treatment" can refer to any action related to the alleviation
or
elimination of a disease or symptom, or pathological condition, including
reducing, alleviating,
relieving or eliminating a disease or disease symptom, making the disease
symptom or
pathological condition more tolerable, slowing down the rate of exacerbating
the disease
symptom or pathological state or etc. The term -subject" or -patient" includes
human or human
patient.
There is provided a pharmaceutical composition comprising a therapeutically
effective
amount of an antibody and a pharmaceutically acceptable diluent, carrier,
solubilizer, emulsifier,
44
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
preservative and/or adjuvant. For examples, the present invention includes a
method of treating a
patient associated with alpha-synuclein by administering the pharmaceutical
composition.
Pharmaceutical compositions used for in vivo administration are typically
provided as sterile
preparations. Once the pharmaceutical composition is formulated, the
pharmaceutical
composition may be stored in sterile vials as a solution, suspension, gel,
emulsion, solid, crystal,
or dehydrated or lyophilized powder. Such formulations may be stored in ready-
to-use form, or
in a form that is reconstituted immediately prior to administration (e.g.,
lyophilized).
The route of administration of the pharmaceutical composition may be known
method,
for example, orally; injection via the intravenous, intraperitoneal,
intracerebral
(intraparenchymal), intraventricular, intramuscular, intraocular,
intraarterial, intraportal, or
intralesional routes, and sustained release systems; or implanted devices may
be used. In certain
embodiments, the composition may be administered continuously by bolus
injection, or by
infusion or implantation device.
The alpha-synuclein antibody or antigen-binding fragment thereof or a
bispecific
antibody comprising the same according to the present invention described
herein, may be used
for diagnostic purposes for detecting, diagnosing, or monitoring diseases
and/or symptoms
associated with alpha-synuclein. For diagnostic use, antibodies may typically
be labeled with a
detectable label.
[Effects of the Invention]
The antibody prepared in one embodiment of the present invention specifically
binds to
IGF1R with a binding affinity optimized for brain endothelial transcytosis,
and is useful for the
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
delivery of antibodies for treatment of degenerative brain diseases and brain
cancer, which have
limited therapeutic efficacy due to low blood-brain barrier-penetrating
ability. In particular, the
antibody disclosed in the present invention does not affect the binding of
ligands such as IGF-1,
IGF-2 and insulin as its homolog to IGF1R, and does not inhibit signal
transduction through the
IGF1R, and thus it has utility in relation to the penetration of the brain
blood barrier. The
antibody disclosed herein can effectively remove or promote the degradation of
alpha-synuclein
aggregates, and can inhibit the intercellular transfer of alpha-synuclein, so
that it can be usefully
used in the treatment of diseases related to the accumulation of alpha-
synuclein aggregates. The
alpha-synuclein antibody or the bispecific antibody comprising the same
according to the present
invention can be used as a pharmaceutical composition for preventing or
treating a-
synucleinopathy.
[Brief Description of Drawings]
Fig. 1 is a result of ELISA to measure the affinity of anti-a-syn chimeric
antibody and
humanized 11F11 antibody prepared in an example of the present invention.
Figs. 2a to 2c are results of BIAcore analyses on the preferred binding
specificity and
affinity of anti-a-syn chimeric antibody and humanized 11F11 antibody prepared
in an example
of the present invention for alpha-synuclein aggregates.
Figs. 3a and 3b are binding data of the anti-IGF1R antibody prepared in an
example of
the present invention to the IGF1R protein.
Figs. 4a, 4b and 4c are binding data of the anti-IGF1R antibody prepared in an
example
of the present invention to IGF1R-expressing cell lines.
46
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Fig. 5a, 5b, and 5c show data of the internalization of the anti-IGF1R
antibody prepared
in an example of the present invention into IGF1R-expressing cell lines and
the fate in the cell.
Figs. 6a, 6b, and 6c are data showing that the anti-IGF1R antibody prepared in
an
example of the present invention does not affect IGF1R signaling induced by
IGF1 or insulin.
Figs. 7a, 7b, 7c, 7d, 7e, and 7f show that the anti-IGF1R antibody and the
bispecific
antibody including the anti-IGF1R antibody and a therapeutic antibody
penetrate the BBB in
vivo better than the therapeutic antibody alone.
Fig. 8 is a result showing the deamidation position of the anti-IGF1R
antibody.
Fig. 9 is an epitope mapping result of an anti-IGF1R antibody.
Figs. 10a and 10b are results of ELISA to measure the binding ability of the
bispecific
antibody prepared in the example of the present invention each antigen.
Fig. 10c and 10d are results of ELISA to compare the binding affinities of the
chimeric
antibody and the humanized antibody to each antigen.
Fig. 10e is a result of evaluating the activity of microglial phagocytosis on
the bispecific
antibody prepared in example of the present invention.
Figs. 1 la to lie are results of evaluating the efficacy of the bispecific
antibody prepared
in an example of the present invention in comparison with a monospecific
antibody in a mouse
animal model.
Fig. 12 is a result showing the increased half-life and improvement in BBB
penetration
by performing Fc engineering on the bispecific antibody prepared in an example
of the present
invention.
Fig. 13 is a result of evaluating the ability to reduce a-syn in a mouse
animal model with
47
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
respect to the bispecific antibody prepared in an example of the present
invention.
Figs. 14a, 14b, and 14c are results of ELISA to perform comparative analysis
of the
antigen-binding ability of the deamidated anti-IGF1R antibodies prepared in
examples of the
present invention and control antibodies, respectively.
Figs. 15a to 15c are results of FACS analysis of the IGF1R-specific binding
capacity of
the deamidated bispecific antibody prepared in an example of the present
invention.
Fig. 16 is a result of comparative analysis of in vivo BBB penetration ability
of the
deamidated bispecific antibody prepared in examples of the present invention
and the control
antibodies.
Fig. 17 is a result of comparative analysis of in vivo BBB penetration ability
of the
deamidated bispecific antibody prepared in examples of the present invention
and the control
antibodies.
[Detailed Description]
The present invention will be described in more detail with reference to the
following
examples, but the scope of the present invention is not intended to be limited
to the following
examples.
Example 1: Preparation of mouse alpha-synuclein antibody
1-1: Immunization and Hybridoma production
48
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Alpha-synuclein monomer with a full length (140 residues) or cleaved with C-
terminal
21 residues (119 residues) were placed in a thermomixer at 37 C, aggregated
with shaking at
1050 rpm for 14 days, and sonicated. Each of 140 residues and 119 residues of
the a-syn fibril at
1 mg / ml was mixed with the adjuvant at a ratio of 1: 1 (vol: vol). The amino
acid sequence of
Homo sapiens alpha-synuclein is shown in SEQ ID NO: 173.
Then, 200 pL of the prepared mixture was injected subcutaneously into 5 to 7
week old
BALB/c female mice. After 2 weeks, 200 pt of the prepared mixture was further
injected
subcutaneously for antibody boosting. After one week of boosting, blood was
collected and
immunization titration was performed by the ELISA method using the
administered antigen.
Subsequently, third boosting was performed by subcutaneous injection of
antigen alone.
The spleen of the immunized mouse was removed, and the spleen cells were
obtained
from the spleen. The spleen cells were suspended in Hybridoma-SFM medium
(Thermo Fisher
Scientific, USA) supplemented with 10% FBS. To prepare the hybridoma, the
spleen cells and
5P2/0-Ag14 of a murine myeloma cell were mixed in a Hybridoma-SFM medium
without serum,
and followed by centrifugation to remove the medium. Then, PEG was added to
the obtained cell
pellet and incubated at 37 C for 1 minute to induce cell fusion.
1-2: Single cell cloning and Purification of antibodies
After 2 weeks in the fusion, the fusion with mouse B cells producing
antibodies was
confirmed with an ELISA method using the antigen administered to the mouse and
a cell culture
medium. Then, single-cell cloning was carried out using a hybridoma to select
16 hybridomas
49
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
producing monoclonal antibodies. 9B11 clones (IgG1 kappa) were obtained using
the aggregate
of full length (140 residues) a-Syn as an antigen, and Clones of 3A9 and 11F11
(IgG2b kappa,
and IgG2b kappa, respectively) were obtained using a-Syn aggregates with
cleaved C-terminal
21 residues as antigens.
In order to purifying the antibody, each hybridoma was cultured in RPMI1640
medium
containing 10% FBS. For antibody production, the culture medium was replaced
with serum-free
SFM medium and cultured for about 4 days. The cell culture supernatant was
separated,
centrifuged, filtered with a 0.22 p.m filter, and purified with a protein G
column for IgG1 type
and the protein A column for the remaining antibodies.
1-3: Determination of variable region sequence
The variable region and CDR sequences were determined by referring to the
disclosure
Alm et of al, Mol. Cells 2004, 18 (2): 237-241. Hybridomas were cultured and
centrifuged to
isolate only the cells. The RNA was isolated from the isolated hybridoma by
the addition of a
triazole and was used for synthesize cDNA as a template.
Example 2. Preparation of anti-alpha-synuclein (chimeric) antibodies
2-1: antibody cloning and expression
By using the nucleotide sequences of the heavy chain variable region and the
light chain
variable region antibody obtained after humanization, gblock (m.biotech) of a
short nucleotide
fragment was synthesized, and cloned into the animal cell culture vector
(pcDNA3.4). The
gblock was synthesized by including about 20 bp overlapped sequence before and
after the
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
variable region, and the part of the pcDNA3.4 vector excluding the variable
region was amplified
by PCR and cloned by Gibson assembly method.
In order to transfect and express the cloned antibody, the prepared vector was
used for
maxi-prep (Qiagen) to obtain a large amount of plasmid DNA, and then
introduced into cells as
follows. The day before transfection, the concentration of ExpiCHO TM (Gibco,
Cat: A29127)
cells was adjusted to concentration of 3 x 10E6 to 4 x 10E6 viable cells / mL
in in ExpiCHO TM
expression medium (Gibco, Cat: A29100-01) and cultured at 8% CO2, at 37 C and
120 rpm for
1 day. On the day of DNA transfection, the cells that were grown to 7 x 10E6
to 10 x 10E6
viable cells / mL and had survival rates of 95% or more were prepared by
diluting using fresh
medium.to 6 x 106 viable cells / mL.
In order to transfect the parent cells, ExpiFectamineTM CHO & plasmid DNA
complex
was prepared by using the ExpiFectamine TM CHO transfection kit (Gibco, Cat:
A29129). DNA
and ExpiFectamine TM CHO reagents were prepared at appropriate concentrations
by dispensing
with cold OptiPRO TM SFMO (Gibco, Cat: 12309019) medium, were respectively
inoculated,
and mixed to stand at room temperature for 5 minutes. The product was
inoculated into parent
cells, and cultured after transfection. The day after transfection, the
enhancer and feed included
in the ExpiFectamine TM CHO transfection kit were inoculated into transfected
cells, and after 5
days, the feed was additionally inoculated, followed by incubation for 10 days
at 8% CO2, 37 C,
and 120 rpm to produce the transfected cells.
In order to obtain the culture solution, the culture medium was transferred to
a centrifuge
bottle for centrifugation and centrifuged at 4 C and 6500 rpm for 30 minutes,
followed by
filtering with a filter having a size of 0.2 pm to obtain a culture medium
with removing
51
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
suspended solids, and then the culture medium was used for subsequent
purification.
2-2: Purification and sequencing of antibody
The culture was purified using HiTrap MabSelectSure (GE Healthcare, 11-0034-
94).
After equilibrating with an equilibration buffer (50 mM Tris-HC1 pH7.2, 100 mM
NaCl), the
recovered culture was loaded onto a column. When the loading was completed,
the medium was
washed with 50 mM Sodium Citrate (pH 5.0), and then eluted using 50 mM Sodium
Citrate (pH
3.4). 1M Tris-HC1 pH 9.0 was added to the eluate to neutralize to pH 6Ø
Then, the eluate was
buffer exchanged and concentrated with PBS (phosphate buffered saline, pH 7.4)
and stored at
4 C until subsequent use.
When additional purification was required, a second purification was performed
based
on the size of the eluted sample by passing the first purified product through
1X PBS buffer on
the HiLoad 26/600 superdex 200 column. The amino acid sequence of the purified
antibody was
analyzed by mass spectrometry, and confirmed to be consistent with the
variable region of the
mouse-derived monoclonal antibody.
The backbone variable region portion of the human IgG1 isotype was replaced
with the
variable regions of the 3A9, 9B11, and 11F11 antibodies identified by the
above method to
prepare a chimeric human IgG1 antibody. Among the obtained chimeric
antibodies, especially
Chl1F11 antibody is an antibody in the form of IgG and comprises a combination
of the heavy
chain variable region sequence of SEQ ID NO: 175 (chl1F11-VH). The bold part
in table 11
corresponds to CDR regions.
[Table 11]
52
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Name Amino acid sequence SEQ ID
NO
chl 1F11-VH EVQLQESGGGLVQPGGSLRLSCATSGFTFSDFYMEWV 175
RQPPGKRLEWIAASRNKANDYTTEYSASVKGRFIVSR
DT S Q S ILYL QMNALRAEDTAIYYCARDAHGKPFAYWG
QGTLVTVSA
chi 1F11-VL DIVMTQSPSSLAVSVGEKVTMSCKSSQSLLYSSNQKN 176
YLAWYQQKPGQ SPKLLIYWASTRE S GVPDRFTGS GS G
TDFTLTISSVKAEDLAVYYCQQYYSYPWTFGGGTKLEI
K
Example 3: Production of humanized antibody
3-1: Library phage preparation
A mini-library in which a mouse or human-derived sequence was introduced into
each
CDR residue was constructed, while binding the human framework to the CDR1,
CDR2, and
CDR3 residues of the chimeric antibody.
The competent cells of the produced min library were inoculated in 2X YT
medium [ 17
g of Tripton (CONDA, 1612.00), 10 g of yeast extract (CONDA, 1702.00) and 5 g
of NaCl
(Sigma, S7653)] containing 34 ug/m1 of chloramphenicol (Sigma, C0857), 2%
glucose (Sigma,
G5400) and 5 mM MgCl2 (Sigma, C0857) at 30 C for 3 hours to be 0D600 of 0.5
to 0.7. Then,
the cells were infected with a helper phage, and cultured in 2X YT medium
containing 34 ug/m1
of chloramphenicol, 5 mM MgCl2, 70 ug/m1 of kanamycin (Sigma, K1876) and 1 mM
IPTG
(ELPISBIO, IPTG025) at 30 C for 6 hours to induce the phage packing. The
culture solution
was centrifuged at 4500 rpm at 4 C for 15 minutes. The supernatant was added
with 4% PEG
6000 (Fluka, 81253) and 3% NaCl (Sigma, S7653) and incubated for 1 hour on
ice. The product
was centrifuged at 8000 rpm for 20 minutes at 4 C, and then, the pellet was
suspended in PBS
53
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
and centrifuged again at 4 C and 12,000 rpm for 10 minutes to obtain a
supernatant containing
the phage library. The obtained supernatant was stored at 4 C until
subsequent use.
3-2: Phage display panning
In order to select antibodies that preferentially bind to alpha-synuclein
aggregates to the
monomers, the panning was performed using the full-length alpha-synuclein
aggregates prepared
in Example 1, and total three panning were performed as follows.
Bovine serum albumin (BSA) was added to the cells at a concentration of 3 % in
a test
tube at 4 C overnight, adding 10 pg/m1 of recombinant alpha-synuclein
aggregates and
monomers to the PBS in an immunotube (maxisorp 444202) solution was added to
the test tube
and the surface of which alpha-synuclein aggregates and monomers were not
adsorbed was
protected. After emptying the test tube, the antibody phage library of 1012
CFU dispersed in BSA
3% solution was put into the immunotube in which the alpha-synuclein
aggregates and
monomers were absorbed and reacted for 1 hour (negative selection). Then, the
phages were not
bound to alpha-synuclein aggregates and monomers were recovered and reacted
for 2 hours at
room temperature in the alpha-synuclein aggregates and monomers were adsorbed.
Phosphate
buffered saline (0.05% Tween 20) solution was used to recover 100 p.IVI
triethylamine solution,
which was recovered by using a PBS-T solution. E. coli at 37 C for 1 hour,
and the infected E.
coli was painted out on a 2X YT agar medium and cultured at 37 C overnight
(pH 7.4), they
were infected by ER2537. On next day, the cultured E. coli was suspended in 4
ml of 2X YT
culture solution containing carbenicillin and 15% glycerol was added, and a
part was stored at -
80 C and the rest was used for preparing phages for next experiments. By
repeating this process
54
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
at 3 rounds in total, alpha-synuclein antigen-specific phage pool was
amplified and concentrated.
As the panning round progressed, the number of washing using PBS-T was
increased to amplify
and concentrate the antigen-specific phage.
3-3: Single clone screening
To sort monoclonal antibodies specifically binding to alpha-synuclein
aggregate from
the phage pool obtained through the panning, the experiment as follows was
performed.
To isolate monoclones from the concentrated pool, after painting out the phage
pool on a
LB-tetracycline/carbenicillin agar medium and culturing, a single colony was
secured. Then,
after inoculating monoclones on a 96-deep well plate in which 400 p2 of 2X YT-
tetracycline/carbenicillin medium was put per well and growing overnight,
10kte culture solution
was put on a new 96-deep well plate in which 390kte of 2X YT-
tetracycline/carbenicillin
medium was put and it was cultured at 37 C for 4 hours. 1mM IPTG was put into
the culture
solution and it was cultured at 30 C overnight. The culture solution cultured
overnight was
centrifuged to take a supernatant.
Then, the clones expressing a monoclone-soluble scFv which binds to alpha-
synuclein
aggregate were selected by using the ELISA method. Specifically, the selected
7B7 antibody in
Example 1-1 was put on a 96-well plate (Nunc-Immuno Plates, NUNC, USA) and it
was coated
at 4 C overnight. 3% BSA was added to each well in an amount of 200 Oõ
followed by blocking
at 37 C for 2 hours. Then, the alpha-synuclein aggregates and the monomer
were loaded at a
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
concentration of 100 ng/well reacted at 37 C for 2 hours and washed five
times with 300 u1_, of
PBS-T. The prepared single clone supernatant was mixed with 3% BSA in a volume
ratio of 1: 1
(vol: vol), and 100 pL of the solution was loaded on the plate bound to the
aggregate and the
monomer, followed by reaction at 37 C for 2 hours. The cells were washed five
times with 300
pt of PBS-T, and incubated at 37 C for 1 hour with an anti-HA HRP-conjugated
antibody,
followed by washing with PBS-T five times. After adding 100 ut of TMB
(Tetramethylbenzidine, Sigma, T0440), the reaction was stopped by adding 50 ut
of 1 N H 2 SO
4 to measure the absorbance at 450 nm. Clones with an absorbance of 0.5 or
greater were
regarded as positive reaction by binding and clones bind to BSA
nonspecifically were excluded.
The CDR residues of clones found in the library are analyzed in silico in
parallel and the
clones to cause serious problems with binding to the framework or clones that
do not have T-cell
epitope, B cell epitope, and MHCII epitope in the framework parts other than
CDR were selected.
Thereafter, the variable regions of the selected clones substituted for the
backbone
variable region of the human IgG1 isotype to prepare an IgG1 backbone
humanized antibody.
Specifically, hul 1F11 (H2L4) is an IgG-type antibody of a combination of
Hu11F11-VH2 of
SEQ ID NO: 146 and Hul 1F11-VL4 of SEQ ID NO: 148; Hul 1F11 (ver. 1) is an IgG-
type
antibody of a combination of Hu11F11-VH-v1 of SEQ ID NO: 142 and Hul 1F11-VLv3
4c of
SEQ ID NO: 147; Hul 1F11 (ver.3) is an IgG-type antibody of a combination of
Hul 1F11-VH-
v3 of SEQ ID NO: 144 and Hul 1F11-VLv3 4c of SEQ ID NO: 147; and Hul 1F11
(ver.4) is an
IgG-type antibody of a combination of Hul 1F11-VH-v4 of SEQ ID NO: 145 and Hul
1F11-
VLv3 4c of SEQ ID NO: 147.
56
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Example 4. ELISA assay of anti-alpha-synuclein antibody
Sandwich ELISA was performed to quantitatively analyze the binding affinity of
the
chimeric antibody (Chl1F11) obtained in Example 2 and the humanized antibodies
(Hul 1F11)
obtained in Example 3.
Specifically, each antibody was diluted by 1/10 to a concentration of 0.04 to
400 nM and
coated on a 96-well plate, and 2000 ng/ml aggregates were treated in each
well. After washing
with 1XPBS, biotin-conjugated capture antibody and HRP-conjugated streptavidin
were treated,
followed by reaction with TMB as a substrate, and absorbance thereof was
measured. The results
are shown in FIG. 7.
As shown in FIG. 1, it was confirmed that the humanized antibodies according
to the
present invention, particularly the humanized antibody derived from chimeric
11F11 (humanized
11F11 antibody), exhibited the binding affinity equivalent to that of the
chimeric 11F11 clone.
The humanized antibodies, especially variants derived from 11F11 such as
hullF11(ver.1)
having a combination of Hul 1F11-VH-v1 and HullF11-VLv3 4c, hullF11(ver.2)
having a
combination of HullF11-VH-v2 and HullF11-VLv3 4c, hul 1F11(ver.3) having a
combination
of Hul 1F11-VH-v3 and Hul 1F11-VLv3 4c, and hul 1F11(ver.4) having a
combination of
Hul1F11-VH-v4 and Hul1F11-VLv3 4c, showed equivalent binding affinity to the
chimeric
11F11 clone. Their EC50 values were 11.5 to 15.1 nM, which was similar to 12.5
nM of ECsoin
the chimeric 11F11.
Example 5. BIAcore analysis using anti-alpha-synuclein antibody
Many chimeric antibodies produced in Example 2 and the humanized antibodies in
57
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Example 3 were quantitatively analyzed using the binding affinities of many
humanized
antibodies.
The used instrument was T200 (GE Healthcare, S / N: 1565888). Protein A is
used as a
chip (GE Healthcare, Cat. 29-1275-56). 10 mM Glycine-HC1 pH 1.5 (GE
Healthcare, Cat. BR-
1003-54) was regeneration buffer. The running buffer, analyte dilution, and
the sample dilution
buffer were HBS-EP. The antibodies prepared in Example 2 and Example 3 were
diluted with 1
x HBS-EP (GE Healthcare, Cat. BR-1006-69), and alpha-synuclein monomer (1
mg/ml) and
fibril protein (3 mg / ml) were serially diluted in duplicate and analyzed at
6 concentrations (0,
0.39, 1.56, 6.25, 25, 100 nM) including 0 nM in total. For the capture, the
monomer was for RU
of 800 (theoretical), and a fibril was for RU of 100 (theoretical). The
capture phase was
performed at contact time of 60 seconds, a flow rate of 30 pl / min, and a
stabilization period of
180 seconds. The association phase was performed at the association time of
120 seconds and
the flow rate was 30 pl/min. The dissociation phase was performed at the
dissociation time of
360 seconds and the flow rate of 30 pl/min. The regeneration phase was
performed twice time at
the regeneration time of 240 seconds (primary) and 60 seconds (secondary) and
a flow rate of 30
pl/min. The fitting was carried out suing 1: 1 binding model, and the
evaluation software was
BIACore T200 Evaluation software (GE healthcare).
The analysis results are shown in Figs. 2a to 2c and the following Table.
[Table 12]
Clone ID KD(nM)
Chl1F11 0.02472
Hu11F11(ver.2) 0.0596
Hu11F11(ver.3) 0.0316
Hu 1 1F11(ver.4) 0.0204
58
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
As a result, the humanized antibodies in the expression, especially the
humanized
antibodies of chimeric antibody 11F11, such as hullF11 (ver.2), hullF11
(ver.3) and hul 1F11
(ver.4), showed the same KD value as chimeric antibody 11F11. The binding of
humanized
antibodies had KD of 0.02 to 0.06 X 10-9 M, and low KD of 0.02 X 10-9 M of
chimeric antibody,
which was high affinity for floating bodies.
Example 6. Production of IGF1R antibody (scFV)
6-1: Preparation of IGF1R antibody (scFV)
The monoclonal antibodies were prepared by using the phage display/panning
technique.
Specifically, the antigens used in the phage display panning and other
analysis were used as the
following proteins. The peptide consisting of 31 to 932 residues of the amino
acid sequence of
SEQ ID NO: 99, in which the signal sequence was excised from the extracellular
domain of
human IGF1R, was tagged with Histidine at C-terminus and used for this example
(R&D
Systems, USA, 391-GR). Monkey IGF1R (National Research Council Canada), mouse
IGF1R
(R&D systems, 6630-GR/CF), and rat IGF1R (National Research Council Canada)
with His tag
at C-terminus were used as an antigen for testing the interspecific cross-
reactivity.
1 X 1019 of the ScFv (Single-chain variable fragment) library cells with
diversity which
were derived from human (prepared by SHIM Hyunbo at Ehwa Womon's University)
were
inoculated in 2X YT medium [17 g of Tripton (CONDA, 1612.00), 10 g of yeast
extract
(CONDA, 1702.00) and 5 g of NaC1 (Sigma, S7653)] containing 34 jig/m1 of
chloramphenicol
(Sigma, C0857), 2% glucose (Sigma, G5400) and 5 mM MgCl2 (Sigma, C0857) at 30
C for 3
59
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
hours to be 0D600 of 0.5 to 0.7. Then, the cells were infected with a helper
phage, and cultured
in 2X YT medium containing 34 jig/ml of chloramphenicol, 5 mM MgC12, 70 jig/ml
of
kanamycin (Sigma, K1876) and 1 mM IPTG (ELPISBIO, IPTG025) at 30 C for 16
hours to
induce the phage packing. Subsequently, the culture solution was centrifuged
at 4500 rpm at
4 C for 15 minutes. The supernatant was added with 4% PEG 6000 (Fluka, 81253)
and 3%
NaCl (Sigma, S7653) and incubated for 1 hour on ice. The product was
centrifuged at 8000 rpm
for 20 minutes at 4 C, and then, the pellet was suspended in PBS and
centrifuged again at 4 C
and 12,000 rpm for 10 minutes to obtain a supernatant containing the phage
library. The obtained
supernatant was stored at 4 C until the subsequent use.
6-2: Phage display panning
In order to screen the human IGF1R antibody, the panning was performed at
three
rounds according to the following. The phage library was synthetic human scFv
library and the
procedure of phage display panning and the result were shown in Table 13.
[Table 13]
Step Panning
1 round 2 round 3 round
Antigen IGF1R ECD IGF1R ECD MCF-7 cell
(biotinylated) (biotinylated)
Coating method Indirect Indirect
Immobilization Immobilization
Input 7.0 x 1012 6.0 x 1012 5.0 x 1012
Output IGF1R or MCF-7 4.9 x 108 3.3 x 105 1.2 x 105
washing PBS-T** 5 times 10 times 10 times
PBS 2 times 2 times 2 times
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Specifically, 1 ml of recombinant human IGF1R protein at a concentration of 5
ug/ml
(R&D Systems, USA, 391-GR or Sino Biological Life Technologies, USA, 10164-
H08H-50R)
was added to an immunotube (maxisorp 444202) and coated on the surface of
immuotubu at
4 C for 16 hours. Then, the supernatant was removed and incubated with the
addition of PBS
containing 3% of BSA at 37 C for 1 hour to block the non-specific binding by
binding the BSA
to the surface unbound by IGF1R. After removing the supernatant, the phage
library prepared in
Example 11-1 mixed with BSA 1.5% solution was put into the immunotube and
reacted at 37 C
for 1 hour to allow the IGF1R specific phage to bind to antigen. Then, the
product was washed
with PBS-T solution (phosphate buffered saline-0.05% Tween 20) to remove the
phage binding
non-specifically, and the phage binding to IGF1R was collected with 100 mM
triethylamine
solution.
The collected phage was neutralized with 1M Tris buffer solution (pH 7.4) and
transfected with E.coli K12 ER2738 at 37 C for 1 hour, and the infected E.
coli was spread out
on LB agar medium containing tetracycline and carbenicillin, and cultured at
37 C overnight.
Next day, the cultured E. coli was suspended in a 5 ml of SB (superbroth)
medium containing
tetracycline and carbenicillin and was added by 50% glycerol at the same
volume. One part was
stored at -80 C, and 50 ul of product was suspended in 40 ml of SB
(superbroth) medium
containing tetracycline and carbenicillin, added with 1012 PFU of VCSM13
helper phage and
cultured with stirring at 37 C for 1 hour. Then, the culture solution was
added by Kanamycin
and cultured at 30 C for about 16 hour, so as to culture only E.coli infected
with the helper
phage.
61
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
The next day, after centrifuging the culture solution, the supernatant was
taken, and
added to a buffer containing 4% PEG8000 and 3% sodium chloride (NaCl), reacted
at 4 C for
about 1 hour, and the phage was precipitated and centrifuged. After removing
the supernatant,
the precipitated phage pool was re-suspended in PBS buffer containing 1% BSA,
and was used
for the next round of panning. As the panning round progressed, the number of
washing using
PBS-T was increased to amplify and concentrate the antigen-specific phage.
6-3: Single clone screening
The cell clones showing the binding affinity to ECD(extracellular domain) of
human
IGF1R and MCF-7 expressing IFG1R were selected.
Specifically, to select the monoclonal antibodies specifically biding to IGF1R
from the
phage pool obtained in Example 11-2, the following experiment was performed.
In order to separate the monoclones from the concentrated pool, the phage pool
obtained
on the LB-tetracycline / carbenicillin agar medium was smeared and cultured to
secure a single
colony. After inoculating these colonies in a 96-deep well plate and
incubating overnight, 10 ul
of the culture solution was re-inoculated into the 96-deep well plate and
incubated at 37 C for
about 4 hours in the same manner to obtain an appropriate OD (0.5 to 0.7).
After adding 20 MOI
helper phage to the culture solution, the mixture was reacted at 37 C for 1
hour. Thereafter,
kanamycin was added to the culture medium, and cultured overnight at 30 C. On
the next day,
the culture medium was centrifuged and the supernatant was taken to perform
ELISA to select
IGF1R-specific phage (Steinberger. Rader and Barbas III. 2000. Phage display
vectors. In: Phage
Display Laboratory Manual. 1 sted.Cold Spring Harbor Laboratory Press NY.USA.
Pp.11.9-
62
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
11.12).
100 ng of recombinant IGF1R was added to each well in an ELISA plate, and
reacted at
4 C for about 15 hours to coat the antigen on the plate. To prevent non-
specific binding, PBS
buffer containing 3% BSA was added at 200 ul per well, and then reacted at 37
C for about 1
hour. The supernatant was discarded.
100 ul of the solution containing the prepared monoclonal phage was put in
each well,
reacted at 37 C for 1 hour, and washed 3 times with 300 ul of PBS-T. To
detect the phage
bound to the IGF1R antigen, the anti-HA HRP was diluted 1: 5000 in PBS buffer
containing 3%
BSA, and reacted at 37 C for 1 hour. After washing with 300 ul of PBS-T at 3
times, 100 ul of
TMB (Tetramethylbenzidine, Sigma, T0440) was added to develop color, and 50 ul
of 1N H2504
was added to quench the reaction. By measuring the absorbance at 450 nm, the
clones with high
absorbance compared to the control group of BSA were selected as antigen-
specific antibody
clones. 1564 clones were selected by screening twice.
Example 7: Production of affinity variant of anti-IGF1R antibody
Antibodies were optimized by carrying out affinity variation for the selected
clones by
evaluating ligand binding capacity and BBB penetration ability. In the first
trial, NNS hand-mix
primers were prepared to randomize heavy chain CDR2 and light chain CDR3 based
on 1564
scFv and amplified 1564 scFv gene containing randomization sequence using PCR
technique.
The amplified gene products were inserted into the pComb3x vector to make a
library form
suitable for phage display, and a number of scFv clones binding to IGF1R could
be selected
through the library panning and ELISA screening. For the selected clones, the
amino acid
63
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
sequences of the variable region were identified through gene sequencing.
In the second trial, two mini libraries were constructed for heavy and light
chains that
introduced germline back-mutation into CDR1, CDR2, and CDR3, respectively. The
clones were
finally obtained by selecting an affinity variant based on the productivity
and antigen binding
affinity of the clones.
Example 8. Preparation of antibody variants having the deamidation residue
8-1:Deamidation residue identification
The deamidation reaction means, for example, that a symmetrical succinimide
intermediate is formed by attacking the peptide bond in the side chain of
asparagine, and this
intermediate is converted to either aspartic acid or isoaspartic acid by
hydrolysis. Particularly,
when deamidation occurs in the CDR, the antibody is degraded and becomes the
weak binding to
the antigen, which may lead to reduced efficacy and sample heterogeneity. The
sample
heterogeneity causes complexity due to its identification in clinical
approvals. Therefore, it was
intended to identify the location where deamidation occurs, through in silico
analysis and peptide
mapping, and finally, to secure stability by preventing deamidation and to
obtain superior
property and efficacy simultaneously.
As shown in Fig. 8, the occurrence of actual deamidation was identified by in
silico
analysis and peptide mapping of the parental 1564 clone. In this regards, the
samples were stored
at 4 C or 40 C for one week before analysis, and it was confirmed that
deamidation occurred in
L-CDR2, L-CDR3, and H-CDR2. The affinity variants disclosed in Example 7 were
also
analyzed to confirm the location of deamidation.
64
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
8-2: Preparation of antibody variants
The process of removing the deamidation residue was performed by substituting
with the
following residue to prepare the mutant:
1) In the amino acid sequence, Asn was replaced with D or Q being similar to
Asn. If the
mutant had no change in the binding affinity, all the residues are replaced
with Q.
2) N95a, the deamindation residue of LCDR3, was replaced with H, R, and K
having
positive charge. Clones subjected to this deamidation process are also
referred to as (de)(StoP)
deamidation clones.
3) Residues located immediately after the CDR where deamidation occurs were
substituted. These residues are relatively small and low charged residues
(e.g., glycine or serine).
Therefore, by replacing the residues with other hydrophobic residues and
relatively small size
(e.g., valine or alanine), it was attempted to minimize the difference in
binding affinity with the
parental antibody (clones before residue substitution) (Table 21). The clones
subjected to this
deamidation process are also referred to as (de2)(StoP) deamidation clones.
The table below
shows how to replace the residue next to the residue where deamidation occurs.
[Table 14]
Location CDR (Seq.) Deamidation
Substitution
at antibodies Site
Light chain 2 (A N M R P S) M51 S52V
Light chain 3 (GTWAGSL AI Ne5a G95bA
G Y V)
Heavy chain 2 (S Y D HG N) N54 G55A
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Italic character: deamidation residue;
Bold and underlined character: residue to be replaced
Example 9. Preparation of various forms of anti-IGF1R antibodies
9-1: Preparation of anti-IGF1R minibody
A minibody was prepared by connecting the whole scFv of the IGF1R specific
monoclonal phage antibody obtained in Examples 6 to 8 to the C-terminus of Fc.
To do so, the
nucleotide sequence encoding the amino acid sequence of scFV disclosed in
Table 12 was
prepared, and the nucleotide sequence was cleaved with a restriction enzyme
and cloned into a
pcDNA-based expression vector containing a nucleotide sequence encoding Fc.
9-2: Preparation of anti-IGF1R bivalent antibody
The entire scFv of the IGF1R specific monoclonal phage antibody obtained in
Examples
6 to 8 was prepared and two entire scFv were linked to each C-terminal of the
therapeutic
antibody in a IgG form to obtain bivalent antibody. To do so, the nucleotide
sequence encoding
the amino acid sequence of scFV disclosed in Table 12 was prepared, cleaved
with a restriction
enzyme, and cloned into a pcDNA-based expression vector containing a
nucleotide sequence
encoding a therapeutic antibody.
9-3: Preparation of anti-IGF1R IgG (Full-IgG) antibody
In order to convert the sequences of 1564 antibody and F06 antibody to full
IgG1 (Full
IgG) form among the IGF1R specific monoclonal phage antibodies obtained in
Examples 6 and
66
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
7, the nucleotide sequences of heavy chain and light chain regions were
synthesized (Genotec
Inc.). The synthesized genes of heavy chain and light chain were cloned into
expression vectors.
One heavy chain linked with one molecule of anti-IGF1R scFv, and the other
heavy chain having
no anti-IGF1R scFv and common light chain constituted the monovalent form of
antibody.
9-4: Preparation of anti-IGF1R scFv monovalent antibody
Example 9-2 is a minibody form in which the scFv form of anti-IGF1R antibody
is
bound to each C-terminal of the two Fc of the heavy chain. In this example,
one scFv is bound to
C-terminus of only one Fc in a heavy chain. In the form of the antibody
obtained in Examples 6
to 8, a vector in which 1564, F06, C04, VH5, VH16, VH35, VH9, VH2, VH7, and
VH32 of the
IGF1R specific monoclonal phage antibody was bound to the C-terminus of only
one Fc, and a
vector having no anti-IGF1R antibody bound to C-terminus were constructed. The
knob-into-
hole mutation was introduced into the Fc regions to produce a heteromeric
form, when producing
antibodies in cells.
9-5: Expression and purification of anti-IGF1R various antibodies
The vectors prepared in Examples 9-1 to 9-4 were introduced into cells as
follows.
Specifically, CHO-S cells were adjusted to a concentration of 1.5 x 106 cells
/ ml in CD-
CHO (Gibco, 10743) medium, and then cultured at 8% CO 2 at 37 C for 1 day. On
the day of
DNA transfection, the cells grown to 2.5 to 3 x 106 cells/ml were prepared at
a concentration of
2.1 x 106 cells / ml using CD-CHO medium containing 1% DMSO, and then were
cultured under
the condition of 8% CO2, 37 C for 3 hours. After centrifugation at 3000 rpm
for 15 minutes, the
67
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
supernatant was removed and re-suspended in RPMI 1640 medium with 2.5% FBS.
Subsequently, the combination of the vectors was diluted in Opti-MEM medium at
1 pg
per ml of medium, and PEI (Polysciences, 23966, stock concentration: 1 mg /
ml) was diluted 8
pg per ml of culture medium. After mixing the DNA and PEI mixtures and leaving
the mixture at
room temperature for 10 min, the mixture was poured in a flask containing
cells and incubated
for 4 hours at 5% CO2, 37 C, 100 rpm. Then, the mixture was cultured with
addition of CD-
CHO medium at the same volume as the culture volume and was incubated at 8%
CO2, 37 C,
110 rpm for 4 days.
The obtained culture solution was passed through an equilibration Mab
selectsure (GE
healthcare, 5 mL) equilibrated by passing with an equilibration buffer (50 mM
Tris-HC1, pH 7.5,
100 mM NaCl) to allow the expressed antibody to bind to the column.
Thereafter, after eluting
with 50 mM Na-citrate (pH 3.4) and 100 mM NaCl solution, neutralization was
performed using
1M Tris-HC1 (pH 9.0) so that the final pH was 7.2. Thereafter, the buffer
solution was
exchanged with PBS (phosphate buffered saline, pH 7.4), and when the purity
was high, it was
stored at -20 C after formulation and when the additional purification was
required, it was
stored at 4 C until further purification
When the additional purification was required, it was purified using Hiload
superdex 200
(GE Healthcare, Cat. No. 28-9893-36), and could be purified using a variety of
different size
exclusion chromatography. After equilibrating with an equilibration buffer (lx
Phosphate
buffered saline pH 7.4, Gibco, Cat. No. 10010-023), the primarily-purified
sample was loaded on
the column. The sample purified completely was stored in a frozen state at -20
C after
formulation.
68
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Example 10. Preparation of the bispecific antibody
The anti-IGF1R antibody in scFV form according to the present invention was
prepared
by linking the heavy chain variable region and the light chain variable region
by using the liker
(SEQ ID NO: 134), and was connected to C-terminus of heavy chain constant
region of the
complete form IGG of the anti-alpha-synuclein antibody by using a linker (SEQ
ID NO: 133) to
prepare the bispecific antibody. In addition, as a bispecific antibody format,
a monovalent
antibody was prepared by linking one molecule of the scFv form of the anti-
IGF1R antibody per
molecule of the IGG antibody of the anti-alpha-synuclein antibody, and the
bivalent antibody
was prepared by linking two molecules of the scFv form of the anti-IGF1R
antibody per
molecule of the IGG antibody of the anti-alpha-synuclein antibody
respectively.
Exemplary sequences of the anti-alpha-synuclein antibody used for preparing
the
bispecific antibody in this example, and the combination of the recombinant
heavy chain and
the light chain of the bispecific antibody prepared according to the present
invention are shown
in the following table 10. The specific preparation method of bivalent
bispecific antibody and
the monovalent bispecific antibody are described below.
10-1: Bivalent bispecific antibody cloning
In order to construct a bivalent bispecific antibody expression vector, an
antibody
nucleotide sequence including a signal sequence was inserted into a multi
cloning site (MCS) of
the pcDNA3.4 vector (invitrogen). The bispecific antibody expression vector
was a
69
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
monocistronic vector, and heavy chain expression vectors and light chain
expression vectors
were prepared, respectively.
As the heavy chain sequence inserted to the heavy chain expression vector, the
anti-
IGF1R scFv was linked via a linker to C-terminus of the immunoglobulin where
the heavy chain
variable region encoding the anti-alpha-synuclein antibody and the human heavy
chain constant
region were linked. As the light chain sequence inserted to the light chain
expression vector, the
light chain variable region encoding the anti-alpha-synuclein antibody and the
human light chain
constant region were linked.
10-2: Monovalent bispecific antibody cloning
Monovalent bispecific antibody was a heterodimer comprised of a heavy chain
(hole) of
an anti-alpha-synuclein immunoglobulin in which the anti-IGF1R scFv was linked
at C-terminus,
and a heavy chain (knob) of an anti-alpha-synuclein immunoglobulinin which the
scFv was not
linked, and a light chain conjugated to the heterodimer.
In order to increase the conjugation efficiency of heavy chain heterodimer,
Knob-in-hole
technique was used. That is, the coding sequence of the heavy chain in hole
type was replaced
with T366S, L368A, and Y406V in the CH3 portion, and the coding sequence of
the heavy chain
in knob type was substituted with amino acid with T366W in the CH3 portion.
10-3: Transient expression
The prepared vector was performed with maxi-prep (Qiagen) to obtain a large
amount of
plasmid DNA. Then, they were introduced into cells as follows. In order to
produce the
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
monovalent BsAb, The expression vector DNA for the heavy chain and the
expression vector
DNA for the light chain were transfected at a ratio of 1: 1. To produce
monovalent BsAb, the
expression vector DNA for the heavy chin in hole type, the expression vector
DNA for the heavy
chin in knob type, and the expression vector DNA for the light chain were
transfected at a ratio
of 0.5: 0.5: 1.
At the day before transfection, the concentration of 3 x 10E6 to 4 x 10E6
viable cells /
mL of ExpiCHO TM (Gibco, Cat: A29127) cells was adjusted in ExpiCHO TM
expression medium
(Gibco, Cat: A29100-01) medium, and then incubated at 8% CO2, 37 C and 120
rpm for 1 day.
On the day of DNA transfection, the cells grown to 7 x 10E6 to 10 x 10E6
viable cells/mL and
having survival rates of 95% or more were diluted to 6 x 106 viable cells / mL
with using fresh
medium.
In order to transfect the parent cells, ExpiFectamineTM CHO and plasmid DNA
complex
was prepared by using the ExpiFectamine TM CHO transfection kit (Gibco, Cat:
A29129). Each
of DNA and ExpiFectamine TM CHO reagents was prepared at appropriate
concentrations and
inoculated on the old OptiPRO TM SFMO (Gibco, Cat: 12309019) medium which were
dispensed and mixed to leave at room temperature for 5 minutes. The product
was inoculated
into parent cells, and began to culture after transfection. The day after
transfection, the enhancer
and feed included in the ExpiFectamine TM CHO transfection kit were inoculated
into transfected
cells, and after 5 days, the feed was additionally inoculated and incubated
for 10 days at 8% CO2,
37 C, and 120 rpm to produce the transfected cells.
10-4: Medium harvest
71
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
In order to obtain the culture solution of the completed production, the
culture medium
was transferred to a centrifuge bottle for centrifugation and centrifuged at 4
C and 6500 rpm for
30 minutes, followed by filtering with a filter having a size of 0.2 p.m to
obtain a culture medium
with removing suspended solids. Then, the obtained culture medium was used for
subsequent
purification.
Example 11. Analysis of IGF1R-specific binding affinity by using anti-IGF1R
antibody
11-1: Analysis of IGF1R-specific binding affinity by using anti-IGF1R antibody
in a
minibody form (ELISA)
The ELISA analysis was performed to test the binding affinity and the
concentration-
dependent binding of the minibody forms of the 996, 1226, 1564, and MKJP2
clones prepared in
Example 9-1 to the recombinant IGF1R,
Specifically, human recombinant IGF1R, which is an antibody-binding target, is
an
extracellular domain (ECD), was purchased from R&D systems (6630-GR/CF). Human
IGF1R
was diluted with 1 ug/ml in PBS buffer, added at an amount of 100 ul per well
in 96-well ELISA
plate (Nunc-Immuno Plates, NUNC, Rochester, NY), coated by reacting at 4 C
for 16 hours,
and then the supernatant was removed. PBS buffer containing 3% BSA (bovine
serum albumin)
was added to 200 ul per well and reacted for 2 hours to block non-specific
binding.
The minibody antibodies of the 996, 1226, 1564, and MKJP2 clones prepared in
Example 9-1 were diluted 3 times based on the highest concentration of 20 nM
to make 12 points,
and then transferred to each well 100 pl, and then treated at room temperature
for 1 hour. After
72
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
treatment, it was wash 4 times with PBS buffer containing 0.05% Tween20, and
was reacted at
room temperature for an hour by adding 100 ul of the anti-human HRP
recognizing human Fc of
the minibody diluted in blocking buffer at 1: 5000 per each well. After
washing 4 times with 300
ul of PBS-T (Tween20 0.05%), the color development was performed using TMB
(Tetramethylbenzidine, Sigma, T0440). The enzymatic reaction was quenched by
0.5 mol/L of
sulfuric acid, and the absorbance was recorded and analyzed at 450 nm using a
microplate reader.
The experimental results are shown in Fig. la.
It was confirmed that the four minibody clones were bound to the human IGF1R
recombinant protein in a concentration-dependent manner, and specifically,
MKJP2 showed the
highest binding ability, and subsequently, clones 996 and 1564 showed similar
binding strength,
and 1226 clone showed a slightly lower binding strength.
11-2: ELISA analysis of interspecific cross-reactivity of IGF1R antibodies
The interspecific cross-linking activity of the 1564 anti-IGF1R antibodies
prepared
according to the method of Example 9-2 and the anti-IGF1R antibodies obtained
in Example 6-3
were analyzed by ELISA analysis. To this end, firstly, human, monkey, mouse
and rat IGF1R
antigens were diluted to 1 ug / ml, added to each well 100 ul, and reacted at
4 C for 15 hours to
be coated on the bottom of the plate. After removing the supernatant, 200 ul
of PBS buffer
containing 3% BSA was treated in each well to block non-specific binding. The
anti-IGF1R
antibodies were diluted by 5 times in PBSB (BSA 3% in PBS) at a maximum
concentration of
400 nM, treated in each well, and reacted at 37 C for 1 hour. Then, after
washing with PBS
buffer 5 times, the anti-human Fab HRP recognizing the Fab portion of the
bound antibody was
73
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
diluted 1: 20000 was treated at 100 ul of each well, and reacted at 37 C for
1 hour. The product
was washed 5 times with PBS buffer and the color development was performed
with TMB
(Tetramethylbenzidine, Sigma, T0440) according to the manufacturer's method.
The enzymatic
reaction was quenched by 0.5 mol/L sulfuric acid, and the absorbance was
measured at 450 nm
using a microplate reader (Molecular device). When many samples are used in
the ELISA
analysis, the plates were divided into two. The experimental results are shown
in Table 15 below.
Specifically, ELISA results of bispecific antibodies to human IGF1R, ELISA
results of
1564 IgG and bispecific antibodies to human IGF1R, ELISA results of bispecific
antibodies to
mouse IGF1R, and ELISA results of bispecific antibodies to rat IGF1R ELISA
results, ELISA
results of bispecific antibodies to monkey IGF1R are summarized in in Table 15
below.
The experimental results below show the advantages of evaluating the efficacy
using
animal models of various species, and thus, efficacy of therapeutic agents can
be evaluated using
the antibody according to the present invention in disease models of various
species.
[Table 15]
ELISA analysis results of antibody binding ability to IGF1R of various species
Experiment Antibody clone Ecso(nM)
ELISA for human IGF1R chl1F11-1564 0.914
chl1F11-48G5 1.21
chl1F11-54H4 2.88
chl1F11-60H6 10
chl1F11-B11 7.13
ELISA for human IGF1R 1564 IgG 0.0823
chl1F11-1564 0.379
ELISA for mouse IGF1R chl1F11 N/A*
chl1F11-1564 3.02
chl1F11 N/A*
chl1F11-48G5 6.2
chl1F11-54H4 N/A
74
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
chl 1F11-60H6 18.6
chl1F11-B11 148
ELISA for rat IGF1R chl1F11 N/A*
chl1F11-1564 1.05
chl 1F11-48G5 2.44
chl 1F11-54H4 14.2
ch11F11-201** N/A*
chl1F11-1564 0.874
chl 1F11-60H6 38
chl1F11-B11 35.1
ELISA for monkey IGF1R chl1F11 N/A*
chl1F11-1564 2.48
chl 1F11-48G5 6.69
chl 1F11-54H4 8.83
ch11F11-201** N/A*
chl1F11-1564 2.21
chl 1F11-60H6 N/A
chl1F11-B11 180
*: not available
**201: scFv form of Herceptin biosimilar
11-3: The binding affinity analysis of the affinity variant to IGF1R (FACS)
The binding affinity of the affinity variants prepared in Example 7 was
performed by
ELISA for the ECD of IGF1R and the binding affinity for MCF-7 was analyzed by
FACS.
As an analysis for the primary clones, Table 16 shows the results of the ELISA
analysis
for the ECD of IGF1R in the bispecific antibody form of the corresponding
primary-selected
clones, and Table 17 shows the result of analyzing the binding affinity to the
MCF-7 cell line by
FACS.
[Table 16]
ELISA results of the binding of the bispecific antibody forms of primary-
selected clones
to ECD of IGF1R
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Antibody clone EC50(nM)
chl1F11-1564 0.442
chl1F11-A06 1.19
chl1F11-A07 1.2
chl1F11-B02 0.919
chl1F11-B09 1.08
chl1F11-1564 0.49
chl1F11-D03 0.666
chl1F11-E06 0.668
chl1F11-F06 0.467
chl1F11-H04(G) 0.67
Hu3A9-1564 0.144
Hu3A9-A02 0.13
Hu3A9-A07 0.125
Hu3A9-B10 0.156
Hu3A9-B01 0.145
Hu3A9-004 0.107
Hu3A9-E09 0.159
[Table 17]
Results of FACS analysis of binding to MCF-7 cell line
Samples GEOmean
2nd Ab only 2.92
1564 parental 4.09
F06 5.02
A07 5.06
B02 4.54
B09 4.29
DO3 4.09
E06 4.24
F06 6.33
CO4 3.88
As a result, F06 clone was selected as the clone having the highest binding
capacity in
cell binding compared to the parental clone (1564 clone) (affinity matured),
and C04 clone was
selected as the clone with the lowest binding capacity in cell binding
compared to the parental
1564 clone (affinity reduced).
As an analysis for secondary clones, Table 18 shows the ELISA results for the
binding
76
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
of bispecific antibody forms of clones made in the secondary production method
to the ECD of
IGF1R.
[Table 18]
ELISA results of secondary-selected clones to the ECD of IGF1R
Antibody clone EC 50(nM)
Hul 1F11(ver.2)-1564 0.259
chl1F11-1564 monovalent 0.347
Hul 1F11(ver.2)-004 0.15
Hul 1F11(ver.2)-F06 0.147
Hul 1F11(ver.2)-1564 0.864
chl1F11-F06 0.857
Hul 1F11(ver.2)-VH2 135
Hul 1F11(ver.2)-VH5 0.366
Hul 1F11(ver.2)-1564 0.157
Hul 1F11(ver.2)-VH7 402
Hul 1F11(ver.2)-VH9 6.06
Hul 1F11(ver.2)-VH16 0.236
Hul 1F11(ver.2)-1564 0.149
Hul 1F11(ver.2)-VH32 121
Hul 1F11(ver.2)-VH35 0.167
Hul 1F11(ver.2)-VH27 N/A*
The clones to be analyzed with FACS analysis were selected as shown in Table
19, after
excluding the clones having significantly lowered productivity and physical
properties among
the secondarily-produced clones.
[Table 19]
Clones to be analyzed with FACS analysis
Category of binding Antibody Explanation
affinity clone
Binding affinity similar to C04 FACS and in vivo analysis
parental 1564 clone F06 FACS and in vivo analysis
77
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
VH5 FACS and in vivo analysis
VH16 FACS and in vivo analysis
VH35 FACS and in vivo analysis
Binding affinity decreased VH9 FACS and in vivo analysis
by 50 times C12 Undesired physical properties
Binding affinity decreased VH2 FACS and in vivo analysis
by 50 times or more VH6 Undesired physical properties
VH7 FACS and in vivo analysis
VH27 Undesired physical properties
VH32 FACS and in vivo analysis
Fig. 4c is the result of analyzing the binding of the clones to the MCF-7 cell
line by
using FACS, and all of the analyzed clones had a lower binding affinity to MCF-
7 compared to
the parental clone 1564. The results show that the clones showing the
decreased binding capacity
in ELISA also showed decreased binding capacity in FACS.
The selected antibody clones are F06, C04, VH2, VHS, VH7, VH9, VH16 and VH32,
and amino acid sequences for heavy chain variable regions and light chain
variable regions for
these antibodies are shown in Tables 4 and 5 above.
Among the antibody clones, deamidation hot spots present in the VHS, VH16, and
F06
variants were removed according to Table 14 of Example 8-2 to prepare mutants,
and the
variants were prepared as bispecific antibodies according to Example 10. VHS
and VH16, were
used for preparing bivalent bispecific antibodies with hullF11 (ver.2), and
F06 was used for
preparing monovalent bispecific antibodies with hullF11 (ver.2). Using the
prepared bispecific
antibody, three variants of VHS, VH16 and F06 (i.e., hul 1f11-F06, hullf11-
VHS, hullF11-
VH16 as bispecific antibodies) and deamidated mutants (i.e., hul 1f11-
F06(de2)(StoP), hul 1f11-
78
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
VH5(de2)(StoP), hullF11-VH16(de2)(StoP) as bispecific antibodies) were
analyzed for binding
to MCF-7 according to the above FACS analysis method. The components of the
bispecific
antibodies are described in Table 10, and the substitution of the deamidation
site of these
antibodies is described in Table 14 of Example 8-2.
The FACS analysis results are shown in Table 20 below. It was confirmed that
the
binding affinity of all three deamidated mutants (hul 1f11-F06(de2)(StoP), hul
1f11-
VH5(de2)(StoP), hullF11-VH16(de2)(StoP)) did not decreased compared to
parental antibodies
(VH5, VH16, F06).
[Table 20]
WT (de2)(StoP)
Binding affinity %
Variant
MFI MFI to binding affinity
of WT
F06 (de2)(StoP) 9.61 8.61 89.59
VH5(de2)(StoP) 6.44 8.03 124.69
VH16
6.13 6.42 104.73
(de2)(StoP)
* MFI = mean fluorescence intensity
Negative control (2ndary Ab only)'s MFI: 2.29
Using the bispecific antibodies prepared above, the binding ability of three
variants of
VH5, VH16 and F06 and their deamidated mutants to human IGF1R protein were
analyzed by
ELISA according to the method of Example 15-2. The results are shown in the
following table. It
was confirmed that the binding affinity of all three mutants did not decrease
compared to the
parental antibody.
[Table 21]
Variant WT (de2)(StoP)
79
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
EC50 (nM) EC50 (nM) % WT
F06 (de2)(StoP) 0.112 0.0575 195
VH5 (de2)(StoP) 0.125 0.0561 222.81
VH16
(de2)(StoP) 0.143 0.122 117.21
11-4: BIAcore analysis for Human IGF1R
The binding capacity of the antibody according to the present invention to
human IGF1R
was analyzed.
For the IgG form of the 1564 clone, the degree of binding to human IGF1R was
analyzed by SPR analysis. The anti-his antibody against the His tag bound to
the human IGF1R
ECD as an antigen was diluted to 20 jig/ml in acetate pH4.0 buffer, and then
immobilized in the
reference/analytic channel of the CM4 chip to 10,000 RU as a target RU
according to the amine
coupling method. During capture, PBS was used as a running buffer, and the
flow rate was
maintained at 30 pt/min. During association/dissociation, the flow rate was 40
pL/min, and PBS
was used as the running buffer. The association/dissociation was 5 minutes and
20 minutes,
respectively. The analysis was performed in the order of baseline 1,
activation (EDC NHS),
human IGF1R loading, quenching (1 M Ethanolamine), baseline 2, association,
and dissociation.
Evaluation was performed using a bivalent model, and analyzed using Biacore
T200 Evaluation
software (version 1.0, S / N: 04Y15X11-0149).
As a result of the analysis, the KB of the 1564 IgG antibody was confirmed to
be 2.5305
x 10-9 nM, and the F06 IgG antibody was confirmed to be 4.7802 x 10-7 nM, all
of which showed
high binding ability to human IGF1R. The results of the analysis are shown in
FIG. 11b. In
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
particular, when the 1564 clone was produced in the form of IgG, the 1564
clone showed
dissociation constant of 2.5305 x 10-9 nM to the human IGF1R, and the 1564
clone confirmed
that there was no significant change in binding affinity depending on the
forms of antibodies.
Example 12. Binding ability analysis for anti-IGF1R antibody to cell line
expressing human IGF1R and brain endothelial cells
12-1: FACS analysis for MCF-7
To confirm whether the minibody forms of clones 996, 1226, and 1564 prepared
in
Example 9-1 bind to endogenous IGF1R on the cell surface, the binding affinity
analysis weas
performed for cell lines expressing human IGF1R and brain endothelial cells by
FACS. The
degree of binding to MCF-7, which is known as a breast cancer cell line to
overexpress IGF1R,
was tested by FACS.
Specifically, each of the three minibody was diluted to 20 ug/ml, treated to
0.43 x 10E6
of the MCF-7 cell lines per sample, and reacted at 4 C for 1 hour. After
washing twice with PBS
buffer, the anti-human FITC was diluted at 1: 500, treated and reacted at 4 C
for 1 hour. After
washing twice with PBS buffer, the binding degrees of the anti-IGF1R
minibodies were
measured using a FACS Calibur instrument. MCF-7 cells treated with only
secondary antibodies
were used as a control. The experimental results are shown in Fig. 4a.
A02, A06, A07, B01, B02, B09, B10, C04, D03, E06, F06, H04 (Gly), H04 (Val),
VH2,
VHS, VH7, VH9, VH16, VH32 and VH35 prepared in Example 7 and Example 9-2 were
analyzed for their binding affinity to MCF-7 in the same manner as above.
Clone 1564 were
prepared by the method of Example 14-2 and compared as parental clones, and
MCF-7 cells
81
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
treated with only secondary antibodies were used as controls. The analysis
results are shown in
Fig. 4c.
According to the results of the above experiment, it was expressed as Mean
Fluorescence Intensity (MFI) of the sample, and the scFV in three minibodies,
the affinity
variants in the bispecific antibodies and the parental clone (1564 clone)
bound specifically to the
endogenous IGF1R expressed on the cell surface. The result shows that the
clones obtained in
the above examples can be used for the intended purpose by binding to IGF1R in
a form actually
present in the body.
12-2: FACS analysis for JIMT-1 and BT474
The minibodies of clones 996, 1226, and 1564 prepared in Example 12-1 in
substantially
the same manner, except that JIMT-1 and BT474 of breast cancer cell lines were
used instead of
the MCF-7 cell lines used in Example 14-1. The morphology was confirmed to
bind to the
endogenous IGF1R on the cell surface. The experimental results are shown in
Fig. 4a.
According to the above experimental results, it was expressed as Mean
Fluorescence
Intensity (MFI) of the corresponding sample, and it was confirmed that scFvs
in the tested three
minibodies specifically bound to endogenous IGF1R on the surface of various
cell lines
expressing IGF1R.
12-3: FACS analysis of mouse brain endothelial cells
It was analyzed whether the bispecific antibody form of the 1564 clone
prepared by the
method of Example 9-2 and the IgG form of the 1564 clone prepared by the
Example 14-3
82
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
method bound to bEND.3 of the brain endothelial cell. In this regards, the
group treated only
the secondary antibody and the group treated with only therapeutic antibody in
IgG form
(CH11F11) were used as negative controls. FACS analysis was performed in the
same manner
as in Examples 12-1 and 12-2. The analysis results are shown in Fig. 4b.
All tested clones showed the binding to bEND.3 except the negative controls.
The
results confirmed that various forms of clone 1564 specifically bound to IGF1R
expressed on
the surface of brain endothelial cells.
Example 13. Intracellular internalization analysis of anti-IGF1R antibody
13-1: MCF-7 internalization assay ¨ 1564, 996, 1226, MKJP2 (minibody)
The example was carried out to test whether the minibody forms of the 996,
1226, 1564,
and MKJP2 clones prepared in Example 9-1 were intracellularly internalized in
a cell line
expressing IGF1R, and the antibody introduced into the cell was passed through
the RMT
Pathway without being degradation. In order that the anti-IGF1R antibody is
used as a shuttle to
improve BBB-penetrating capacity, the antibody should be internalized into
brain endothelial
cells constituting BBB.
The intracellular internalization of the antibodies according to the present
invention was
tested by using the MCF-7 cell line expressing IGF1R. Specifically, after
plating 30,000 MCF-7
cell lines in an 8-well slide chamber, the cells were cultured for 1 day. The
cultured cell lines
were treated in each well at 4 C for 2 hours with 5 jig/m1 of minibody
antibodies of the 996,
1226, 1564 and MKJP2 clones prepared in Example 9-1, washed three times with
cold DMEM
culture, and also treated with Alexa488-conjugated anti -human Fc antibody at
4 C for 1 hour.
83
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
To test the internalization of the antibody complex, the plate was transferred
to a CO2
incubator and incubated at 37 C for 30 minutes. The culture was fixed by
adding 100%
methanol and the reaction was terminated simultaneously. After fixation, it
was washed 3 times
with PBS. On the fluorescence microscope, the internalization degree of the
antibody was
imaged in the green filter region (Alexa488). In the imaging process, the
nuclei inside cells were
stained using DAPI to confirm the location of each cell. The experimental
results are shown in
Fig. 5a.
From the experimental results, all four antibodies tested in the experiment
using the
MCF-7 cell line were shown to be internalized well. In particular, it was
found that the
internalization of MKJP2 and 1564 occurred more than other clones.
13-2: MCF-7 internalization assay - C04, F06, VH5, VH16, VH35, VH9, VH2, VH7,
VH32
1564 variants having the change in binding capacity to IGF1R were tested or
the IGF1R
binding on the cell surface by FACS analysis using MCF-7 cell line expressing
IGF1R. 2 x
10E5 MCF7 cells were treated with the bispecific antibody made by the scFv
anti-IGF1R
antibody at a concentration of10 ug/mL for 30 minutes. After washing with PBS
buffer
containing 1% BSA, the secondary antibody bound with FITC to detect human
antibodies was
treated for 1 hour. After washing with PBS buffer, FACS analysis confirmed the
extracellular
binding and internalization of various variants with the changed binding
affinity.
As shown in Table 22, the bispecific antibody including 1564 IGF1R antibody
was
found to have an increased internalization and an increased intensity at 37 C
than the
84
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
refrigerated condition. These results suggest that the 1564 variants bind well
to cells and
internalize into the cells in a binding-dependent manner.
[Table 22]
GeoMean
Sample
Internalization at 37 C
Not Treated 1.88
2nd Ab only 2.86
hu3A9 WT 3.4
hu3A9x1564 WT 7.72
hul 1F11 WT 3.18
hu11F11x1564 WT 7.34
hu3A9x1564 CO4 7.23
hu3A9x1564 F06 19.8
hu11F11x1564 VHS 6.1
hullF11x1564 VH16 5.83
hu11F11x1564 VH35 7.28
hu11F11x1564 VH9 5.01
hu11F11x1564 VH2 3.19
hu11F11x1564 VH7 3.84
hu11F11x1564 VH32 3.24
13-3: Internalization analysis to human brain endothelial cells
It was tested whether the bivalent form and the monovalent form of the clone
1564
prepared in Examples 9-2 and 9-4 were internalized into primary human
microvascular brain
endothelial cells (HMBEC). The therapeutic antibody IgG (11F11) was used as a
negative
control.
HMBEC (Cell Systems, cat #: ACBRI376) was plated in a 12-well plate at 90%
confluency, and followed by test antibody After fixing with 4%
paraformaldehyde and rinsing
with PBS on next day, the blocking and permeabilizing were performed by using
a solution
containing 3% BSA and TritonX for 50 minutes. After rinsing with PBS, an
antibody against
human Fc (Goat anti-human antibody) was incubated for 2 hours and 30 minutes,
rinsed with
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
PBS, and treated with a secondary antibody against the corresponding primary
antibody for 1
hour. After rinsing with PBS, the cells were stained by Hoechst for 10 minutes
at a concentration
of 1: 1000 for nuclear staining. The result was analyzed under the condition
of LSM 780 NLO
EC Plan-Neofluar 100X / 1.3 Oil with a confocal microscope. The experimental
results are
shown in Fig. 5b.
The bivalent form and the monovalent form of the 1564 clone showed an
increased
internalization compared to the negative control therapeutic antibody (11F11).
This result shows
that the anti-IGF1R antibody described above can effectively internalize the
therapeutic antibody
into brain endothelial cells constituting BBB, as various forms of bispecific
antibodies
containing a therapeutic antibody linked to it, thereby increasing BBB-
penetrating ability of the
therapeutic antibody.
13-4: Analysis of cellular fate in human brain endothelial cells
If the antibody is internalized and co-localized with a lysosome-related
marker in the
cell, the antibody cannot pass through the BBB due to the degradation in the
brain endothelial
cell. In contrast, if the antibody is co-localized with an early endosome
associated with
exocytosis or a marker known to be associated with BBB passage, the antibody
is expected to
cross the BBB by receptor-mediated transcytosis that is internalized into
brain endothelial cells
and then exits into the brain.
After treating HMBEC in the same manner with the 1564 bivalent form among the
antibodies tested in Example 13-2, it was analyzed which cellular component in
these cells co-
86
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
localize with these antibodies. However, each of the following antibodies was
treated
simultaneously with Goat anti-human antibodies that detect the treated
antibodies after blocking
and permeabilization.
- Anti-Cathepsin D: lysosomal marker
- Anti-Caveolin-1: caveolin-mediated transcytosis marker (which is thought
to be the
main mechanism of BBB passage
- Anti-EEAl: early endosome marker
The remaining parts of the methods were the same as in Example 13-2, but the
secondary antibodies to the markers were treated respectively.
The analysis results are shown in Fig. 5c. The 1564 clone in the bispecific
antibody form
did not co-localize with Cathepsin D, but co-localized with caveolin-1 and
EEA1 inside the cell
membrane and cells. These results indicate that after the 1564 clone was
internalized, it was
possible to pass BBB through RMT pathway without going through the
intracellular degradation
mechanism.
Example 14. Analysis of the effect of anti-IGF1R antibody on IGF1R signaling
14-1: Proliferation assay of MCF-7 cell line by using IGF1R
Whether the anti-IGF1R antibody according to the present invention interferes
with the
binding between IGF1R (IGF1 receptor) and its ligand was confirmed using cell
proliferation
efficacy by IGF1.
The minibody antibodies of the 996, 1226, 1564 and MKJP2 clones prepared in
87
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Example 9-1 were diluted 5 times from 400 nM, respectively, to prepare diluted
samples, and
then 25 pl of the diluted samples were treated with 25 pl of 20 ng/ml IGF1,
respectively. The
MCF-7 cell lines expressing IGF1R was cultured, and passaged by removing the
medium on the
day of the experiment, and 20,000 cell lines of each well (corresponding to 50
pl) were added to
a 96 well plate in which IGF1 and test antibody were dispensed.
After incubating at an appropriate temperature and humidity for 3 days, 10 pi
of CCK-8
reagent was treated in order to measure the degree of cell growth, and
incubated in a CO2
incubator for 4-5 hours. Then, it was taken out and the absorbance was
measured at a wavelength
of 450 nm with the spectrophotomer. The experimental results are shown in Fig.
6a.
According to the experimental results, it was confirmed that the antibody
according to
the present invention did not inhibit the cell proliferation of MCF-7 caused
by the signaling of
IGF1 to IGF1R. The anti-IGF1R antibody (Imclone) as a control group inhibited
the cell
proliferation of MCF-7 by IGF1 signaling to IGF1R in the treating-
concentration dependent
manner. Therefore, the antibody of the present invention is an antibody having
the ability
binding to IGF1R expressed in endothelial cells constituting BBB and
penetrating BBB, but does
not inhibit signaling by IGF1 in the body. Thus, it was confirmed that the
antibody according to
the present invention could be used as a BBB shuttle.
14-2: Analysis for IGF1R inhibition of signaling component in MCF-7 cell line
When IGF1 binding to the cells expressing IGF1R delivered the signaling into
cells, the
anti-IGF1R antibody according to the present invention was tested to determine
whether IGF1
was involved in the receptor and downstream signaling component of the
signaling, That is, anti-
88
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
IGF1R antibody was treated to the MCF-7 cell lines expressing IGF1R, and then
total IGF1R,
phosphorylated IGF1R, total Ala as downstream factors of IGF1R, and
phosphorylated Ala
amount in the cells were analyzed.
After culturing MCF-7 cells, the culture medium was changed to a serum-free
culture
medium at 20 hours before treatment with the anti-IGF1R antibody. The minibody
antibodies of
996, 1226, 1564 and MKJP2 clones prepared in Example 4-1 were treated with 100
nM in the
MCF-7 cell lines, respectively and treated with 200 ng/ml of IGF1 after 1
hour. After 20 minutes,
the cells were washed with PBS and then lysed with M-PER added by protease and
phosphatase
inhibitor cocktail. After measuring the protein concentration using the BCA
assay kit, 12.5 pg of
protein was loaded onto an SDS-PAGE gel for electrophoresis, and then
transferred to a PVDF
membrane. The blocking was performed at room temperature with gentle shaking
for 1 hour with
PBST (0.1% Tween 20) containing 5% BSA, and then the primary antibody against
IGF1R or
Akt was treated with slow shaking at 4 C overnight. Beta-actin antibody was
used as a loading
control. After washing, the secondary antibody was treated with shaking slowly
at room
temperature for 1 hour, and then washed. ECL solution was added, and signals
were observed
using Image Quant Las 4000. The experimental results are shown in Fig. 6b.
According to the experimental results, it was confirmed that the antibody
according to
the present invention did not affect the total IGF1R, phosphorylated IGF1R,
total Akt as a
downstream factor of IGF1R, and the amount of phosphorylated Ala in the cells.
14-3: Analysis for IGF1R inhibition of signaling component in mouse brain
endothelial
cells
89
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
When IGF1 binding to the cells expressing IGF1R delivered the signaling into
cells, the
anti-IGF1R antibody according to the present invention was tested to determine
whether IGF1
was involved in the receptor and downstream signaling component of the
signaling, That is,
11F11-1564 and 3A9-1564 CH11F11 and ch3A9, alpha-synuclein monospecific
antibodies
described in Korean Patent Publication No. 2018-0081465) produced by the
method of Example
9-2 and 1564 clone in IgG form produced by the method of Example 9-3 were
treated to the
bEND3 cell lines expressing IGF1R, and then total IGF1R, phosphorylated IGF
1R, total Akt as
downstream factors of IGF1R, and phosphorylated Ala amount in the cells were
analyzed.
While incubating the bEND3 cells, the culture medium was changed to a serum-
free
culture medium at 20 hours before treatment with the anti-IGF1R antibody. The
bispecific
antibodies of the 1564 and MKJP2 clones of Example 14-2 were treated
respectively with 100
nM in the bEND cell line and treated with 200 ng/ml of IGF1 after 1 hour.
After 20 minutes, the
cells were washed with PBS and then lysed with M-PER added by protease and
phosphatase
inhibitor cocktail. After measuring the protein concentration using the BCA
assay kit, 12.5 pg of
protein was loaded onto an SDS-PAGE gel for electrophoresis, and then
transferred to a PVDF
membrane. The blocking was performed at room temperature with gentle shaking
for 1 hour with
PBST (0.1% Tween 20) containing 5% BSA, and then the primary antibody against
IGF1R or
Akt was treated with slow shaking at 4 C overnight. Beta-actin antibody was
used as a loading
control. After washing, the secondary antibody was treated with shaking slowly
at room
temperature for 1 hour, and then washed. ECL solution was added, and signals
were observed
using Image Quant Las 4000. The experimental results are shown in Fig. 6c.
According to the experimental results, it was confirmed that the antibody
according to
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
the present invention did not affect the total IGF1R, phosphorylated IGF1R,
total Akt as a
downstream factor of IGF1R, and the amount of phosphorylated Ala in the cells.
Example 15. Analysis for in vivo BBB-penetrating ability of anti-IGF1R
antibody
(co-localization assay)
15-1. Minibody co-localization with brain vessel
The following experiment was conducted to confirm whether the anti-IGF1R
antibodies
of the present invention were distributed along the brain vasculature in vivo.
Specifically, PBS buffer or 10 mg/kg of IgG control, and the minibody
antibodies of
clones 996, 1226, and 1564 prepared in Example 14-1 were administered to the
tail vein of a 6-8
week old BALB/c male mouse, respectively. After 4 hours, the mouse brain was
intracardially
perfused with a sufficient amount of 0.9% NaCl solution and 4%
paraformaldehyde. The fixed
brain was extracted and sectioned at 20 pm, and co-staining was performed with
anti-mouse
CD31 as a vascular marker, and anti-human Fc antibodies, to confirm co-
localization of the brain
vessels and the tested IGF1R. A secondary antibody conjugated with Alexa 488
for CD31, and
the secondary antibody conjugated with Alexa 594 for human Fc were used for
imaging CD31
and human Fc under a fluorescence microscope. The experimental results are
shown in Fig. 7a.
According to the experimental results, it was confirmed that the non-blocking
antibodies
for the ligand binding according to the present invention had an excellent BBB-
penetrating
ability. As a result of the staining the brain tissues with vascular markers
(anti-CD31, green) and
human antibodies (anti-human Fc, red) according to the method of analyzing the
antibody co-
localization degree with cerebral blood vessels by immunostaining (Neuron
(2016) Yu-Zuchero
91
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
et al.), the non-blocking antibodies for the ligand binding according to the
present invention
showed a higher degree of co-localization than the IgG control group.
15-2. Analysis for in vivo BBB-penetrating ability of bispecific antibody
The anti-IGF1R antibody of the present invention was attempted to confirm in
vivo
BBB-penetrating ability in normal rats. PBS buffer or 10 mg/kg of IgG control,
and therapeutic
antibody for Parkinson's disease (11F11) or the bivalent bispecific antibody
(11F11-1564)
containing 1564 clone linked to the therapeutic antibody were administered to
the tail vein of SD
rats, respectively. At 24 hours, the amounts of antibodies in CSF and brain
were analyzed by the
mass spectrometry. The mass spectrometry was performed as the same method as
Example 20-1.
The bispecific antibody to which the 1564 clone was bound showed higher CSF
and
brain penetration ability than the therapeutic antibody to which the anti-
IGF1R antibody was not
bound, and the efficacy was confirmed at both 10 and 30 mg/kg doses. The
bispecific antibody
showed the brain-penetrating ability up to about 4.5 times higher than the
monospecific antibody
at 30 mg/kg dose.
Clone 1564 were prepared in bivalent form and monovalent form according to
Examples
9-2 and 9-4, and then administered at 30 mg/kg or 60 mg/kg in the same manner
as described
above, and the amounts of antibodies in CSF and brain were analyzed after 24
hours. The two
types of bispecific antibodies bound to 1564 clone showed higher CSF and brain
penetration
ability than monospecific antibodies. In particular, the bivalent form showed
a higher BBB
penetration ability than the monovalent form, which was increased brain-
penetrating ability up to
5-fold.
92
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
The results of FIG. 7b and FIG. 7c show that 1564 clone improves the BBB-
penetrating
ability of the therapeutic antibody in the body even when bound to the
therapeutic antibody in
various forms.
The affinity variants of 1564 clone prepared according to Example 2 were
expected to
increase PK in a serum compared to the parental clone. Therefore, it was
expected that the BBB-
penetrating ability would be improved by remaining in the serum for a long
time and
continuously maintaining the BBB influx. After the affinity variants produced
in bivalent form
according to Example 9-2 or monovalent form according to Example 9-4 was
administered
intravenously to SD rats at 30 mg/kg, the blood was collected from the eye
vein gun at 0, 24 and
48 hours. The tested antibodies were divided into two experiments according to
the backbone of
the therapeutic antibody. The bispecific antibodies of the corresponding
variants used in the
experiment are shown in the following Table.
[Table 23]
Bispecific antibodies used for in vivo BBB penetration analysis
Chimeric backbone clones Humanized Backbone clones
Chl1F 11-1564 bivalent Hu 1 1F11(ver.2)-1564 bivalent
Chl1F 11-1564 monovalent HullF11(ver.2)-VH5 bivalent
Chl1F 11-004 monovalent HullF11(ver.2)-VH16 bivalent
Chl1F 11-F06 bivalent HullF11(ver.2)-VH35 bivalent
Chl1F 11-F06 monovalent HullF11(ver.2)-VH9 bivalent
** HullF11(ver.2)-VH2 bivalent
** HullF11(ver.2)-VH7 bivalent
** HullF11(ver.2)-VH32 bivalent
The blood levels of antibodies were analyzed by ELISA. After the goat anti-
human Fc
antibody was coated on a 96-well plate, an appropriate amount of the diluted
sample was treated
93
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
and then detected with an antibody conjugated with an anti-human Fab HRP. The
analysis results
are shown in Fig. 7d and Fig. 7e.
As a result, in the first test group, the monovalent form of 1564, the
monovalent form of
F06, and the monovalent from of C04 showed longer serum PK than bivalent of
the parental
1564 clone. In the second test group, the bivalent forms of VH2, VH5, VH7,
VH9, VH16, and
VH32 except for the VH35 showed an increased serum PK compared to the parental
1564
bivalent.
In order to analyze the BBB-penetrating ability of the groups, CSF was
extracted from
the rats at 48 hours and analyzed by the same ELISA method. The analysis
results are shown in
Fig. 7f.
In the first test group, 1564 monovalent, F06 monovalent, and C04 monovalent
forms
showing an increased serum PK showed increased CSF antibody compared to
parental 1564
bivalent. In the second test group, the bivalents of VH2, VHS, VH7, VH9, VH16,
and VH32,
which also showed an increased serum PK, showed an increased CSF antibody
compared to
parental 1564 bivalent. VH35 showed shorter serum PK and low CSF antibody
level compared
to parental 1564 bivalent.
The results of Fig. 7d, Fig. 7e and Fig. 7f showed that serum PK was an
important factor
in the BBB-penetrating ability of the antibody due to the continuous BBB
influx of the antibody,
and that the BBB-penetrating abilities of bispecific antibodies having BBB
shuttle and serum PK
increased. In particular, in the case of F06 monovalent form with the highest
CSF antibody level,
it showed about 5-fold higher CSF-penetrating ability than the parental 1564
bivalent. In
Examples 18-2 and 18-3, since 1564 bivalent antibody showed about 3-fold
higher CSF-
94
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
penetrating ability than the monospecific antibody in CSF, it was expected
that F06 monovalent
form would show a up to about 15-fold higher BBB-penetrating ability than the
monospecific
antibody.
Example 16. Epitope mapping of anti-IGF1R antibodies
16-1. ELISA analysis of anti-IGF1R antibody, boiled IGF1R protein and native
IGF1R
protein
This example attempted to confirm whether the anti-IGF1R antibody recognizes a
linear
epitope or conformational epitope. ELISA was performed with the bivalent
bispecific antibodies
of 1564, 48G5, 54H4, 60H6, and B11 and ECD protein of native human IGF1R or a
heated
protein (boiled IGF1R). The ELISA method was performed as the same as that
shown in
Example 11. The analysis results are shown in the following table.
[Table 24]
Clone ID EC50(nM) for native EC50(nM) for boiled
IGF1R IFG1R
chl1F11-1564 0.914 N/A*
chl1F11-48G5 1.21 N/A
chl1F11-54H4 2.88 N/A
chl1F11-60H6 10 N/A
chl1F11-B11 7.13 410
*N/A: Not available
The clones showed similar binding to ECD protein of native human IGF1R as in
Example 15, but did not bind to ECD protein of boiled human IGF1 of which the
tertiary
structure was destroyed by applying heat. This means that the anti-IGF1R
antibody of the present
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
invention binds to a conformational epitope, but not a linear epitope.
16-2. Epitope mapping of anti-IGF1R antibody
To analyze the conformational epitope of 1564 clone, alanine scanning was
performed as
follows. The OGFAR3 cell, an ovarian cancer cell line confirmed to have low
IGF1R expression,
was made to express the IGF1R library in which an eGFP tag was fused at N-
terminus and the
C-terminal kinase domain was removed. The IGF1R library contains the mutations
in which the
residues on the IGF1R surface are substituted with alanine. The prepared
library was transfected
into OVCAR3 cells. The cells identified with IGF1R expression were treated
with 1564 antibody,
and then labeled fluorescently by being treated with a secondary antibody
labeled with
DyLight650. The labeled cells were classified according to the presence or
absence of IGF1R
expression, the expression of IGF1R, and the presence or absence of 1564
binding, and the RNA
deep sequencing was performed by using the Illumina HiSeq technique to analyze
the frequency
of each alanine mutation in the corresponding cell group. The corresponding
frequency was
normalized as a result for cells expressing wild-type IGF1R, and then the
relative frequency was
calculated to select the mutations whose number decreased in the 1564-labeled
cell group. Based
on this observation, it was found that the epitope of 1564 clone was located
in the FN2 domain,
and the residues belonging to it were Y775, P776, F778, R650, S791, and L798.
The results and
the sequences recognized by the 1564 clone are shown in FIG. 9. Since these
residues are not
known to involve in the binding of IGF1 according to the prior literature, the
results faithfully
describe the properties of 1564 clone in Example 16-1.
96
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Example 17. Comparison of antigen binding affinities of monospecific antibody
and
bispecific antibody
17-1: Binding affinities of monospecific antibody and bispecific antibody to
alpha-
synuclein antigen
When the scFv form of IGF1R antibody was linked to the alpha-synuclein
antibody in
IgG type, the effect on the binding affinity of the alpha-synuclein antibody
was analyzed.
The alpha-synuclein aggregates were coated on a 96-well plate at a
concentration of 1
ug/ml for 18 hours, and after washing, was treated with each antibody by
diluting by 5 times
from 400 nM. The bound antibodies were bound to anti-human Fc-HRP and then
performed by
color development with TMB solution, to measure the degree of binding of the
antibody.
As shown in Fig. 10a, it was confirmed that the binding affinity to alpha-
synuclein
aggregates were the same in the monospecific antibody and the bispecific
antibody.
17-2: Binding affinities of monospecific antibody and bispecific antibody to
IGF1R
antigen
To compare the binding degrees of the single alpha-synuclein antibody and the
bispecific
antibody to the IGF1R antigen, the experiment was performed in the same manner
as in Example
22.
As shown in FIG. 10b, it was confirmed that the bispecific antibody having the
scFv form
of IGF1R antibody bound well in a concentration-dependent manner, but the
monospecific
antibody having no IGF1R antibody region did not bind.
97
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
17-3: Analysis of binding ability of a humanized alpha-synuclein antibody
The difference in binding affinity between the bispecific chimeric antibody
and the
bispecific humanized antibody was analyzed by performing the experiment in the
same manner
as in Example 17-1.
As shown in FIG. 10c, the bispecific humanized antibodies had binding
affinities to
alpha-synuclein aggregates at a level similar to those of bispecific chimeric
antibody, and it was
confirmed that monovalent bispecific antibody with one scFv of IGF1R also
exhibited the
binding affinities at a level similar to chimeric antibodies.
As a result of analyzing the binding affinities to IGF1R between the
bispecific chimeric
antibody and the bispecific humanized antibody by performing the experiment in
the same
manner as in Example17-2, all bispecific antibodies represented the same
binding affinity, but
the monospecific antibody having no IGF1R scFv did not bind, as shown in FIG.
10d.
These results suggest that it has the same activity and no change in the
binding affinity to
alpha-synuclein aggregates and IGF1R, when it is humanized to replace the
mouse antibody
region acting as an immunogen in the human body.
17-4: Comparison of phagocytosis of the monospecific antibody and the
bispecific
antibody
Phagocytosis refers to the action of removing extracellular substances by
involving in
various receptors of macrophages. Various protein aggregates induce an immune
response or an
inflammatory reaction, which adversely affects the human body. Particularly,
it is known that it
is promoted through the interaction between the Fc region of the antibody and
FcrR on the cell
98
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
surface, when the antibody is administered to remove the alpha-synuclein
aggregates. For this
reason, the activity against phagocytosis of a monospecific antibody and a
bispecific antibody
liked with IGF1R scFv was compared.
BV-2 microglial cells derived from mouse were used to compare phagocytosis
between
the monospecific antibody and the bispecific antibody. BV-2 cells were
cultured in RPMI1640
medium, prepared at a concentration of 2 x 106 cells/ml, and dispensed at 100
uL in U-bottom 96
well plates. 10 ug/ml of alpha-synuclein aggregates and 25 ug/ml of antibodies
were diluted with
RPMI1640 medium, mixed, and left at room temperature for 20 minutes. The
mixture of alpha-
synuclein aggregates and antibodies were treated with BV-2 cells and left for
15 minutes. The
alpha-synuclein aggregates in the supernatant were removed by centrifugation
at 1200 rpm, and
washed three times with PBS buffer (pH2.5) to remove aggregates or antibodies
bound to the
cell surface. The cells were fixed with 4% paraformaldehyde and washed with
PBS buffer. To
confirm the phagocytosis of aggregates and antibodies into the cells, 0.5%
triton X-100 was
added to loosen the cell membrane, washed with PBS buffer, and treated with
pan-alpha-
synuclein antibody for 1 hour. The bound pan-alpha-synuclein antibody was
treated with an anti-
rabbit-alexa-488 antibody for 1 hour, and then FACS analysis confirmed the
aggregates entering
into the cell by macrophage.
As shown in FIG. 10e, it was confirmed that the normal human IgG did not
affect
macrophage and the phagocytosis of alpha-synuclein aggregates was increased,
when treating
with the alpha-synuclein antibody. When the monospecific antibody and the
bispecific antibody
were compared, it was confirmed that the phagocytosis occurred at a similar
level, and that the
scFv form of IGF1R antibody bound to C-terminus of the IgG did not affect the
action of the
99
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
alpha-synuclein antibody.
Example 18. Evaluation of efficacy of bispecific antibody
According to Example 10, the bivalent bispecific antibody comprised of
chimeric 11F11
antibody and scFv of 1564 clone was prepared, and the bispecific antibody and
the single alpha-
synuclein antibody were tested for in vivo efficacy in a transgenic mouse
(mThy-1 human a-
synuclein, UC San Diego) overexpressing human alpha-synuclein. 2.5 mg/kg of
the
monospecific antibody or human IgG, or the same mole of the bivalent
bispecific antibodies
were administered intraperitoneally weekly for 3 months. Five mice per a group
were used, and
non-transgenic littermate was used as a control. Subsequently, perfusion was
performed as
follows.
After the last administration was completed, the animals were anesthetized
with chloral
hydrate under humanitarian regulations and then perfused with 0.9%
physiological saline, for the
analysis of pathology in the brain. Subsequently, one half (sagittal section)
of perfused brain was
stored in 4% paraformaldehyde (pH7.4, 4 C) in phosphate buffer until the
analysis time, and the
other half was immediately frozen (-70 C).
The pathological analysis was conducted as follows. The half brain fixed to
paraformaldehyde was cut into continuous sections at 40 p.m thickness by free-
floating using a
vibrometer. To confirm the expression level of alpha-synuclein in the brain of
each
administration group, the sections containing cortex, hippocampus and striatum
were incubated
with alpha-synuclein antibodies (p129 cc-syn antibody of aggregate marker,
abcam, ab59264, or
whole alpha-synuclein antibodies) at 4 C overnight. Alternatively, in order
to analyze the
activity degree of astrocytes, the sections were analyzed for GFAP (glial
fibrillary acidic protein)
100
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
(AB5804, millipore) or in order to analyze the neuro-inflammation degree, the
sections were
incubated with an antibody to IL-1(3 (ab9722, abeam), respectively.
Alternatively, an antibody
against NeuN (Chemicon, # MAB377) was treated to analyze the degree of
neuronal cell death in
hippocampus. After incubation with the primary antibody, the biotin-linked
goat anti-rabbit IgG
(1: 100, Vector Laboratories) and Avidin D-horseradish peroxidase (1: 200, ABC
Elite, Vector
Laboratories) were treated and detected with diaminobenzidine (DAB). Each
immune-stained
section was observed with a bright field microscope to measure optical
density. The results are
disclosed in FIGS. 11a to lie.
18-1. Analysis of alpha-synuclein reduction ability by a chimeric antibody and
a
bispecific antibody
FIG. 11a shows the result of staining and measuring cortex and hippocampus
among the
mouse brain tissue by using p-129 a-Syn antibody after administering the
antibodies to mouse
for testing whether the chimeric 11F11 antibody and the bivalent bispecific
antibody comprised
of 1564 clone and the chimeric 11F11 antibody can remove alpha-synuclein
aggregates in a
mouse animal model (TG) overexpressing human alpha-synuclein. p-129 a-syn is
phosphorylated form at 129th residue and a maker of aggregates, and is
represented as dark
brown spots or aggregates in stained tissue.
According to FIG. 11a, the IgG-treated group showed a higher staining degree
of p-129
cc-syn than the non-tg control group (#: one way ANOVA, p \u003c0.01). On the
contrary, in the
group treated with the monospecific antibodies or the bispecific antibodies,
the staining degree
of p-129 cc-syn or aggregates was significantly reduced. In particular, in
hippocampus, the degree
of reduction in the bispecific antibody treatment group was higher than that
of the chimeric
101
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
11F11 antibody (*: one way ANOVA, p \u003c0.05). FIG. lib shows the experiment
result in
the same manner as in FIG. 11a, except for the staining with a whole alpha-
synuclein antibody as
a marker. The detection of all alpha-synuclein indicates that the antibody of
the present invention
has the ability to clear the alpha-synuclein itself and inhibit the cell-to-
cell transmission. In other
aspects, it can also be interpreted as inhibiting the formation of aggregates
from monomers or
removing all monomers. The increased human alpha-synuclein in TG mouse is
reduced
compared to the IgG administration group by administration of the monospecific
antibodies and
the bispecific antibodies. In particular, in hippocampus, the bispecific
antibodies were more
effective than the monospecific antibodies.
The results indicate that the chimeric 11F11 antibody and the bispecific
antibody
effectively reduce alpha-synuclein and its aggregate levels in Parkinson's
disease animal models
even at a low dose of 2.5 mg/kg. In particular, the bispecific antibody is
superior to the
monospecific antibody, which suggests that the bispecific antibody can reach
the brain more than
the monospecific antibody and treat the disease effectively based on the
improved BBB-
penetrating ability.
18-2. Analysis of astroglosis and inflammatory cytokine level reduction
ability of the
chimeric antibody and the specific antibody
Glyosis is a non-specific reaction that occurs in glial cells in response to
damage to the
central nervous system and is triggered by BBB damage, or the substances such
as TGF-beta and
interleukin. Representatively, it includes astrogliosis and GFAP protein is
used as a marker. Thus,
the effect of reducing the astrocytosis and inflammatory cytokine release
triggering the
astrocytosis were analyzed by administering the chimeric 11F11 antibody and
the bispecific
102
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
antibody comprised of 1564 clone and the chimeric antibody. The results of the
analysis are
disclosed in FIG. 21c and FIG. 21d.
FIG. 11c shows a result of staining and measuring the mouse brain tissue using
GFAP
(astrogliosis) as a marker after administering the antibodies, to test whether
the chimeric 11F11
antibody and the bispecific antibody comprised of 1564 clone and the chimeric
antibody
prepared in an example of the present invention can reduce astrogliosis in
vivo. The
monospecific antibody and the bispecific antibody inhibited astrogliosis
compared to the IgG
control group. In particular, it was confirmed that the efficacy of the
bispecific antibody was
superior to that of the monospecific antibody in striatum.
FIG. lid shows a result of staining and measuring the mouse brain tissue using
IL-1 beta
antibody as a marker after administering the antibodies, to test whether the
chimeric 11F11
antibody and the bispecific antibody comprised of 1564 clone and the chimeric
antibody
prepared in an example of the present invention can reduce inflammatory
cytokines in vivo. IL-1
beta causes an inflammation, leading to the death and inflammatory response of
various neurons.
In the hippocampus of rats administered by the antibodies according to the
present invention, IL-
1 beta was reduced in the groups administered by monospecific antibodies and
the bispecific
antibodies- compared to the IgG control group, and in particular, the
reduction ability of the
bispecific antibody was significantly superior to that of the monospecific
antibody (##: One- way
ANOVA, p \u003c0.005; *: one way ANOVA, p \u003c0.05).
As shown in the figures, the antibody according to the present invention has
been shown
to reduce the astrogliosis and decrease the release of inflammatory cytokine
of IL- lbeta, which
triggers the astrogliosis, compared to the control.
103
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
18-3. Analysis of neurodegeneration reduction ability of the chimeric antibody
and the
bispecific antibody
It has been confirmed in the prior literature that the death of brain cells
occurs due to the
neurotoxicity and the inflammatory response of alpha-synuclein. Whether the
monospecific
antibodies and the bispecific antibodies of the present invention can inhibit
brain cell death
caused by alpha-synuclein in vivo was analyzed.
As a result of staining with NeuN which was a marker of neurons in cortex and
hippocampus, it was found that both the monospecific antibody and the
bispecific antibody
reduced the degree of brain cell death compared to the IgG control group.
Particularly, in cortex,
it was confirmed that the bispecific antibody had superior inhibition ability
of brain cell death
compared to the monospecific antibody. The results are shown in Fig. lie.
Example 19. Increased half-life by Fc engineering and improved BBB-penetrating
ability due to the increased half-life
FcRn is an important receptor on the cell membrane that increases the half-
life by
drawing and circulating the antibody into cells, so as to inhibit the
degradation of antibody when
the antibody circulates in blood vessels. The BBB-penetrating ability is also
important for the
transcytosis activity of antibody, but it is well known that the transcytosis
activity of antibody is
important in the BBB-penetrating ability, but the antibodies pass through BBB
depending on the
concentration of antibodies in blood vessels. For this reason, in order to
increase the half-life of
the bispecific antibody, the bispecific antibodies were prepared by increasing
the binding affinity
to FcRn by changing methionine (Met) to leucine (Leu) at 428th amino acid in
the Fc region. As
a result of comparing the half-life by the administration of WT bispecific
antibody and M428L
104
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
bispecific antibody at a concentration of 10 mg/kg to tg mouse expressing
Human FcRn, the
increased half-life effect was confirmed to be about 50%, as shown in FIG. 11.
To confirm the
half-life increase again, the PK profiles were analyzed by administering WT
bispecific antibody,
M428L bivalent bispecific antibody, and M428L monovalent bispecific antibody
to monkeys. In
the case of the WT bispecific antibody, as shown in FIG. 22a, the blood
concentration rapidly
decreased after 168 hours, while the M428L bispecific antibodies with high
binding affinity to
FcRn maintained an improved blood concentration compared to WT. It was
confirmed that the
half-life increased by about 1.5 days in the M428L bispecific antibody
compared to the WT
bispecific antibody. In particular, in terms of clearance, the M428L
monovalent bispecific
antibody was the best clearance and the WT bispecific antibody showed the
fastest clearance
(Fig. 12b).
To verify the improved BBB passage due to the increased half-life effect, CSF
was
extracted at 24 hours after the antibody administration, and the amount of
antibody in CSF was
analyzed. After coating 100 ng/ml of IGF1R in a refrigerated state for 18
hours, CSF was added
to detect the antibody bound to IGF1R. As can be seen in FIG. 12c, it was
confirmed that the
amount of the M428L bispecific antibody to pass BBB, which had a large amount
of antibodies
in the blood, was large and the M428L monovalent bispecific antibody showed
improved BBB-
penetrating ability than the M428L bivalent bispecific antibody, as well as
the excellent BBB
penetrating ability.
Example 20. Efficacy evaluation of deamidated affinity variant-based
bispecific
antibodies
105
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Monovalent bispecific antibodies including hul 1F11(ver.2) (humanized antibody
of
11F11) and F06 scFv (affinity variant of 1564), especially bispecific
antibodies including mutant
having modified in some residues of CDR for remove deamidation (including
hullF11(ver.2)-
F06(de2)(StoP) monovalent), were produced according to Example 10. The
prepared bispecific
antibody and the alpha-synuclein monospecific antibody were tested and
compared for in vivo
efficacy in a transgenic mouse overexpressing human alpha-synuclein (mThy-1
human a-
synuclein, UC San Diego).
Specifically, in 4-month old transgenic mouse, 20 mg/kg of hullF11 (ver.2) and
23.4
mg/kg of bispecific antibody equivalent to the same mole number were
administered
intraperitoneally at 0, 72, 144, or 192 hours for 8 days. In twenty-four hours
after the last dose,
the animals were anesthetized with chloral hydrate and cardiac perfused with
0.9% saline. Brains
were isolated and snap frozen at -70 C until analysis time. The brain tissue
was ground and
centrifuged to remove debris, and the supernatant was obtained. It was
analyzed for cc-syn with
ELISA analysis to measure quantitively the amount of ct-syn in the brain
lysate (Invitrogen
#1(1-1B0061). The result is shown in FIG. 13.
As shown in FIG. 13 , the humanized antibody 11F11(ver.2) and the deamidated
F06
variant-based bispecific antibody prepared in an example of the present
invention decreased ct-
syn in the brain compared to the IgG control. In particular, the bispecific
antibody showed a
superior ability to reduce cc-syn in the brain compared to the monospecific
antibody of cc-syn.
Example 21. IGF1R-specific antigen binding affinity analysis (ELISA) for the
bispecific antibody including (de2)(StoP)deamidated anti-IGF1R antibody
106
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
This example was performed to test whether the bispecific antibody including
the
deamidated anti-IGF1R antibody according to Example 8 has normal antigen
binding affinity,
and to analyze simultaneously the antigen-binding affinity of the deamidated
anti-IGF1R
antibody in various anti-IGF1R antibodies and the bispecific antibody formats
in different ways.
For this purpose, the monovalent bispecific antibody and the bivalent
bispecific antibody
including each of non-deamidated antibodies (wild type), (de)(StoP) deamidated
antibodies, and
(de2)(StoP) deamidated antibodies prepared based on the anti-IGF1R clones F06,
VH5 and
VH16 were produced. Their binding affinity and concentration-dependent binding
to
recombinant IGF1R were quantitatively analyzed and compared through sandwich
ELISA. The
hul 1F11 (ver.2) clone was used as the anti-a-syn antibody.
Human recombinant IGF1R of an antigen for antibody binding was purchased from
Sino
biological as an extracellular domain (ECD) (10164-H08H). In a 96-well ELISA
plate (Nunc-
Immuno Plates, NUNC, Rochester, NY), human IGF1R was diluted to 1 ug/ml in PBS
buffer
and put in 100 ul per well, followed by reaction at 4 C for 16 hour, and
after coating, the
supernatant was removed. 200 ul of PBS buffer containing 1% BSA (bovine serum
albumin) was
added per well and reacted at 37 C for 2 hours to block non-specific binding.
The prepared bispecific antibodies and each control antibody (wild type and
(de)(StoP)
deamindated antibody) were diluted with five times to a maximum concentration
of 400 nM to
produce eight (8) points. The diluted solutions were added each well at 100
pl, and reacted at
37 C for 2 hours to binding the antibodies to the coated antigen. After
completion of the
reaction, washing was performed 4 times using 300 ul of PBS buffer containing
0.05% Tween20,
and anti-human Fc-HRP recognizing human Fc present in the bispecific antibody
was diluted
107
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
1:2000 in blocking buffer to each well. 100 ul of each was reacted for 1 hour
at 37 C. After
washing 4 times using 300 ul of PBS-T (Tween20 0.05%) again, TMB
(Tetramethylbenzidine,
Sigma, T0440) was used to develop color. The enzymatic reaction was stopped
with 0.5 mol/L
sulfuric acid, and the absorbance was recorded and analyzed at 450 nm using a
microplate reader
(molecular device). The experimental results are shown in FIGs. 14a to 14c and
Table 25. Fig.
14a is an experimental result for F06 monovalent antibody, F06(Stop)
monovalent antibody and
F06(de2)(Stop) antibody, Fig. 14b is an experimental result for VH5 antibody,
VH5(de)(Stop)
antibody and VH5(de2)(Stop) antibody, and Fig. 14c is an experimental result
for VH16
antibody, VH16(de)(Stop) antibody and VH16(de2)(Stop) antibody.
According to Figs. 14a, 14b, and 14c, regardless of the anti-IGF1R clone type
and
monovalent / bivalent format, (de2)(StoP) deamidated antibody maintained the
antigen binding
ability to be level of the non-deamidated wild type, and had an excellent
antigen-binding ability
compared to (de)(StoP) deamidated antibody. Table 25 below shows the
experimental results of
the non-deamidated antibody (wild type), (de)(StoP) deamidated antibody and
(de2)(StoP)
deamidated antibody based on F06, VHS and VH16.
[Table 25]
Clones (de)(StOP) (de2)(StoP)
EC50 (nM) % WT EC50 (nM) % WT
F06 mono 4.24 2.64 0.0575 195.00
VHS bi 1.19 10.50 0.0561 222.81
VH16 bi 1.25 11.44 0.122 117.21
Table 25 show the comparison of the numerical values obtained from the
sandwich
ELISA results of (de)(StoP) deamidated antibody and (de2)(StoP) deamidated
antibody.
108
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
According to the result of Table 25, it was confirmed that regardless of the
anti-IGF1R clone
type and monovalent / bivalent format, (de2)(StoP) deamidated antibody had an
excellent
antigen-binding ability compared to (de)(StoP) deamidated antibody.
Example 22. Cell surface IGF1R-specific antigen binding affinity analysis
(FACS)
for the bispecific antibody including (de2)(StoP)deamidated anti-IGF1R
antibody
The cell surface IGF1R-specific antigen binding affinity analysis was
performed by
FACS using (de2)(StoP) deamindated bispecific antibodies and their wild type
antibodies and
(de)(StoP) deamindated bispecific antibodies as controls used in Example 21.
MCF7 cells
overexpressing IGF1R were used in the analysis.
Specifically, each bispecific antibody was diluted to 10 ug/ml, added to MCF-7
cell lines
at 0.5 x 106 MCF-7 cell lines, and reacted at 4 C for 2 hours. After washing
twice using PBS
buffer, anti-human FITC was diluted 1:1000 and treated, and reacted at 4 C for
1 hour. After
washing twice again with PBS buffer, the binding degree of anti-IGF1R BsAb was
measured
using a FACSCalibur instrument. As a control, MCF-7 cells treated with only
the secondary
antibody were used, and the experimental results are shown in FIGs. 15a to
15c.
As the experimental results, similar to the results confirmed in Example 21,
the antigen
binding affinity of (de2) (StoP) deamidated antibody was equivalent to that of
non-deamidated
wild type antibody, and showed superior antigen-binding ability compared to
(de)(StoP)
deamidated antibody, regardless of anti-IGF1R clone type and monovalent /
bivalent formats.
109
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
Example 23. In vivo BBB penetration capacity analysis for the bispecific
antibody
based on (de2)(StoP) deamidated anti-IGF1R antibody
The in vivo BBB penetration ability of the bispecific antibody including
deamidated
anti-IGF1R antibody according to Example 8 was confirmed in SD (Sprague-
Dawley) rats.
Experimental groups and doses are summarized in the table below.
[Table 26]
Clone ID Dose
hul 1F11(ver.2) 30 mg/kg
hullF11(ver2)-1564 monovalent 35.46 mg/kg
hullF11(ver2)-F06 monovalent(de)(StoP) 35.46 mg/kg
hullF11(ver2)-F06 monovalent(de2)(StoP) 35.46 mg/kg
As described in Table 26, the amount of antibodies in serum and cerebrospinal
fluid
(CSF) in 24 hours after a single administration of a-syn monospecific antibody
or a-syn/IGF1R
bispecific antibody into the caudal vein of rats, were analyzed with the mass
spectrometry
analysis. The specific mass spectrometry method was performed substantially in
the same
manner as in Example 15, and the analysis result is shown in FIG. 16.
In FIG. 16, the serum concentration representing the blood concentration of
antibody at
24 hours after administration, and was similarly observed in (de)(StoP)
deamidated antibody and
(de2)(StoP) deamidated antibody. On the other hand, the concentration in the
cerebrospinal fluid
representing the brain delivery of the antibody was highest in the (de2)(StoP)
deamidated
antibody. This shows that the bispecific antibody of the present invention
exhibits excellent BBB
penetrating ability by the deamidated anti-IGF1R antibody.
In order to observe the efficacy of the bispecific antibody of the present
invention for a
110
Date recue / Date received 2021-12-10
CA 03143242 2021-12-10
longer period of time, after the anti-alpha-synuclein monospecific antibody of
hul 1F11 (ver.2)
and hul 1F11(ver2)-F06 monovalent(de2)(StoP), which was (de2)(StoP) deamidated
bispecific
were administrated once into the caudal vein of rats, the amounts of
antibodies in serum,
cerebrospinal fluid and brain were analyzed up to 168 hours after
administration with with the
mass spectrometry analysis. The specific mass spectrometry method was
performed substantially
in the same manner as in Example 15, and the analysis result is shown in FIG.
17.
According to FIG. 17, the serum concentration of the antibody was similarly
observed
for the anti-alpha-synuclein monospecific antibody and the (de2)(StoP)
deamidated bispecific
antibody. However, in case of the concentration in the cerebrospinal fluid
representing the brain
delivery of the antibody, compared to the monospecific antibody, the area
under the curve
(AUC) of the (de2)(StoP) deamidated bispecific antibody increased about 5.8-
fold and the
concentration in the cerebrospinal fluid at 24 hours was about 10-fold or more
in the (de2)(StoP)
deamidated bispecific antibody. In addition, the brain concentration also
increased about 7.9-fold
in the area under the curve (AUC) in the (de2)(StoP) deamidated bispecific
antibody, compared
to the monospecific antibody. From this result, it was confirmed that the
bispecific antibody of
the present invention exhibited excellent BBB penetrating ability by including
the (de2)(StoP)
deamidated IGR1R antibody.
111
Date recue / Date received 2021-12-10
