Note: Descriptions are shown in the official language in which they were submitted.
WO 2021/219871
PCT/EP2021/061450
ANTI-CD103 ANTIBODIES
RELATED APPLICATION
[0001] This application claims priority to United States
Provisional Application Serial
No. 62/704,258, filed April 30, 2020, which is hereby incorporated by
reference in its
entirety.
FIELD OF THE INVENTION
[0002] The present invention relates to anti-CD103 antibodies,
as well as use of these
antibodies in the diagnosis, prognosis, monitoring, and treatment of diseases.
BACKGROUND OF THE INVENTION
[0003] CD103 (Integrin aE) is type I membrane protein expressed
on a subpopulation of
lamina propria T cells, epithelial dendritic cells, lamina propria-derived
dendritic cells, and a
small subset of peripheral lymphocytes. Twg cells express a high level of
CD103. Mature
CD103 protein can be cleaved into 2 chains, a 150 kD (C-terminal) chain and a
25 kD (N-
terminal) chain, which remain linked by disulfide bonds. In combination with
the f37 integrin,
CD103 forms an aF437 heterodimer, which represents the F-cadherin binding
integrin known
as the human mucosal lymphocyte-1 antigen.
[0004] The identification and understanding of immune checkpoint
proteins and their
role in the immune response represents a breakthrough in cancer therapy. With
this
discovery, efforts focussed on blocking the immune checkpoint pathways in an
attempt to
activate T-cells directed at cancer cells that were found to be ineffective in
stimulating a
productive antitumor response. Ipilimumab, an antibody which binds to and
functionally
blocks CTLA-4, was approved by the US Food and Drug Administration (FDA) for
the
treatment of metastatic melanoma in 2011. Following on the heels of
ipilimumab, antibodies
targeting the programmed cell death-1 (PD-1) receptor, and its ligand found on
many cancer
cells programmed death-ligand 1 (PD-L1), were also approved. These checkpoint
inhibitors
have led to a revolution in cancer therapy.
[0005] Despite significant clinical benefit ascribed to
immunotherapy targeting immune
checkpoint pathways, a majority of cancer patients fail to respond to
checkpoint inhibitors. In
-1 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
particular, studies suggest that checkpoint inhibition may not be sufficient
in patients that
display limited functional T cell infiltration into the tumor environment.
Moreover, while T
cells may accumulate in tissues surrounding the tumor mass, they may not be
interacting with
tumor cells themselves.
[0006] Through their ability to produce T cell-specific
chemokines and present antigens
together with costimulatory or inhibitory signals, tumor-associated antigen
presenting cells
are best poised to shape anti-tumoral effector immunity. Tissue-resident
dendritic cells
consist of two functionally specialized subsets: the CD103+-CD8+ DCs that
participate in
priming and cross-presentation of cell-associated antigens to CD8 T cells, and
CD1 Ib' DCs
that are more potent at driving CD4- helper T cell responses. Type I
interferon production by
the CD103--CD8+ DC lineage controls spontaneous T cell priming to tumor
antigens. Thus,
the composition of the tumor-associated myeloid compartment likely plays a key
role in
tumor response to checkpoint blockade.
[0007] The reported association of CD103+ tumor-infiltrating T
lymphocytes with
improved clinical outcomes in cancer patients highlights the need to have a
clear and
comprehensive understanding of the expression characteristics of cancer-
specific
lymphocytes and their implications for future immunotherapies.
SUMMARY OF THE INVENTION
[0008] In a first aspect, the invention provides anti-CD103
antibodies and antigen
binding fragments thereof comprising the structural and functional features
specified below.
[0009] In various embodiments, the invention provides an
antibody or antigen binding
fragment thereof that binds to human CD103 comprising:
a. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 1 or an amino acid sequence differing from SEQ ID NO: 1 by 1,
2, or 3 conservative substitutions,
b. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 2 or an amino acid sequence differing from SEQ ID NO: 2 by 1,
2, or 3 conservative substitutions,
-2-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
c. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 3 or an amino acid sequence differing from SEQ ID NO: 3 by 1,
2, or 3 conservative substitutions,
d. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 4 or an amino acid sequence differing from SEQ ID NO: 4 by 1,
2, or 3 conservative substitutions,
e. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 5 or an amino acid sequence differing from SEQ ID NO: 5 by 1,
2, or 3 conservative substitutions, and
f. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 6 or an amino acid sequence differing from SEQ ID NO: 6 by 1,
2, or 3 conservative substitutions;
or
g. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 9 or an amino acid sequence differing from SEQ ID NO: 9 by 1,
2, or 3 conservative substitutions,
h. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 10 or an amino acid sequence differing from SEQ ID NO: 10 by
1, 2, or 3 conservative substitutions,
i. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 11 or an amino acid sequence differing from SEQ ID NO: 11 by
1, 2, or 3 conservative substitutions,
j. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 12 or an amino acid sequence differing from SEQ ID NO: 12 by
1, 2, or 3 conservative substitutions,
-3 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
k. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 13 or an amino acid sequence differing from SEQ ID NO: 13 by
1, 2, or 3 conservative substitutions, and
1.
a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 14 or an amino acid sequence differing from SEQ ID NO: 14 by
1, 2, or 3 conservative substitutions;
or
m. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 17 or an amino acid sequence differing from SEQ ID NO: 17 by
1, 2, or 3 conservative substitutions,
n. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 18 or an amino acid sequence differing from SEQ ID NO: 18 by
1, 2, or 3 conservative substitutions,
o. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 19 or an amino acid sequence differing from SEQ ID NO: 19 by
1, 2, or 3 conservative substitutions,
p. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 20 or an amino acid sequence differing from SEQ ID NO: 20 by
1, 2, or 3 conservative substitutions,
q. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 21 or an amino acid sequence differing from SEQ ID NO: 21 by
1, 2, or 3 conservative substitutions, and
r. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 22 or an amino acid sequence differing from SEQ ID NO: 22 by
1, 2, or 3 conservative substitutions;
or
-4-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
s. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 25 or an amino acid sequence differing from SEQ ID NO: 25 by
1, 2, or 3 conservative substitutions,
t. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 26 or an amino acid sequence differing from SEQ ID NO: 26 by
1, 2, or 3 conservative substitutions,
u. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 27 or an amino acid sequence differing from SEQ ID NO: 27 by
1, 2, or 3 conservative substitutions,
v. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 28 or an amino acid sequence differing from SEQ ID NO: 28 by
1, 2, or 3 conservative substitutions,
w. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 29 or an amino acid sequence differing from SEQ ID NO: 29 by
1, 2, or 3 conservative substitutions, and
x. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 30 or an amino acid sequence differing from SEQ ID NO: 30 by
1, 2, or 3 conservative substitutions;
or
y. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 33 or an amino acid sequence differing from SEQ ID NO: 33 by
1, 2, or 3 conservative substitutions,
z. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 34 or an amino acid sequence differing from SEQ ID NO: 34 by
1, 2, or 3 conservative substitutions,
-5-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
aa. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 35 or an amino acid sequence differing from SEQ ID NO: 35 by
1, 2, or 3 conservative substitutions,
bb. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 36 or an amino acid sequence differing from SEQ ID NO: 36 by
1, 2, or 3 conservative substitutions,
cc. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 37 or an amino acid sequence differing from SEQ ID NO: 37 by
1, 2, or 3 conservative substitutions, and
dd. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 38 or an amino acid sequence differing from SEQ ID NO: 38 by
1, 2, or 3 conservative substitutions.
[0010] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 1,
b. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 2,
c. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 3,
d. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ 1D NO: 4,
e. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ 1D NO: 5, and
f. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 6.
-6-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[0011] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 9,
b. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 10,
c. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 11,
d. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 12,
e. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 13, and
f. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 14.
[0012] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 17,
b. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 18,
c. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 19,
d. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 20,
-7-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
e. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 21, and
f. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 22.
[0013] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 25,
b. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 26,
c. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 27,
d. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 28,
e. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 29, and
f. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 30.
[0014] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 33,
b. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 34,
-8-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
c. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 35,
d. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 36,
e. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 37, and
f. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 38.
[0015] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 1 by 1 conservative substitution,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 2 by 1 conservative substitution,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 3 by 1 conservative substitution,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 4 by 1 conservative substitution,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 5 by 1 conservative substitution, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 6 by 1 conservative substitution.
[0016] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
-9-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 9 by 1 conservative substitution,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 10 by 1 conservative substitution,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 11 by 1 conservative substitution,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 12 by 1 conservative substitution,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 13 by 1 conservative substitution, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 14 by 1 conservative substitution.
[0017] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR I comprising an amino acid sequence
differing from SEQ ID NO: 17 by 1 conservative substitution,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 18 by 1 conservative substitution,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 19 by 1 conservative substitution,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 20 by 1 conservative substitution,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 21 by 1 conservative substitution, and
-10-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 22 by 1 conservative substitution.
[0018] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 25 by 1 conservative substitution,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 26 by 1 conservative substitution,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 27 by 1 conservative substitution,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 28 by 1 conservative substitution,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 29 by 1 conservative substitution, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 30 by 1 conservative substitution.
[0019] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 33 by 1 conservative substitution,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 34 by 1 conservative substitution,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 35 by 1 conservative substitution,
-11-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 36 by 1 conservative substitution,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 37 by 1 conservative substitution, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 38 by 1 conservative substitution.
[0020] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 1 by 2 conservative substitutions,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 2 by 2 conservative substitutions,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 3 by 2 conservative substitutions,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 4 by 2 conservative substitutions,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 5 by 2 conservative substitutions, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 6 by 2 conservative substitutions.
[0021] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 9 by 2 conservative substitutions,
-12-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 10 by 2 conservative substitutions,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 11 by 2 conservative substitutions,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 12 by 2 conservative substitutions,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 13 by 2 conservative substitutions, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 14 by 2 conservative substitutions.
[0022] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 17 by 2 conservative substitutions,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 18 by 2 conservative substitutions,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 19 by 2 conservative substitutions,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 20 by 2 conservative substitutions,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 21 by 2 conservative substitutions, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 22 by 2 conservative substitutions.
-13-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[0023] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 25 by 2 conservative substitutions,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 26 by 2 conservative substitutions,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 27 by 2 conservative substitutions,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 28 by 2 conservative substitutions,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 29 by 2 conservative substitutions, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 30 by 2 conservative substitutions.
[0024] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 33 by 2 conservative substitutions,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 34 by 2 conservative substitutions,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 35 by 2 conservative substitutions,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 36 by 2 conservative substitutions,
-14-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 37 by 2 conservative substitutions, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 38 by 2 conservative substitutions.
[0025] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 1 by 3 conservative substitutions,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 2 by 3 conservative substitutions,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 3 by 3 conservative substitutions,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 4 by 3 conservative substitutions,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 5 by 3 conservative substitutions, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 6 by 3 conservative substitutions.
[0026] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 9 by 3 conservative substitutions,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 10 by 3 conservative substitutions,
-15-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 11 by 3 conservative substitutions,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 12 by 3 conservative substitutions,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 13 by 3 conservative substitutions, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 14 by 3 conservative substitutions.
[0027] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 17 by 3 conservative substitutions,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 18 by 3 conservative substitutions,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 19 by 3 conservative substitutions,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 20 by 3 conservative substitutions,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 21 by 3 conservative substitutions, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 22 by 3 conservative substitutions.
[0028] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
-16-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
a. a heavy chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 25 by 3 conservative substitutions,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 26 by 3 conservative substitutions,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 27 by 3 conservative substitutions,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 28 by 3 conservative substitutions,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 29 by 3 conservative substitutions, and
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 30 by 3 conservative substitutions.
[0029] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising:
a. a heavy chain variable region CDR I comprising an amino acid sequence
differing from SEQ ID NO: 33 by 3 conservative substitutions,
b. a heavy chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 34 by 3 conservative substitutions,
c. a heavy chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 35 by 3 conservative substitutions,
d. a light chain variable region CDR1 comprising an amino acid sequence
differing from SEQ ID NO: 36 by 3 conservative substitutions,
e. a light chain variable region CDR2 comprising an amino acid sequence
differing from SEQ ID NO: 37 by 3 conservative substitutions, and
-17-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
f. a light chain variable region CDR3 comprising an amino acid sequence
differing from SEQ ID NO: 38 by 3 conservative substitutions.
[0030] In various other embodiments, the invention provides an
antibody or antigen
binding fragment thereof that binds to human CD103 comprising:
a. a heavy chain of the antibody or antigen binding fragment that comprises
the
amino acid sequence of SEQ ID NO: 7 and a light chain of the antibody or
antigen binding fragment that comprises the amino acid sequence of SEQ ID
NO: 8; or
b. a heavy chain of the antibody or antigen binding fragment that comprises
the
amino acid sequence of SEQ ID NO: 15 and a light chain of the antibody or
antigen binding fragment that comprises the amino acid sequence of SEQ ID
NO: 16; or
c. a heavy chain of the antibody or antigen binding fragment that comprises
the
amino acid sequence of SEQ ID NO: 23 and a light chain of the antibody or
antigen binding fragment that comprises the amino acid sequence of SEQ ID
NO: 24; or
d. a heavy chain of the antibody or antigen binding fragment that comprises
the
amino acid sequence of SEQ ID NO: 31 and a light chain of the antibody or
antigen binding fragment that comprises the amino acid sequence of SEQ ID
NO: 32; or
e. a heavy chain of the antibody or antigen binding fragment that comprises
the
amino acid sequence of SEQ ID NO: 39 and a light chain of the antibody or
antigen binding fragment that comprises the amino acid sequence of SEQ ID
NO: 40;
or in each case a sequence having at least 95% (and more preferably 97% or
99%) sequence
similarity or identity to a given SEQ ID NO, with any difference in such
sequence being
confined to amino acids that are not a part of a CDR sequence within the SEQ
ID NO.
-18-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[0031] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising a heavy chain of the antibody that comprises the amino acid
sequence of
SEQ ID NO: 7 and a light chain of the antibody comprises the amino acid
sequence of SEQ
ID NO: 8.
[0032] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising a heavy chain of the antibody that comprises the amino acid
sequence of
SEQ ID NO: 15 and a light chain of the antibody that comprises the amino acid
sequence of
SEQ ID NO: 16.
[0033] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising a heavy chain of the antibody that comprises the amino acid
sequence of
SEQ ID NO: 23 and a light chain of the antibody that comprises the amino acid
sequence of
SEQ ID NO: 24.
[0034] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising a heavy chain of the antibody that comprises the amino acid
sequence of
SEQ ID NO: 31 and a light chain of the antibody that comprises the amino acid
sequence of
SEQ ID NO: 32.
[0035] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising a heavy chain of the antibody that comprises the amino acid
sequence of
SEQ ID NO: 39 and a light chain of the antibody that comprises the amino acid
sequence of
SEQ ID NO: 40.
[0036] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising a heavy chain of the antibody that comprises the amino acid
sequence
having at least 95% (and more preferably 97% or most preferably 99%) sequence
identity to
SEQ ID NO: 7, with any difference in such sequence being confined to amino
acids that are
not a part of a CDR sequence within SEQ ID NO: 7, and a light chain of the
antibody
comprises the amino acid sequence having at least 95% (and more preferably 97%
or most
preferably 99%) sequence identity to SEQ ID NO: 8, with any difference in such
sequence
being confined to amino acids that are not a part of a CDR sequence within SEQ
ID NO: 8.
-19-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[0037] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising a heavy chain of the antibody that comprises the amino acid
sequence
having at least 95% (and more preferably 97% or most preferably 99%) sequence
identity to
SEQ ID NO: 15, with any difference in such sequence being confined to amino
acids that are
not a part of a CDR sequence within SEQ ID NO: 15, and a light chain of the
antibody
comprises the amino acid sequence having at least 95% (and more preferably 97%
or most
preferably 99%) sequence identity to SEQ ID NO: 16, with any difference in
such sequence
being confined to amino acids that are not a part of a CDR sequence within SEQ
ID NO: 16.
[0038] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising a heavy chain of the antibody that comprises the amino acid
sequence
having at least 95% (and more preferably 97% or most preferably 99%) sequence
identity to
SEQ ID NO: 23, with any difference in such sequence being confined to amino
acids that are
not a part of a CDR sequence within SEQ ID NO: 23, and a light chain of the
antibody
comprises the amino acid sequence having at least 95% (and more preferably 97%
or most
preferably 99%) sequence identity to SEQ ID NO: 24, with any difference in
such sequence
being confined to amino acids that are not a part of a CDR sequence within SEQ
ID NO: 24.
[0039] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising a heavy chain of the antibody that comprises the amino acid
sequence
having at least 95% (and more preferably 97% or most preferably 99%) sequence
identity to
SEQ ID NO: 31, with any difference in such sequence being confined to amino
acids that are
not a part of a CDR sequence within SEQ ID NO: 31, and a light chain of the
antibody
comprises the amino acid sequence having at least 95% (and more preferably 97%
or most
preferably 99%) sequence identity to SEQ ID NO: 32, with any difference in
such sequence
being confined to amino acids that are not a part of a CDR sequence within SEQ
ID NO: 32.
[0040] In one embodiment, the invention provides an antibody
that binds to human
CD103 comprising a heavy chain of the antibody that comprises the amino acid
sequence
having at least 95% (and more preferably 97% or most preferably 99%) sequence
identity to
SEQ ID NO: 39, with any difference in such sequence being confined to amino
acids that are
not a part of a CDR sequence within SEQ ID NO: 39, and a light chain of the
antibody
comprises the amino acid sequence having at least 95% (and more preferably 97%
or most
-20-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
preferably 99%) sequence identity to SEQ ID NO: 40, with any difference in
such sequence
being confined to amino acids that are not a part of a CDR sequence within SEQ
ID NO: 40.
[0041] In this context, "sequence similarity" is based on the
extent of identity combined
with the extent of conservative changes. The percentage of "sequence
similarity" is the
percentage of amino acids or nucleotides which is either identical or
conservatively changed
viz. -sequence similarity" = percent sequence identity) + percent conservative
changes).
Thus, for the purpose of this invention "conservative changes" and "identity"
are considered
to be species of the broader term "similarity". Thus, whenever the term
sequence "similarity"
is used it embraces sequence "identity" and "conservative changes". According
to certain
embodiments the conservative changes are disregarded and the percent sequence
similarity
refers to percent sequence identity. In certain embodiments, the changes in a
sequence
permitted by the referenced percent sequence identity are all or nearly all
conservative
changes; that is, when a sequence is 90% identical, the remaining 10% are all
or nearly all
conservative changes. The term "nearly all" in this context refers to at least
75% of the
permitted sequence changes are conservative changes, more preferably at least
85%, still
more preferably at least 90%, and most preferably at least 95%. In certain
embodiments of
antibody heavy and/or light chains, the permitted sequence changes are within
the framework
regions and not in the CDRs.
[0042] In any of the above embodiments, the antibody or antigen
binding fragment
thereof may be isolated, as that term is defined herein.
[0043] In any of the above embodiments, the antibody or antigen
binding fragment
thereof is a recombinant antibody, as that term is defined herein.
[0044] In any of the above embodiments, the antibody or antigen
binding fragment
thereof is a full-length antibody, as that term is defined herein.
[0045] Antibodies or antigen binding fragments of the present
invention may be obtained
from a variety of species. For example, the antibodies of the present
invention may comprise
immunoglobulin sequences which are rabbit, mouse, rat, guinea pig, chicken,
goat, sheep,
donkey, human, llama or camelid sequences, or combinations of such sequences
(so-called
chimeric antibodies). Most preferably, the antibodies or antigen binding
fragments are human
-21-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
antibodies or antigen binding fragments. Most preferably, the antibodies or
antigen binding
fragments are humanized antibodies or antigen binding fragments.
[0046] The term antibody includes antigen-binding portions,
i.e., "antigen binding sites,"
(e.g., fragments, subsequences, complementarity determining regions (CDRs))
that retain
capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment
consisting of
the VT,, Vu, CT , and Cul domains; (ii) a F(ab')2 fragment, a bivalent
fragment comprising two
Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd
fragment consisting
of the VH and Cul domains; (iv) a Fv fragment consisting of the VL and Vu
domains of a
single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature
341:544-546),
which consists of a VII domain; and (vi) an isolated complementarity
determining region
(CDR). Single chain antibodies are also included by reference in the term
"antibody."
Preferred therapeutic antibodies are intact IgG antibodies. The term "intact
IgG" as used
herein is meant as a polypeptide belonging to the class of antibodies that are
substantially
encoded by a recognized immunoglobulin gamma gene. In humans this class
comprises
IgGl, IgG2, IgG3, and IgG4. In mice this class comprises IgGl, IgG2a, IgG2b,
and IgG3.
The known Ig domains in the IgG class of antibodies are VH, Cyl, Cy2, Cy3, VL,
and CL.
[0047] In any of the above embodiments, the antibody or antigen
binding fragment
thereof is a human or humanized antibody comprising two heavy chains and two
light chains.
In one embodiment, the antibody is an IgG. In preferred embodiments, antibody
is an IgGI,
IgG2, or IgG4, and preferably a human IgG1 , IgG2, or IgG4.
[0048] In one embodiment, the anti-CD103 antibody of the
invention comprises a full
length antibody structure having two light chains and two heavy chains as
recited above,
wherein each light chain comprises a human kappa light chain or a human lambda
light chain
constant domain; and each heavy chain comprises a human IgG1 constant region.
[0049] In one embodiment, the anti-CD103 antibody of the
invention comprises a full
length antibody structure having two light chains and two heavy chains as
recited above,
wherein each light chain comprises a human kappa light chain or a human lambda
light chain
constant domain; and each heavy chain comprises a human IgG2 constant region.
[0050] In one embodiment, the anti-CD103 antibody of the
invention comprises a full-
length antibody structure having two light chains and two heavy chains as
recited above,
-22-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
wherein each light chain comprises a human kappa light chain or a human lambda
light chain
constant domain; and each heavy chain comprises a human IgG4 constant region.
[0051] In certain embodiments, the anti-CD103 antibody of the
invention can be
conjugated to at least one diagnostic label for in vivo imaging studies. In
certain
embodiments, the antigen binding fragment of anti-CD103 antibody of the
invention can be
conjugated to at least one diagnostic label for in vivo imaging studies. In
certain
embodiments, the anti-CD103 antibody of the invention can be conjugated to at
least one
therapeutic agent. In certain embodiments, the antigen binding fragment of
anti-CD103
antibody of the invention can be conjugated to at least one therapeutic agent.
In one
embodiment, the therapeutic agent is a second antibody or fragment thereof In
one
embodiment, the therapeutic agent is a second antibody. In one embodiment, the
therapeutic
agent is an immunomodulator. In one embodiment, the therapeutic agent is a
hormone. In
one embodiment, the therapeutic agent is a cytotoxic agent. In one embodiment,
the
therapeutic agent is an enzyme. In one embodiment, the therapeutic agent is a
radionuclide.
In one embodiment, the therapeutic agent is a second antibody conjugated to at
least one
immunomodulator. In one embodiment, the therapeutic agent is a second antibody
conjugated to at least one one enzyme. In one embodiment, the therapeutic
agent is a second
antibody conjugated to at least one radioactive label. In one embodiment, the
therapeutic
agent is a second antibody conjugated to at least one hormone. In one
embodiment, the
therapeutic agent is a second antibody conjugated to at least one antisense
oligonucleotide. In
one embodiment, the therapeutic agent is a second antibody conjugated to at
least one
cytotoxic agent. In one embodiment, the therapeutic agent is a second antibody
conjugated to
a combination thereof In one embodiment, the therapeutic agent is a
combination of any one
of a second antibody or fragment thereof, an immunomodulator, a hormone, a
cytotoxic
agent, an enzyme, a radionuclide, or a second antibody conjugated to at least
one
immunomodulator, enzyme, radioactive label, hormone, antisense
oligonucleotide, or
cytotoxic agent. In another embodiment the diagnostic label is one applicable
to PET
imaging. In another embodiment the diagnostic label is one applicable to
single-photon
emission computed tomography (SPECT) imaging. In another embodiment the
diagnostic
label is one applicable to MRI. In another embodiment the diagnostic label is
one applicable
to optical imaging. In another embodiment the diagnostic label is one
applicable to
-23-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
13N, 150, 99mTc, 61cu, 62.cu, 64c,u, 6.7cu, 18F, 19F,
(photo)acoustic imaging etc., such as 11C,
66Ga, 67Ga, 68Ga, 72Ga, 1231, 1241, 1111n, 177Lu, 44se, 4.7sc, 86y, 88y, 90y,
45Ti, 89Zr, indocyanine
green, IRDye 800CW, fluorescein (FITC), magnetic (e.g.,iron oxide)
nanoparticles. This list
is not meant to be limiting.
[0052] The invention also provides isolated nucleic acids
encoding anyone of the anti-
CD 103 antibodies or antigen binding fragments of the invention.
[0053] The invention also provides expression vectors comprising
one or more nucleic
acids of the present invention. An expression vector is a DNA molecule
comprising the
regulatory elements necessary for transcription of a target nucleic acid in a
host cell.
Typically, the target nucleic acid is placed under the control of certain
regulatory elements
including constitutive or inducible promoters, tissue-specific regulatory
elements, and
enhancer elements. Such a target nucleic acid is said to be "operably linked
to" the regulatory
elements when the regulating element controls the expression of the gene.
[0054] These isolated nucleic acids and the expression vectors
comprising them may be
used to express the antibodies of the invention or antigen binding fragments
thereof in
recombinant host cells. Thus, the invention also provides host cells
comprising an expression
vector of the present invention.
[0055] The invention also provides a vessel or injection device
comprising anyone of the
anti-CD 103 antibodies or antigen binding fragments of the invention.
[0056] The invention also provides a method of producing an anti-
CD 1 03 antibody or
antigen binding fragment of the invention comprising: culturing a host cell
comprising a
polynucleotide encoding a heavy chain and/or light chain of an antibody of the
invention (or
an antigen binding fragment thereof) under conditions favorable to expression
of the
polynucleotide; and optionally, recovering the antibody or antigen binding
fragment from the
host cell and/or culture medium. In one embodiment, the polynucleotide
encoding the heavy
chain and the polynucleotide encoding the light chain are in a single vector.
In another
embodiment, the polynucleotide encoding the heavy chain and the polynucleotide
encoding
the light chain are in different vectors.
-24-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[0057] In another aspect, the invention relates to methods of
imaging tissue or other
biological specimen. These methods comprise contacting the biological specimen
with an
anti-CD103 antibody, and detecting the presence or amount of binding of the
antibody to
CD103 present in the biological specimen. Thus, an anti-CD103 antibody is used
as an
imaging agent.
[0058] In a related aspect, the invention relates to methods for
producing an imaging
agent comprising an anti-CD103 antibody and a diagnostic label. These methods
comprise
forming a covalent association between the anti-CD103 antibody and the
diagnostic label.
Alternatively, these methods comprise forming a non-covalent association
between the anti-
CD103 antibody and the diagnostic label. In the case of radiolabels, the
isotope may be
chelated using a bifunctional chelator comprising a first functional group for
the
immobilization of the radiometal and a second functional group for the
covalent attachment
to the antibody. Examples of such chelators include, but are not limited to,
DOTA, NOTA,
TRITA, TETA, TACN, cyclen, cyclam, homocyclen, EDTA, DTPA, DOTP, and NOTMP.
Functionalized versions of the chelators provide a linkage chemistry which
provides a
terminal functional moiety which may be selected from the group consisting of
protected or
unprotected sulfhydryl moieties, protected or unprotected amine moieties,
protected or
unprotected hydroxyl moieties, primary amine-reactive moieties, sulfhydryl-
reactive
moieties, photoreactive moieties, carboxyl-reactive moieties, arginine-
reactive moieties, and
carbonyl-reactive moieties. Functionalized versions of the chelators provide a
linkage
chemistry which provides a terminal functional moiety (i.e. protected
sulfhydryl moieties).
Functionalized versions of the chelators provide a linkage chemistry which
provides a
terminal functional moiety (i.e. unprotected sulfhydryl moieties).
Functionalized versions of
the chelators provide a linkage chemistry which provides a terminal functional
moiety (i.e.
protected amine moieties). Functionalized versions of the chelators provide a
linkage
chemistry which provides a terminal functional moiety (i.e. unprotected amine
moieties).
Functionalized versions of the chelators provide a linkage chemistry which
provides a
terminal functional moiety (i.e. protected hydroxyl moieties). Functionalized
versions of the
chelators provide a linkage chemistry which provides a terminal functional
moiety (i.e.
unprotected hydroxyl moieties). Functionalized versions of the chelators
provide a linkage
chemistry which provides a terminal functional moiety (i.e. amine-reactive
moieties).
-25-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
Functionalized versions of the chelators provide a linkage chemistry which
provides a
terminal functional moiety (i.e. sulfhydryl-reactive moieties). Functionalized
versions of the
chelators provide a linkage chemistry which provides a terminal functional
moiety (i.e.
photoreactive moieties). Functionalized versions of the chelators provide a
linkage chemistry
which provides a terminal functional moiety (i.e. carboxyl-reactive moieties).
Functionalized
versions of the chelators provide a linkage chemistry which provides a
terminal functional
moiety (i.e. arginine-reactive moieties). Functionalized versions of the
chelators provide a
linkage chemistry which provides a terminal functional moiety (i.e. carbonyl-
reactive
moieties). A direct labeling approach in which a reducing agent converts
disulfide linkages to
free thiols which bind to the radiolabel is also contemplated.
[0059] In various embodiments, the diagnostic label may be
selected from the group
consisting of an enzyme, a nucleic acid, a fluorophore, biotin, avidin,
streptavidin,
digoxigenin, maltose, oligohistidine, 2,4-dintrobenzene, phenylarsenate, a
metal, a peptide
tag, a fluorescent or colored microsphere, a fluorescent particle, and a
colored latex particle.
This list is not meant to be limiting. In various embodiments, the diagnostic
label is an
enzyme. In various embodiments, the diagnostic label is a nucleic acid. In
various
embodiments, the diagnostic label is a fluorophore. In various embodiments,
the diagnostic
label is biotin. In various embodiments, the diagnostic label is avidin. In
various
embodiments, the diagnostic label is streptavidin. In various embodiments, the
diagnostic
label is digoxigenin. In various embodiments, the diagnostic label is maltose.
In various
embodiments, the diagnostic label is oligohistidine. In various embodiments,
the diagnostic
label is 2,4-dintrobenzene. In various embodiments, the diagnostic label is
phenylarsenate. In
various embodiments, the diagnostic label is a metal. In various embodiments,
the diagnostic
label is a peptide tag. In various embodiments, the diagnostic label is a
fluorescent
microsphere. In various embodiments, the diagnostic label is a colored
microsphere. In
various embodiments, the diagnostic label is a fluorescent particle. In
various embodiments,
the diagnostic label is a colored latex particle. Such a label may be
conjugated to the
antibody by means of a crosslinker which contains a maleimide, an alkyl
halide, an aryl
halide, an alpha-haloacyl, an activated aryl, a pyridyl disulfide, a carbonyl,
a carboxyl, a
thiol, a thioester, disulfide, a N-hydroxy-succinimide, or a cyclic
thiolactone, etc.
-26-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[0060] In certain embodiments, the biological specimen is tissue
within a living body,
and the method is an in vivo imaging method. In certain embodiments, the
biological
specimen is tissue within a living body, and the method is an in vivo imaging
method such as
PET imaging. In certain embodiments, the biological specimen is tissue within
a living body,
and the method is an in vivo imaging method single-photon emission computed
tomography
(SPECT) imaging. In certain embodiments, the biological specimen is tissue
within a living
body, and the method is an in vivo imaging method MIRE. In these methods, the
anti-CD103
antibody is detectably labeled according to the requirements of the imaging
methodology
employed. Suitable diagnostic labels are described herein, and include, but
are not limited to,
11C, 13N, 150, 99mTc, 61cu, 62cti, 64cu, 67ciu, 18F, 19F, 66Ga, 67Ga, 681a,
726a, 1231, 1241, "'In,
1771_,U, "SC, 47SC, 86Y, 88Y, 9 Y, 4'Ti, 89Zr, indocyanine green, IRDye 800CW,
fluorescein
(FITC), and magnetic (e.g.,iron oxide) nanoparticles.
[0061] In various embodiments, the anti-CD103 antibody used as
an imaging agent
blocks CD103 binding to its cognate receptor E-cadherin. In various
embodiments, the anti-
CD103 antibody used as an imaging agent does not block CD103 binding to its
cognate
receptor E-cadherin. In various embodiments, the anti-CD103 antibody used as
an imaging
agent partially blocks CD103 binding to its cognate receptor E-cadherin.
Examples of each of
these types of anti-CD103 antibody are described hereinafter.
[0062] In various embodiments, the methods of imaging tissue or
other biological
specimen utilizes an antibody of the invention as an imaging agent.
[0063] In various embodiments, the methods of imaging tissue or
other biological
specimen utilizes an antigen binding fragment of an antibody of the invention
as an imaging
agent.
[0064] In various embodiments, the methods of imaging tissue or
other biological
specimen utilizes an antibody or antigen binding fragment thereof as an
imaging agent which
comprises:
a. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ m NO: 1 or an amino acid sequence differing from SEQ ID NO: 1 by 1,
2, or 3 conservative substitutions,
-27-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
b. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 2 or an amino acid sequence differing from SEQ ID NO: 2 by 1,
2, or 3 conservative substitutions,
c. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 3 or an amino acid sequence differing from SEQ ID NO: 3 by 1,
2, or 3 conservative substitutions,
d. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 4 or an amino acid sequence differing from SEQ ID NO: 4 by 1,
2, or 3 conservative substitutions,
e. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 5 or an amino acid sequence differing from SEQ ID NO: 5 by 1,
2, or 3 conservative substitutions, and
f. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 6 or an amino acid sequence differing from SEQ ID NO: 6 by 1,
2, or 3 conservative substitutions;
or
g. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 9 or an amino acid sequence differing from SEQ ID NO: 9 by 1,
2, or 3 conservative substitutions,
h. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 10 or an amino acid sequence differing from SEQ ID NO: 10 by
1, 2, or 3 conservative substitutions,
i. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 11 or an amino acid sequence differing from SEQ ID NO: 11 by
1, 2, or 3 conservative substitutions,
-28-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
j. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 12 or an amino acid sequence differing from SEQ ID NO: 12 by
1, 2, or 3 conservative substitutions,
k. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 13 or an amino acid sequence differing from SEQ ID NO: 13 by
1, 2, or 3 conservative substitutions, and
1.
a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 14 or an amino acid sequence differing from SEQ ID NO: 14 by
1, 2, or 3 conservative substitutions;
or
m. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 17 or an amino acid sequence differing from SEQ ID NO: 17 by
1, 2, or 3 conservative substitutions,
n. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 18 or an amino acid sequence differing from SEQ ID NO: 18 by
1, 2, or 3 conservative substitutions,
o. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 19 or an amino acid sequence differing from SEQ ID NO: 19 by
1, 2, or 3 conservative substitutions,
p. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 20 or an amino acid sequence differing from SEQ ID NO: 20 by
1, 2, or 3 conservative substitutions,
q. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 21 or an amino acid sequence differing from SEQ ID NO: 21 by
1, 2, or 3 conservative substitutions, and
-29-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
r. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 22 or an amino acid sequence differing from SEQ ID NO: 22 by
1, 2, or 3 conservative substitutions;
or
s. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 25 or an amino acid sequence differing from SEQ ID NO: 25 by
1, 2, or 3 conservative substitutions,
t. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 26 or an amino acid sequence differing from SEQ ID NO: 26 by
1, 2, or 3 conservative substitutions,
u. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 27 or an amino acid sequence differing from SEQ ID NO: 27 by
1, 2, or 3 conservative substitutions,
v. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 28 or an amino acid sequence differing from SEQ ID NO: 28 by
1, 2, or 3 conservative substitutions,
w. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 29 or an amino acid sequence differing from SEQ ID NO: 29 by
1, 2, or 3 conservative substitutions, and
x. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 30 or an amino acid sequence differing from SEQ ID NO: 30 by
1, 2, or 3 conservative substitutions;
or
y. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 33 or an amino acid sequence differing from SEQ ID NO: 33 by
1, 2, or 3 conservative substitutions,
-30-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
z. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 34 or an amino acid sequence differing from SEQ ID NO: 34 by
1, 2, or 3 conservative substitutions,
aa. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 35 or an amino acid sequence differing from SEQ ID NO: 35 by
1, 2, or 3 conservative substitutions,
bb. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 36 or an amino acid sequence differing from SEQ ID NO: 36 by
1, 2, or 3 conservative substitutions,
cc. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 37 or an amino acid sequence differing from SEQ ID NO: 37 by
1, 2, or 3 conservative substitutions, and
dd. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 38 or an amino acid sequence differing from SEQ ID NO: 38 by
1, 2, or 3 conservative substitutions.
[0065] In various other embodiments, the methods of imaging
tissue or other biological
specimen utilizes an antibody or antigen binding fragment thereof as an
imaging agent which
comprises:
a. a heavy chain of the antibody or antigen binding fragment that comprises
the
amino acid sequence of SEQ ID NO: 7 and a light chain of the antibody or
antigen binding fragment that comprises the amino acid sequence of SEQ ID
NO: 8; or
b. a heavy chain of the antibody or antigen binding fragment that comprises
the
amino acid sequence of SEQ ID NO: 15 and a light chain of the antibody or
antigen binding fragment that comprises the amino acid sequence of SEQ ID
NO: 16; or
-31-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
c. a heavy chain of the antibody or antigen binding fragment that comprises
the
amino acid sequence of SEQ ID NO: 23 and a light chain of the antibody or
antigen binding fragment that comprises the amino acid sequence of SEQ ID
NO: 24; or
d. a heavy chain of the antibody or antigen binding fragment that comprises
the
amino acid sequence of SEQ ID NO: 31 and a light chain of the antibody or
antigen binding fragment that comprises the amino acid sequence of SEQ ID
NO: 32; or
e. a heavy chain of the antibody or antigen binding fragment that comprises
the
amino acid sequence of SEQ ID NO: 39 and a light chain of the antibody or
antigen binding fragment that comprises the amino acid sequence of SEQ ID
NO: 40;
or in each case a sequence having at least 95% (and more preferably 97% or
99%) sequence
similarity or identity to a given SEQ ID NO, with any difference in such
sequence being
confined to amino acids that are not a part of a CDR sequence within the SEQ
ID NO.
[0066] In another aspect, the invention relates to methods for
the use of an anti-CD103
antibody of the invention as a therapeutic agent. In a related aspect, the
invention relates to
the use of an anti-CD103 antibody of the invention in the manufacture of a
medicament. In
another related aspect, the invention relates to methods for the use of an
anti-CD103 antibody
of the invention to inhibit CD103 signaling. In another related aspect, the
invention relates to
methods for the use of an anti-CD103 antibody of the invention to block CD103
binding to
E-cadherin.
[0067] In one embodiment, the methods are for treating a CD103
signaling-mediated
condition in an individual in need thereof, and the methods comprise
administering an
effective amount of an anti-CD103 antibody of the inventionto the individual
wherein the
anti-CD103 antibody is optionally coupled to a cytotoxic agent.
[0068] In one embodiment, the methods are for treating a CD103
signaling-mediated
condition in an individual in need thereof, and the methods comprise
administering an
-32-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
effective amount of an antigen binding fragment of an anti-CD103 antibody of
the invention
to the individual wherein the anti-CD103 antibody is optionally coupled to a
cytotoxic agent.
[0069] In one embodiment, the methods are for preventing a CD103
signaling-mediated
condition in an individual in need thereof, and the methods comprise
administering an
effective amount of an anti-CD103 antibody of the invention, or antigen
binding fragment
thereof, to the individual wherein the anti-CD103 antibody is optionally
coupled to a
cytotoxic agent
[0070] In one embodiment, the methods are for preventing a CD103
signaling-mediated
condition in an individual in need thereof, and the methods comprise
administering an
effective amount of an antigen binding fragment of an anti-CD103 antibody of
the invention
to the individual wherein the anti-CD103 antibody is optionally coupled to a
cytotoxic agent
[0071] In another embodiment, the methods are for inhibiting
CD103 signaling in a cell,
and the methods comprise contacting the cell with an anti-CD103 antibody of
the invention,
or antigen binding fragment thereof.
[0072] In another embodiment, the methods are for inhibiting
CD103 binding to E-
cadherin present on a cell, and the methods comprise contacting the cell with
an anti-CD103
antibody of the invention, or antigen binding fragment thereof
[0073] In yet another embodiment, the methods are for depleting
CD103-expressing cells
in an individual, and the methods comprise administering an effective amount
of an anti-
CD103 antibody of the invention, or antigen binding fragment thereof, to the
individual
wherein the anti-CD103 antibody is optionally coupled to a cytotoxic agent.
[0074] In yet another embodiment, the methods are for method for
treating or preventing
a disease selected from the group consisting of Hairy Cell leukemia, HCLy,
intestinal and
extraintestinal lymphomas, enteropathy-associated T-cell lymphoma (EATL), T-
lymphoblastic leukemia/lymphoma (T-ALL), T-cell prolymphocytic leukemia (T-
PLL), adult
T cell leukemia/lymphoma (ATLL), mycosis fungoides (ME), anaplastic large cell
lymphoma ALCL, cutaneous T-cell lymphoma (CTCL), Sezary Syndrome (SS),
Alzheimer's
disease, Parkinson's disease, multiple sclerosis, IgM polyneuropathies,
myasthenia gravis,
atopic dermatitis, allergy, asthma, systemic inflammatory response syndrome
(SIRS), sepsis,
-33-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
septic shock, atherosclerosis, celiac disease, dermatomyositis, scleroderma,
interstitial
cystitis, transplant rejection, graft-versus-host disease, Aicardi-Goutieres
Syndrome,
Hutchison Guilford progeria syndrome, Singleton-Merten Syndrome, proteasome-
associated
autoinflammatory syndrome, SAVI (STING- associated vasculopathy with onset in
infancy),
CANDLE (Chronic Atypical Neutrophilic Dermatosis with Lipodystrophy and
Elevated
Temperature) syndrome, chilblain lupus erythematosus, systemic lupus
erythematosus,
rheumatoid arthritis, juvenile rheumatoid arthritis, Wegener's disease,
inflammatory bowel
disease (e.g. ulcerative colitis, Crohn's disease), idiopathic
thrombocytopenic purpura,
thrombotic thrombocytopenic purpura, autoimmune thrombocytopenia, multiple
sclerosis,
psoriasis, IgA nephropathy, IgM polyneuropathies, glomerulonephritis,
autoimmune
myocarditis, myasthenia gravis, vasculitis, Type 1 diabetes, Type 2 diabetes,
Sjorgen's
syndrome, X-linked reticulate pigmentary disorder, polymyositis,
spondyloenchondrodysplasia, and age-related macular degeneration in an
individual in need
thereof, and the methods comprise administering an effective amount of an anti-
CD103
antibody of the invention, or antigen binding fragment thereof, to the
individual wherein the
anti-CD103 antibody is optionally coupled to a cytotoxic agent.
[0075] In yet another embodiment, the methods are for method for
treating a disease
selected from the group consisting of Hairy Cell leukemia, HCLv, intestinal
and
extraintestinal lymphomas, enteropathy-associated T-cell lymphoma (EATL), T-
lymphoblastic leukemia/lymphoma (T-ALL), T-cell prolymphocytic leukemia (T-
PLL), adult
T cell leukemia/lymphoma (ATLL), mycosis fungoides ( ME), anaplastic large
cell
lymphoma ALCL, cutaneous T-cell lymphoma (CTCL), Sezary Syndrome (SS),
Alzheimer's
disease, Parkinson's disease, multiple sclerosis, IgM polyneuropathies,
myasthenia gravis,
atopic dermatitis, allergy, asthma, systemic inflammatory response syndrome
(SIRS), sepsis,
septic shock, atherosclerosis, celiac disease, dermatomyositis, scleroderma,
interstitial
cystitis, transplant rejection, graft-versus-host disease, Aicardi-Goutieres
Syndrome,
Hutchison Guilford progeria syndrome, Singleton-Merten Syndrome, proteasome-
associated
autoinflammatory syndrome, SAVI (STING- associated vasculopathy with onset in
infancy),
CANDLE (Chronic Atypical Neutrophilic Dermatosis with Lipodystrophy and
Elevated
Temperature) syndrome, chilblain lupus erythematosus, systemic lupus
erythematosus,
rheumatoid arthritis, juvenile rheumatoid arthritis, Wegener's disease,
inflammatory bowel
-34-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
disease (e.g. ulcerative colitis, Crohn's disease), idiopathic
thrombocytopenic purpura,
thrombotic thrombocytopenic purpura, autoimmune thrombocytopenia, multiple
sclerosis,
psoriasis, IgA nephropathy, IgM polyneuropathies, glomerulonephritis,
autoimmune
myocarditis, myasthenia gravis, vasculitis, Type 1 diabetes, Type 2 diabetes,
Sjorgen's
syndrome, X-linked reticulate pigmentary disorder, polymyositis,
spondyloenchondrodysplasia, and age-related macular degeneration in an
individual in need
thereof, and the methods comprise administering an effective amount of an anti-
CD103
antibody of the invention to the individual wherein the anti-CD103 antibody is
optionally
coupled to a cytotoxic agent.
[0076] In yet another embodiment, the methods are for method for
preventing a disease
selected from the group consisting of Hairy Cell leukemia, HCLv, intestinal
and
extraintestinal lymphomas, enteropathy-associated T-cell lymphoma (EATL), T-
lymphoblastic leukemia/lymphoma (T-ALL), T-cell prolymphocytic leukemia (T-
PLL), adult
T cell leukemia/lymphoma (ATLL), mycosis fungoides (MT), anaplastic large cell
lymphoma ALCL, cutaneous T-cell lymphoma (CTCL), Sezary Syndrome (SS),
Alzheimer's
disease, Parkinson's disease, multiple sclerosis, IgM polyneuropathies,
myasthenia gravis,
atopic dermatitis, allergy, asthma, systemic inflammatory response syndrome
(SIRS), sepsis,
septic shock, atherosclerosis, celiac disease, dermatomyositis, scleroderma,
interstitial
cystitis, transplant rejection, graft-versus-host disease, Aicardi-Goutieres
Syndrome,
Hutchison Guilford progeria syndrome, Singleton-Merten Syndrome, proteasome-
associated
autoinflammatory syndrome, SAVI (STING- associated vasculopathy with onset in
infancy),
CANDLE (Chronic Atypical Neutrophilic Dermatosis with Lipodystrophy and
Elevated
Temperature) syndrome, chilblain lupus erythematosus, systemic lupus
erythemato sus,
rheumatoid arthritis, juvenile rheumatoid arthritis, Wegener's disease,
inflammatory bowel
disease (e.g. ulcerative colitis, Crohn's disease), idiopathic
thrombocytopenic purpura,
thrombotic thrombocytopenic purpura, autoimmune thrombocytopenia, multiple
sclerosis,
psoriasis, IgA nephropathy, IgM polyneuropathies, glomerulonephritis,
autoimmune
myocarditis, myasthenia gravis, vasculitis, Type 1 diabetes, Type 2 diabetes,
Sjorgen's
syndrome, X-linked reticulate pigmentary disorder, polymyositis,
spondyloenchondrodysplasia, and age-related macular degeneration in an
individual in need
thereof, and the methods comprise administering an effective amount of an anti-
CD103
-35-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
antibody of the invention to the individual wherein the anti-CD103 antibody is
optionally
coupled to a cytotoxic agent.
[0077] In various embodiments, these methods utilize an antibody
of the invention.
[0078] In various embodiments, these methods utilize antigen
binding fragment of an
antibody of the invention.
[0079] In various embodiments, these methods utilize an antibody
or antigen binding
fragment thereof which comprises:
a. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 1 or an amino acid sequence differing from SEQ ID NO: 1 by 1,
2, or 3 conservative substitutions,
b. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 2 or an amino acid sequence differing from SEQ ID NO: 2 by 1,
2, or 3 conservative substitutions,
c. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 3 or an amino acid sequence differing from SEQ ID NO: 3 by 1,
2, or 3 conservative substitutions,
d. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 4 or an amino acid sequence differing from SEQ ID NO: 4 by 1,
2, or 3 conservative substitutions,
e. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 5 or an amino acid sequence differing from SEQ ID NO: 5 by 1,
2, or 3 conservative substitutions, and
f. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 6 or an amino acid sequence differing from SEQ ID NO: 6 by 1,
2, or 3 conservative substitutions;
or
-36-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
g. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 9 or an amino acid sequence differing from SEQ ID NO: 9 by 1,
2, or 3 conservative substitutions,
h. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 10 or an amino acid sequence differing from SEQ ID NO: 10 by
1, 2, or 3 conservative substitutions,
i. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 11 or an amino acid sequence differing from SEQ ID NO: 11 by
1, 2, or 3 conservative substitutions,
j. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 12 or an amino acid sequence differing from SEQ ID NO: 12 by
1, 2, or 3 conservative substitutions,
k. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 13 or an amino acid sequence differing from SEQ ID NO: 13 by
1, 2, or 3 conservative substitutions, and
1.
a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 14 or an amino acid sequence differing from SEQ ID NO: 14 by
1, 2, or 3 conservative substitutions;
or
m. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 17 or an amino acid sequence differing from SEQ ID NO: 17 by
1, 2, or 3 conservative substitutions,
n. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 18 or an amino acid sequence differing from SEQ ID NO: 18 by
1, 2, or 3 conservative substitutions,
-37-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
o. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 19 or an amino acid sequence differing from SEQ ID NO: 19 by
1, 2, or 3 conservative substitutions,
p. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 20 or an amino acid sequence differing from SEQ ID NO: 20 by
1, 2, or 3 conservative substitutions,
q. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 21 or an amino acid sequence differing from SEQ ID NO: 21 by
1, 2, or 3 conservative substitutions, and
r. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 22 or an amino acid sequence differing from SEQ ID NO: 22 by
1, 2, or 3 conservative substitutions;
or
s. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 25 or an amino acid sequence differing from SEQ ID NO: 25 by
1, 2, or 3 conservative substitutions,
t. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 26 or an amino acid sequence differing from SEQ ID NO: 26 by
1, 2, or 3 conservative substitutions,
u. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 27 or an amino acid sequence differing from SEQ ID NO: 27 by
1, 2, or 3 conservative substitutions,
v. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 28 or an amino acid sequence differing from SEQ ID NO: 28 by
1, 2, or 3 conservative substitutions,
-38-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
w. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 29 or an amino acid sequence differing from SEQ ID NO: 29 by
1, 2, or 3 conservative substitutions, and
x. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 30 or an amino acid sequence differing from SEQ ID NO: 30 by
1, 2, or 3 conservative substitutions;
or
y. a heavy chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 33 or an amino acid sequence differing from SEQ ID NO: 33 by
1, 2, or 3 conservative substitutions,
z. a heavy chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 34 or an amino acid sequence differing from SEQ ID NO: 34 by
1, 2, or 3 conservative substitutions,
aa. a heavy chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 35 or an amino acid sequence differing from SEQ ID NO: 35 by
1, 2, or 3 conservative substitutions,
bb. a light chain variable region CDR1 comprising the amino acid sequence of
SEQ ID NO: 36 or an amino acid sequence differing from SEQ ID NO: 36 by
1, 2, or 3 conservative substitutions,
cc. a light chain variable region CDR2 comprising the amino acid sequence of
SEQ ID NO: 37 or an amino acid sequence differing from SEQ ID NO: 37 by
1, 2, or 3 conservative substitutions, and
dd. a light chain variable region CDR3 comprising the amino acid sequence of
SEQ ID NO: 38 or an amino acid sequence differing from SEQ ID NO: 38 by
1, 2, or 3 conservative substitutions.
-39-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[0080] It is to be understood that the invention is capable of
embodiments in addition to
those described and of being practiced and carried out in various ways. Also,
it is to be
understood that the phraseology and terminology employed herein, as well as
the abstract,
are for the purpose of description and should not be regarded as limiting. As
such, those
skilled in the art will appreciate that the conception upon which this
disclosure is based may
readily be utilized as a basis for the designing of other structures, methods
and systems for
carrying out the several purposes of the present invention. It is important,
therefore, that the
claims be regarded as including such equivalent constructions insofar as they
do not depart
from the spirit and scope of the present invention.
BRIEF DESCRIPTION OF THE FIGURES
[0081] Figure 1: cell ELISA binding data of anti-hCD103 mAbs to
CHO.K1-
hCD103/hBeta7, CHO.K1-rhCD103/rhBeta7, and CHO.K1-hAlpha4/hBeta7.
[0082] Figure 2: Phylogenetic tree for the different hCD103 VL
and VH sequences.
[0083] Figure 3: CELISA binding data of hCD103.01A, hCD103.05A,
hCD103.06A,
Fab.hCD103. 01. Cl, Fab. hCD103. 05. Cl, and Fab. hCD103.06. Cl to
CHO.K1.hCD103/hBeta7, CHO.K1, and recombinant human CD103/Beta7.
[0084] Figure 4: Cellular binding of AF647-hCD103.01A, AF647-
hCD103.05A, AF647-
hCD103.06A, AF647-Fab.hCD103.01.C1, AF647-Fab.hCD103.05.C1, and AF647-
Fab.hCD103.06.C1 to CHO.K1 .hCD103/hBeta7, respectively.
[0085] Figure 5: Representative staining of tumor digest for CD8
and CD103 with
control antibodies or anti-hCD103 mAbs.
[0086] Figure 6: Binding of anti-hCD103 mAb candidates to CD3+
cells (total T-cell
population), CD3+ CD103+ CD8+ cells (T-cell subpopulation), and CD33+ cells
(myeloid
population). N = 10 different tumor digests.
[0087] Figure 7: Staining of tumor digest for CD8 and CD103 with
control reagents or
anti-hCD103 Fabs. Top two rows show staining with parental Fabs (non-labeled)
and
detection with a secondary anti-Fab reagent, while bottom row shows results
for staining
with AF647 conjugated Fabs and direct read-out.
-40-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[0088] Figure 8: CD103+ CD8+ T cells were pre-incubated with our
CD103 mAbs or the
commercial CD103 mAb (Clone BerACT-8, BD bioscience) and subsequently
incubated
with their fluorescently labeled counterparts to study differences in affinity
and competition
between the mAbs. Percentage binding of fluorescently labeled mAbs was
determined using
flow cytometry. Maximum binding was set at 100%.
[0089] Figure 9: CD103+ T cell binding to recombinant E-cadherin
in the presence of
anti-hCD103 mAbs and controls. Antibodies were pre-incubated with cells before
incubation
with recombinant E-cadherin (left set of bars, pre-treatment) or cells were
first incubated
with recombinant E-cadherin whereafter the mAbs were added (right set of bars,
treatment).
[0090] Figure 10: Binding of Df-conjugated and parental anti-
hCD103 mAbs (candidates
hCD103.01A and hCD103.05A), or Fab fragments (candidates Fab.hCD103.01.C1 and
Fab.hCD103.05.C1) to CHO.K1-hCD103/hBeta7.
[0091] Figure 11: Radiochemical purity of 89Zr-labeled anti-
hCD103 mAbs (candidates
hCD103.01A and hCD103.05A) at different 89Zr levels.
[0092] Figure 12: Binding of 89Zr-labeled anti-hCD103 mAbs
(candidates hCD103.01A
and hCD103.05A) to CHO.K1-hCD103/hBeta7 (red) and CHO.K1 (blue). Binding was
measured as amount of 89Zr-mAb bound activity.
[0093] Figure 13A-E: PET imaging protocol for 89Zr-hCD103.01A
and 89Zr-
hCD I 03.05A (13A), PET imaging 2D visualization (coronals) (13B), target to
blood ratio of
59Zr-hCD103. 01 A and 89Zr-hCD103. 05A, and 59Zr-hCD103 01 A and 89Zr-
hCD103.05A
levels in blood versus target tissue, in CHO.K1-hCD103/hBeta7 or CHO.K1 WT
bearing
mice (13C and 13D), and comparative tissue distribution ratios (13E). Tumor
(target) here
means CHO.K1-hCD103/hBeta7 (red and green) or CHO.K1 WT (grey), respectively.
CHO.K1 WT bearing mice were injected with 89Zr-hCD103.01A as an unspecific
control
group.
[0094] Figure 14: Biodistribution results for 89Zr-hCD103.01A
and 89Zr-hCD103.05A in
CHO.K1-hCD103/hBeta7 or CHO.K1 WT bearing mice (n=3) 6 days post-injection.
Tumor
here means CHO.K1-hCD103/hBeta7 (red or green) or CHO.K1 (grey), respectively.
-41 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
CHO.K1 WT bearing mice were injected with 89Zr-hCD103.01A as an unspecific
control
group.
[0095] Figure 15: Biodistribution results for 89Zr-
Fab.hCD103.01.C1 and 89Zr-
Fab.hCD103.05.C1 in CIIO.K1-hCD103/hBeta7 (n=2) or CIIO.K1 WT bearing mice (n=
3)
24 hours post-injection. Tumor here means CHO.K1-hCD103/hBeta7 (red or green)
or
CHO.K1 WT (grey), respectively. CHO.K1 WT bearing mice were injected with 89Zr-
Fab.hCD103.01.C1 as an unspecific control group.
DETAILED DESCRIPTION
[0096] Most, if not all forms of cancer immunotherapy rely on
the induction of T cell-
based immune responses against antigens preferentially or selectively
expressed in cancer
cells and presented via major histocompatibility molecules (MHC) on the cell
surface. This
mode of action is perhaps exemplified most by the exquisite responses of
patients with a high
tumor mutational burden (TMB) to treatment with monoclonal antibodies that
block
programmed death-1 (PD-1) or its ligand (PD-L1). In an effort to extend the
promise of
immunotherapy to more patients, over 2000 (combination) immunotherapy trials
have now
been initiated across numerous types of cancer. Considering this plethora of
treatment
options, biomarkers that can guide drug development, treatment decisions and
assess
therapeutic effects, are urgently needed.
[0097] A hallmark of successful immunotherapy is an increase in
the activity and number
of T cells within the tumor mass (tumor-infiltrating lymphocytes; TIL). TIL
"load" in tumor
lesions therefore represents an attractive biomarker to support selection and
monitoring of
patients for immunotherapy. Unfortunately, there is a wide repertoire of TIL
and not every T
cell within a tumor is involved in the anti-cancer immune response. In recent
years, the
integrin subunit CD103 has come forward as a marker of TIL for prognostic
benefit across
epithelial malignancies, including, esophageal, melanoma, lung, breast,
bladder and all
gynecological cancers. Importantly, CD1 03+ TIL comprise the CD3 9+, PD-1+ and
CD137+
TIL populations previously linked to anti-cancer effects in tumors.
Mechanistic studies have
also demonstrated CD103 to be induced after specific activation of T cells
against their
cognate target, and CD103- cells expand significantly during successful
anti¨PD-1 treatment
in melanoma, esophageal squamous cell carcinoma and non-small cell lung cancer
patients.
-42-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
Finally, CD103 is absent from other immune cell populations in the tumor and
therefore
provides excellent cell specificity. Taken together, intratumoral CD103
detection may
provide an excellent biomarker for determining TIL load and responses to
immunotherapy.
[0098] The current standard for assessing TIL load is through
immunohistochemistry
(IHC) on tissue biopsies. However, there are several obstacles known to be
associated with
biopsy-based techniques, such as poor accessibility of lesions, burden for the
patient, tumor
heterogeneity within and between lesions and sampling errors. Also using
current
technologies, it is difficult/not possible to follow T-cell infiltration in
tumor lesions over
time. In order to overcome these obstacles and obtain information about TIL
load in all tumor
lesions and toxicity-sensitive organs in the patient, noninvasive whole-body
imaging
techniques can be applied. Positron emission tomography (PET) is a molecular
imaging
technique that allows repetitive, non-invasive clinical assessment of tumor
characteristics
such as the expression of hormone and growth factor receptors. PET is
characterized by a
high spatial resolution, sensitivity, and possibility to quantify the imaging
signal. PET could
enable specific monitoring of CD103+ cells in the tumor, provided that a
suitably sensitive
radiopharmaceutical is available. Therefore, here we describe the development
of various
anti-CD103 specific antibodies that are suitable for radiopharmaceutical use.
[0099] In addition to a diagnostic/prognostic target, CD103 also
presents a therapeutic
target in a variety of diseases. For example, CD103 is expressed in several
subsets of
lymphocytes including T cells, intestinal intraepithelial lymphocytes and
lamina propria
lymphocytes. Interaction between CD103 and E-cadherin results in adhesion of
lymphocytes
to epithelial cells. While E-cadherin is constitutively expressed in
epithelial cells, the
expression of CD103 is induced in T cells upon inflammatory stimulation in
vitro. Blockade
of CD103 is of particular relevance in disorders involving expansion of
CD8+and Th9 cells
such as inflammatory bowel disease and in allograft rejection. CD103 is also
expressed by
dendritic cells and on various T cell types, including malignant forms of
these cells.
Additionally, tumor-associated CD103+ CD8 T cells can have a tolerogenic
phenotype, and
CD103+ DCs show expression of immunomodulatory molecules and produce
immunosuppressive factors such as IL-10, TGF-I3, IL-35, and indoleamine 2,3-
dioxygenase
(IDO), resulting in T cell anergy and apoptosis and induction of Tregs.
-43-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00100] Thus, molecules that bind to CD103 and interfere with its interaction
between
CD103 and E-cadherin are drug candidates for the diseases. Likewise, molecules
that bind to
CD103 may be used, for example as part of an antibody-drug conjugate, to
deplete CD103-
expressnw cells for therapeutic purposes.
Definitions
[00101] So that the invention may be more readily understood, certain
technical and
scientific terms are specifically defined below. Unless specifically defined
elsewhere in this
document, all other technical and scientific terms used herein have the
meaning commonly
understood by one of ordinary skill in the art to which this invention
belongs.
[00102] As used herein, including the appended claims, the singular forms of
words such
as "a," "an," and "the," include their corresponding plural references unless
the context
clearly dictates otherwise.
[00103] " A dm i ni strati on" and "treatment," as it applies to
an animal, human, experimental
subject, cell, tissue, organ, or biological fluid, refers to contact of an
exogenous
pharmaceutical, therapeutic, diagnostic agent, or composition to the animal,
human, subject,
cell, tissue, organ, or biological fluid. Treatment of a cell encompasses
contact of a reagent to
the cell, as well as contact of a reagent to a fluid, where the fluid is in
contact with the cell.
"Administration" and "treatment" also means in vitro and ex vivo treatments,
e.g., of a cell,
by a reagent, diagnostic, binding compound, or by another cell.
[00104] "Treat" or "treating" means to administer a therapeutic
agent, such as a
composition containing any of the antibodies or antigen-binding fragments of
the present
invention, internally or externally to a subject or patient having one or more
disease
symptoms, or being suspected of having a disease, for which the agent has
therapeutic
activity. Typically, the agent is administered in an amount effective to
alleviate one or more
disease symptoms in the treated subject or population, whether by inducing the
regression of
or inhibiting the progression of such symptom(s) by any clinically measurable
degree. The
amount of a therapeutic agent that is effective to alleviate any particular
disease symptom
may vary according to factors such as the disease state, age, and weight of
the patient, and
the ability of the drug to elicit a desired response in the subject. Whether a
disease symptom
has been alleviated can be assessed by any clinical measurement typically used
by physicians
-44-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
or other skilled healthcare providers to assess the severity or progression
status of that
symptom.
[00105] "Recombinant expression" of a protein means the transcription and
translation of
an exogenous gene in a host organism to generate the protein, which is
referred to herein as a
recombinant protein."
[00106] The term "Positron Emission Tomography (PET)" as used herein refers to
a
nuclear imaging technique used in the medical field to assist in the diagnosis
of diseases.
PET allows the physician to examine the whole patient at once by producing
pictures of
many functions of the human body unobtainable by other imaging techniques. In
this regard,
PET displays images of how the body works (physiology or function) instead of
simply how
it looks. Applications for PET imaging include those in the fields of
oncology, cardiology,
and neurology. In PET, short-lived positron-emitting isotopes, herein referred
to as
radiopharmaceuticals, are injected into a patient. When these radioactive
drugs are
administered to a patient, they distribute within the body according to the
physiologic
pathways associated with their stable counterparts.
[00107] The term "SPECT" as used herein refers to "Single-Photon Emission
Computed
Tomography which is a nuclear medicine tomographic imaging technique using
gamma rays.
It is very similar to conventional nuclear medicine planar imaging using a
gamma camera
and able to provide true 3D information. This information is typically
presented as cross-
sectional slices through the patient, but can be freely reformatted or
manipulated as required.
The basic technique requires delivery of a gamma-emitting radioisotope (called
radionuclide)
into the patient, normally through injection into the bloodstream.
[00108] By the term "detectable label" is meant, for the purposes of the
specification or
claims, a label molecule that is attached indirectly or directly to an
antibody or antigen-
binding fragment thereof according to the disclosure, wherein the label
molecule facilitates
the detection of the antibody in which it is incorporated. Thus, "detectable
label" is used
synonymously with "label molecule".
[00109] The term "imaging agent" as used herein refers to a labeling moiety
that is useful
for providing an indication of the position of the label and adherents
thereto, in a cell or
tissue of an animal or human subject, or a cell or tissue under in vitro
conditions. While
-45-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
agents may include those that provide detectable signals such as fluorescence,
luminescence,
radioactivity, or can be detected by such methods as MRI imaging, and the
like, in the
context of the probes and methods of use of the disclosure, the term "imaging
agent"
particularly refers to a label detectable by such as PET or SPECT imaging
technology such
as, but not limited to, mcu, 67cu, 89zr, 1241, 86y, 90y, "'in, 123/131%
1 1771_,U, 18F, 99mTC, and the
like. In the most preferred embodiments of the immunoconjugate probes of the
disclosure the
labeling agent is 89-zirconium ( Zr) although it is contemplated that any
metal isotope (or
any other PET-compatible labeling agent) may be used that provides a PET-
generated image
and may be attached or conjugated to the glypican-3 targeting antibody or
antibody fragment.
[00110] The term "biological specimen" refers to a tissue, body
fluid, or other sample
from or in an organism (e.g., a human patient) or from components (e.g.,
cells) of an
organism. The sample may be of any biological tissue or fluid. The specimen
may be a
"clinical sample" which is a sample derived from a patient. Such specimen
include, but are
not limited to, sputum, blood, blood cells (e.g., white cells), amniotic
fluid, plasma, bone
marrow, and tissue or fine needle biopsy samples, urine, peritoneal fluid, and
pleural fluid, or
cells therefrom. Biological specimen may also include tissues or sections of
tissues (such as
frozen or parafin-embedded sections) taken for histological purposes. A
biological specimen
may also be referred to as a "patient sample."
[00111] In certain embodiments a biological specimen may be a tumor, either
within a
living being or removed therefrom. The term "tumor" as used herein refers to
all neoplastic
cell growth and proliferation, whether malignant or benign, and all pre-
cancerous and
cancerous cells and tissues. The terms "cancer" and "cancerous" refer to or
describe the
physiological condition in mammals that is typically characterized by
unregulated cell
growth. In particular, the probes and compositions of the disclosure are most
advantageous
for the detection of a cancer cells of the liver (hepatocellular carcinoma)
and especially of
such cells bearing epitopes of the glypican-3 membrane-bound protein.
Anti-00103 Antibodies and Antigen-Binding Fragments Thereof
[00112] The present invention provides antibodies that bind human CD103 and
uses of
such antibodies. The present invention provides antigen-binding fragments that
bind human
-46-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
CD103 and uses of such fragments. In some embodiments, the anti-CD103
antibodies are
isolated.
[00113] Whether an antibody specifically binds to a polypeptide sequence
(e.g., human
CD103) can be determined using any assay known in the art. Examples of assays
known in
the art to determining binding affinity include surface plasmon resonance
(e.g., BIACORE)
or a similar technique (e.g. KinExa or OCTET).
[00114] As used herein, the term "antibody" refers to any form of antibody
that exhibits
the desired biological activity. The term antibody includes antigen-binding
portions, i.e.,
"antigen binding sites," (e.g., fragments, subsequences, complementarity
determining regions
(CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a
monovalent
fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab')2
fragment, a bivalent
fragment comprising two Fab fragments linked by a disulfide bridge at the
hinge region; (iii)
a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment
consisting of the VL
and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et
al., (1989)
Nature 341:544-546), which consists of a VII domain; and (vi) an isolated
complementarity
determining region (CDR). Single chain antibodies are also included by
reference in the term
"antibody." Preferred therapeutic antibodies are intact IgG antibodies. The
term "intact IgG"
as used herein is meant as a polypeptide belonging to the class of antibodies
that are
substantially encoded by a recognized immunoglobulin gamma gene. In humans
this class
comprises IgG1 , IgG2, IgG3, and IgG4. In mice this class comprises IgG1 ,
IgG2a, IgG2b,
IgG3. The known Ig domains in the IgG class of antibodies are VH, Cyl, C12,
Cy3, VL, and
CL.
[00115] The present invention includes anti-CD103 antigen-binding fragments
and
methods of use thereof.
[00116] As used herein, a "full length antibody- is, in the case of an IgG, a
bivalent
molecule comprising two heavy chains and two light chains. Each heavy chain
comprises a
VH domain followed by a constant domain (Cm), a hinge region, and two more
constant (CH2
and CH3) domains; while each light chain comprises one VL domain and one
constant (CL)
domain. A full length antibody in the case of an IgM is a decavalent or
dodecavalent
-47-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
molecule comprising 5 or 6 linked immunoglobulins in which each immunoglobulin
monomer has two antigen binding sites formed of a heavy and light chain.
[00117] As used herein, unless otherwise indicated, "antibody fragment" or
"antigen-
binding fragment" refers to antigen-binding fragments of antibodies, i.e.
antibody fragments
that retain the ability to bind specifically to the antigen bound by the full-
length antibody,
e.g. fragments that retain one or more CDR regions. Examples of antigen-
binding fragments
include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments;
diabodies; linear
antibodies; single-chain antibody molecules, e.g., sc-Fv; nanobodies and
multispecific
antibodies formed from antibody fragments.
[00118] The present invention includes anti-CD103 Fab fragments and methods of
use
thereof A "Fab fragment" is comprised of one light chain and the CH1 and
variable regions
of one heavy chain. The heavy chain of a Fab molecule cannot form a disulfide
bond with
another heavy chain molecule. A "Fab fragment" can be the product of papain
cleavage of an
antibody.
[00119] The present invention includes anti-CD103 antibodies and antigen-
binding
fragments thereof which comprise an Fc region and methods of use thereof. An
"Fc" region
contains two heavy chain fragments comprising the CH3 and CH2 domains of an
antibody.
The two heavy chain fragments are held together by two or more disulfide bonds
and by
hydrophobic interactions of the C113 domains.
[00120] The present invention includes anti-CD103 Fab' fragments and methods
of use
thereof A "Fab' fragment" contains one light chain and a portion or fragment
of one heavy
chain that contains the VH domain and the C H1 domain and also the region
between the CH1
and C H2 domains, such that an interchain disulfide bond can be formed between
the two
heavy chains of two Fab' fragments to form a F(ab') 2 molecule.
[00121] The present invention includes anti-CD103 F(ab')2 fragments and
methods of use
thereof A "F(ab')2 fragment" contains two light chains and two heavy chains
containing a
portion of the constant region between the CHi and CH2 domains, such that an
interchain
disulfide bond is formed between the two heavy chains. A F(ab') 2 fragment
thus is composed
of two Fab' fragments that are held together by a disulfide bond between the
two heavy
chains. An "F(ab')2 fragment" can be the product of pepsin cleavage of an
antibody.
-48-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00122] The present invention includes anti-CD103 Fv fragments and methods of
use
thereof. The "Fv region" comprises the variable regions from both the heavy
and light chains,
but lacks the constant regions.
[00123] The present invention includes anti-CD103 scFv fragments and methods
of use
thereof The term "single-chain Fv" or "scFv" antibody refers to antibody
fragments
comprising the Vu and VL domains of an antibody, wherein these domains are
present in a
single polypeptide chain. Generally, the Fv polypeptide further comprises a
polypeptide
linker between the VH and VL domains which enables the scFv to form the
desired structure
for antigen-binding. For a review of scFv, see Pluckthun (1994) THE
PHARMACOLOGY OF
MONOCLONAL ANTIBODIES, vol. 113, Rosenburg and Moore eds. Springer-Verlag, New
York, pp. 269-315. See also, International Patent Application Publication No.
WO 88/01649
and U.S. Pat. Nos. 4,946, 778 and 5,260,203.
[00124] The present invention includes anti-CD103 domain antibodies and
methods of use
thereof A "domain antibody" is an immunologically functional immunoglobulin
fragment
containing only the variable region of a heavy chain or the variable region of
a light chain. In
some instances, two or more Vu regions are covalently joined with a peptide
linker to create a
bivalent domain antibody. The two VII regions of a bivalent domain antibody
may target the
same or different antigens.
[00125] The present invention includes anti-CD103 bivalent antibodies and
methods of
use thereof A "bivalent antibody" comprises two antigen-binding sites. In some
instances,
the two binding sites have the same antigen specificities. However, bivalent
antibodies may
be bi specific (see below).
[00126] The present invention includes anti-CD103 diabodies and methods of use
thereof.
As used herein, the term "diabodies' refers to small antibody fragments with
two antigen-
binding sites, which fragments comprise a heavy chain variable domain (Vri)
connected to a
light chain variable domain (VL) in the same polypeptide chain (VH-Vi_ or VL-
VH). By using
a linker that is too short to allow pairing between the two domains on the
same chain, the
domains are forced to pair with the complementary domains of another chain and
create two
antigen-binding sites. Diabodies are described more fully in, e.g., EP
404,097; WO
93/11161; and Holliger et a/. (1993) Proc. Nall. Acad. Sci. USA 90: 6444-6448.
Duobodies
-49-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
are described in Labrijn et al., 2013, Proc. Natl. Acad. Sci. USA 110 (13):
5145-5150. For a
review of engineered antibody variants generally see Holliger and Hudson
(2005) Nat.
Biotechnol . 23 : 1126-1136.
[00127] Typically, an antibody or antigen-binding fragment of the invention
which is
modified in some way retains at least 10% of its binding activity (when
compared to the
parental antibody) when that activity is expressed on a molar basis.
Preferably, an antibody
or antigen-binding fragment of the invention retains at least 20%, 50%, 70%,
80%, 90%,
95% or 100% or more of the CD103 binding affinity as the parental antibody. It
is also
intended that an antibody or antigen-binding fragment of the invention can
include
conservative or non-conservative amino acid substitutions (referred to as
"conservative
variants" or "function conserved variants" of the antibody) that do not
substantially alter its
biologic activity.
[00128] The present invention includes isolated anti-CD103
antibodies and antigen-
binding fragments thereof and methods of use thereof Herein, the term
"isolated" is not
intended to refer to a complete absence of such biological molecules or to an
absence of
water, buffers, or salts or to components of a pharmaceutical formulation that
includes the
antibodies or fragments. An "isolated" antibody, antigen-binding fragment,
nucleic acid, etc.,
is one which has been identified and separated and/or recovered from one or
more
components of its natural environment. In preferred embodiments, the antibody,
antigen-
binding fragment, nucleic acid, etc., is purified to 75% by weight or more,
more preferably to
90% by weight or more, still more preferably to 95% by weight or more, and
still more
preferably to 98% by weight or more. Thus, "isolated" biological molecules are
at least
partially free of other biological molecules from the cells or cell cultures
in which they are
produced. Such biological molecules include nucleic acids, proteins, lipids,
carbohydrates, or
other material such as cellular debris and growth medium. An isolated antibody
or antigen-
binding fragment may further be at least partially free of expression system
components such
as biological molecules from a host cell or of the growth medium thereof
[00129] The present invention includes anti-CD103 chimeric antibodies (e.g.,
human
constant domain/mouse variable domain) and methods of use thereof. As used
herein, a
"chimeric antibody" is an antibody having the variable domain from a first
antibody and the
-50-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
constant domain from a second antibody, where the first and second antibodies
are from
different species. (U.S. Pat. No. 4,816,567; and Morrison etal., (1984) Proc.
Natl. Acad. Sc!.
USA 81: 6851-6855). Typically, the variable domains are obtained from an
antibody from an
experimental animal (the "parental antibody"), such as a rodent, and the
constant domain
sequences are obtained from human antibodies, so that the resulting chimeric
antibody will
be less likely to elicit an adverse immune response in a human subject than
the parental (e.g.,
mouse) antibody.
[00130] The present invention includes anti-CD103 humanized antibodies and
antigen-
binding fragments thereof (e.g., rat or mouse antibodies that have been
humanized) and
methods of use thereof. As used herein, the term "humanized antibody" refers
to forms of
antibodies that contain sequences from both human and non-human (e.g., mouse
or rat)
antibodies. In general, the humanized antibody will comprise substantially of
at least one,
and typically two, variable domains, in which all or substantially all of the
hypervariable
loops correspond to those of a non-human immunoglobulin, and all or
substantially all of the
framework (FR) regions are those of a human immunoglobulin sequence. The
humanized
antibody may optionally comprise at least a portion of a human immunoglobulin
constant
region (Fc). For more details about humanized antibodies, see, e.g., Jones et
al., Nature,
321:522-525 (1986); Reichmann et al., Nature, 332:323-329 (1988); Presta, Cum
Op. Struct.
Biol., 2:593-596 (1992); and Clark, 1111111tmol. Today 21: 397-402 (2000).
[00131] In general, the basic antibody structural unit comprises a tetramer.
Each tetramer
includes two identical pairs of polypeptide chains, each pair having one
"light" (about 25
kDa) and one "heavy" chain (about 50-70 kDa). The amino-terminal portion of
each chain
includes a variable region of about 100 to 110 or more amino acids primarily
responsible for
antigen recognition. The carboxy-terminal portion of the heavy chain may
define a constant
region primarily responsible for effector function. Typically, human light
chains are
classified as kappa and lambda light chains. Furthermore, human heavy chains
are typically
classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's
isotype as IgM,
IgD, IgG, IgA, and IgE, respectively. Within light and heavy chains, the
variable and
constant regions are joined by a "J" region of about 12 or more amino acids,
with the heavy
chain also including a "D" region of about 10 more amino acids. See generally,
Fundamental
Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).
-51 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00132] The variable regions of each light/heavy chain pair form the antibody
binding site.
Thus, in general, an intact antibody has two binding sites. Except in
bifunctional or bispecific
antibodies, the two binding sites are, in general, the same.
[00133] Typically, the variable domains of both the heavy and light chains
comprise three
hypervariable regions, also called complementarity determining regions (CDRs),
located
within relatively conserved framework regions (FR). The CDRs are usually
aligned by the
framework regions, enabling binding to a specific epitope. In general, from N-
terminal to C-
terminal, both light and heavy chains variable domains comprise FR1, CDRI,
FR2, CDR2,
FR3, CDR3 and FR4. The assignment of amino acids to each domain is, generally,
in
accordance with the definitions of Sequences of Proteins of Immunological
Interest, Kabat, et
al.; National Institutes of Health, Bethesda, MD; 5th e ,.;
a NI11-1 Publ. No. 91-3242 (1991);
Kabat (1978) Adv. Prot. Chem. 32:1-75; Kabat, et al., (1977) J. Biol. Chem.
252:6609-6616;
Chothia, etal., (1987)J Ma/. Biol. 196:901-917 or Chothia, etal., (1989)
Nature 342:878-
883.
[00134] As used herein, the term "hypervariable region" refers to the amino
acid residues
of an antibody or antigen-binding fragment thereof that are responsible for
antigen-binding.
The hypervariable region comprises amino acid residues from a "
complementarity
determining region" or "CDR" (i.e. CDRLI, CDRL2 and CDRL3 in the light chain
variable
domain and CDRH I, CDRH2 and CDRH3 in the heavy chain variable domain). See
Kabat et
al. (1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public
Health Service,
National Institutes of Health, Bethesda, Md. (defining the CDR regions of an
antibody by
sequence); see also Chothia and Lesk (1987) J. MoL Biol. 196: 901-917
(defining the CDR
regions of an antibody by structure). As used herein, the term "framework" or
"FR" residues
refers to those variable domain residues other than the hypervariable region
residues defined
herein as CDR residues.
[00135] "Isolated nucleic acid molecule" or -isolated polynucleotide" means a
DNA or
RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof
which is
not associated with all or a portion of a polynucleotide in which the isolated
polynucleotide is
found in nature, or is linked to a polynucleotide to which it is not linked in
nature. For
purposes of this disclosure, it should be understood that "a nucleic acid
molecule comprising"
-52-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
a particular nucleotide sequence does not encompass intact chromosomes.
Isolated nucleic
acid molecules "comprising" specified nucleic acid sequences may include, in
addition to the
specified sequences, coding sequences for up to ten or even up to twenty or
more other
proteins or portions or fragments thereof, or may include operably linked
regulatory
sequences that control expression of the coding region of the recited nucleic
acid sequences,
and/or may include vector sequences.
[00136] The phrase "control sequences" refers to DNA sequences necessary for
the
expression of an operably linked coding sequence in a particular host
organism. The control
sequences that are suitable for prokaryotes, for example, include a promoter,
optionally an
operator sequence, and a ribosome binding site. Eukaryotic cells are known to
use promoters,
polyadenylation signals, and enhancers.
[00137] A nucleic acid or polynucleotide is "operably linked"
when it is placed into a
functional relationship with another nucleic acid sequence. For example, DNA
for a
presequence or secretory leader is operably linked to DNA for a polypeptide if
it is expressed
as a preprotem that participates in the secretion of the polypeptide, a
promoter or enhancer is
operably linked to a coding sequence if it affects the transcription of the
sequence; or a
ribosome binding site is operably linked to a coding sequence if it is
positioned so as to
facilitate translation. Generally, but not always, "operably linked" means
that the DNA
sequences being linked are contiguous, and, in the case of a secretory leader,
contiguous and
in reading phase. However, enhancers do not have to be contiguous. Linking is
accomplished
by ligation at convenient restriction sites. If such sites do not exist, the
synthetic
oligonucleotide adaptors or linkers are used in accordance with conventional
practice.
[00138] As used herein, the expressions "cell," "cell line," and
"cell culture" are used
interchangeably and all such designations include progeny. Thus, the words
"transformants"
and "transformed cells" include the primary subject cell and cultures derived
therefrom
without regard for the number of transfers. It is also understood that not all
progeny will have
precisely identical DNA content, due to deliberate or inadvertent mutations.
Mutant progeny
that have the same function or biological activity as screened for in the
originally
transformed cell are included. Where distinct designations are intended, it
will be clear from
the context.
-53-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00139] As used herein, "germline sequence" refers to a sequence of
unrearranged
immunoglobulin DNA sequences. Any suitable source of unrearranged
immunoglobulin
sequences may be used. Human germline sequences may be obtained, for example,
from
JOINS OLVER germline databases on the website for the National Institute of
Arthritis and
Musculoskeletal and Skin Diseases of the United States National Institutes of
Health. Mouse
germline sequences may be obtained, for example, as described in Giudicelli et
al. (2005)
Nucleic Acids Res. 33: D256-D261.
Binding Affinity
[00140] By way of example, and not limitation, the antibodies disclosed herein
may bind
human CD103 bivalently with a KD value of 10 x 10-9M or lower as determined by
surface
plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or bio-
layer
interferometry (OCTET)). In one embodiment, the antibodies disclosed herein
may bind
human CD103 bivalently with a KD value of about 5-10 x 10-9M. The Kd value may
be
determined by surface plasmon resonance (e.g., BIACORE). The Kd value may be
determined by similar techniques (e.g. KinExa or OCTET). By way of example,
and not
limitation, the antigen-binding fragments disclosed herein may bind human
CD103
bivalently with a KD value of 10 x 10-9M or lower as determined by surface
plasmon
resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or bio-layer
interferometry
(OCTET)). In one embodiment, the antigen-binding fragments disclosed herein
may bind
human CD103 bivalently with a KD value of about 5-10 x 10-9M. The Kd value may
be
determined by surface plasmon resonance (e.g., BIACORE). The Kd value may be
determined by similar techniques (e.g. KinExa or OCTET). Affinity is
calculated as KD =
koffikon (koff is the dissociation rate constant, Kon is the association rate
constant and KD is the
equilibrium constant). Affinity can be determined at equilibrium by measuring
the fraction
bound (r) of labeled ligand at various concentrations (c). The data are
graphed using the
Scatchard equation: r/c = K(n-r): where r = moles of bound ligand/mole of
receptor at
equilibrium; c = free ligand concentration at equilibrium; K = equilibrium
association
constant; and n = number of ligand binding sites per receptor molecule. By
graphical
analysis, r/c is plotted on the Y-axis versus r on the X-axis, thus producing
a Scatchard plot.
Antibody affinity measurement by Scatchard analysis is well known in the art.
See, e.g., van
-54-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
Erp etal., J. Immunoassay 12: 425-43, 1991; Nelson and Griswold, Comput.
Methods
Programs Biomed. 27: 65-8, 1988.
Methods of Making Antibodies and Antigen-binding Fragments Thereof
[00141] Thus, the present invention includes methods for making an anti-CD103
antibody
or antigen-binding fragment thereof of the present invention comprising
culturing a
hybridoma cell that expresses the antibody or fragment under condition
favorable to such
expression and, optionally, isolating the antibody or fragment from the
hybridoma and/or the
growth medium (e.g. cell culture medium).
[00142] The anti-CD103 antibodies disclosed herein may also be produced
recombinantly
(e.g., in an E. colilT7 expression system, a mammalian cell expression system
or a lower
eukaryote expression system). In this embodiment, nucleic acids encoding the
antibody
immunoglobulin molecules of the invention (e.g., Vx or VL) may be inserted
into a pET-
based plasmid and expressed in the E. colilT7 system. For example, the present
invention
includes methods for expressing an antibody or antigen-binding fragment
thereof or
immunoglobulin chain thereof in a host cell (e.g., bacterial host cell such as
E.coli such as
BL21 or BL21DE3) comprising expressing T7 RNA polymerase in the cell which
also
includes a polynucleotide encoding an immunoglobulin chain that is operably
linked to a T7
promoter. For example, in an embodiment of the invention, a bacterial host
cell, such as a E.
colt, includes a polynucleotide encoding the T7 RNA polymerase gene operably
linked to a
lac promoter and expression of the polymerase and the chain is induced by
incubation of the
host cell with IPTG (isopropyl-beta-D-thiogalactopyranoside).
[00143] There are several methods by which to produce recombinant antibodies
which are
known in the art. One example of a method for recombinant production of
antibodies is
disclosed in U.S. Patent No. 4,816,567.
[00144] Transformation can be by any known method for introducing
polynucleotides into
a host cell. Methods for introduction of heterologous polynucleotides into
mammalian cells
are well known in the art and include dextran-mediated transfection, calcium
phosphate
precipitation, polybrene-mediated transfecti on, protoplast fusion, el
ectroporation,
-55-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
encapsulation of the polynucleotide(s) in liposomes, biolistic injection and
direct
microinjection of the DNA into nuclei. In addition, nucleic acid molecules may
be introduced
into mammalian cells by viral vectors. Methods of transforming cells are well
known in the
art. See, for example, U.S. Patent Nos. 4,399,216; 4,912,040; 4,740,461 and
4,959,455.
[00145] Thus, the present invention includes recombinant methods for making an
anti-
CD103 antibody or antigen-binding fragment thereof of the present invention,
or an
immunoglobulin chain thereof, comprising introducing a polynucleotide encoding
one or
more immunoglobulin chains of the antibody or fragment (e.g., heavy and/or
light
immunoglobulin chain); culturing the host cell (e.g., CHO or Pichia or Pichia
pastoris) under
condition favorable to such expression and, optionally, isolating the antibody
or fragment or
chain from the host cell and/or medium in which the host cell is grown.
[00146] Anti-CD103 antibodies can also be synthesized by any of
the methods set forth in
U.S. Patent No. 6,331,415.
[00147] Eukaryotic and prokaryotic host cells, including mammalian cells as
hosts for
expression of the antibodies or fragments or immunoglobulin chains disclosed
herein are well
known in the art and include many immortalized cell lines available from the
American Type
Culture Collection (ATCC). These include, inter al/a, Chinese hamster ovary
(CHO) cells,
NSO, SP2 cells, HeLa cells, baby hamster kidney (MK) cells, monkey kidney
cells (COS),
human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells,
HEK-293 cells
and a number of other cell lines. Mammalian host cells include human, mouse,
rat, dog,
monkey, pig, goat, bovine, horse and hamster cells. Cell lines of particular
preference are
selected through determining which cell lines have high expression levels.
Other cell lines
that may be used are insect cell lines, such as Sf9 cells, amphibian cells,
bacterial cells, plant
cells and fungal cells. Fungal cells include yeast and filamentous fungus
cells including, for
example, Pichia pastor/s. Pichia finlandica, Pichia trehalophila, Pichia
koclamae, Pichia
membranaefaciens, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia
opuntiae,
Pichia therm otolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi,
Pichia stiptis,
Pichia methanol/ca, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp.,
Hansenula
polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida albi cans,
Aspergillus
nidulans, Aspergillus niger, Aspergillus oryzae, Trichoderma reesei,
Chrysosporium
-56-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
lucknowense, Fusarium sp., Fusarium gramineum, Fusarium venenatum,
Physcomitrella
patens and Neurospora crassa. Pichia sp., any Saccharomyces sp., Hansenula
polymorpha,
any Kluyveromyces sp., Candida albicans, any Aspergillus sp., Trichoderma
reesei,
Chrysosporium lucknowense, any Fusarium sp., Yarrowia lipolytica, and
Neurospora crassa.
When recombinant expression vectors encoding the heavy chain or antigen-
binding portion
or fragment thereof, and/or the light chain or antigen-binding fragment
thereof are introduced
into mammalian host cells, the antibodies are produced by culturing the host
cells for a
period of time sufficient to allow for expression of the antibody or fragment
or chain in the
host cells or secretion into the culture medium in which the host cells are
grown.
[00148] Antibodies and antigen-binding fragments thereof and immunoglobulin
chains
can be recovered from the culture medium using standard protein purification
methods.
Further, expression of antibodies and antigen-binding fragments thereof and
immunoglobulin
chains of the invention (or other moieties therefrom) from production cell
lines can be
enhanced using a number of known techniques. For example, the glutamine
synthetase gene
expression system (the GS system) is a common approach for enhancing
expression under
certain conditions. The GS system is discussed in whole or part in connection
with European
Patent Nos. 0216846, 0256055, and 0323997 and 0338841. Thus, in an embodiment
of the
invention, the mammalian host cells (e.g., CHO) lack a glutamine synthetase
gene and are
grown in the absence of glutamine in the medium wherein, however, the
polynucleotide
encoding the immunoglobulin chain comprises a glutamine synthetase gene which
complements the lack of the gene in the host cell.
[00149] The present invention includes methods for purifying an anti-CD103
antibody or
antigen-binding fragment thereof of the present invention comprising
introducing a sample
comprising the antibody or fragment to a purification medium (e.g., cation
exchange
medium, anion exchange medium, hydrophobic exchange medium, affinity
purification
medium (e.g., protein-A, protein-G, protein-A/G, protein-L)) and either
collecting purified
antibody or fragment from the flow-through fraction of said sample that does
not bind to the
medium; or, discarding the flow-through fraction and eluting bound antibody or
fragment
from the medium and collecting the eluate. In an embodiment of the invention,
the medium is
in a column to which the sample is applied. In an embodiment of the invention,
the
purification method is conducted following recombinant expression of the
antibody or
-57-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
fragment in a host cell, e.g., wherein the host cell is first lysed and,
optionally, the lysate is
purified of insoluble materials prior to purification on a medium.
[00150] In general, glycoproteins produced in a particular cell line or
transgenic animal
will have a glycosylation pattern that is characteristic for glycoproteins
produced in the cell
line or transgenic animal. Therefore, the particular glycosylation pattern of
an antibody will
depend on the particular cell line or transgenic animal used to produce the
antibody.
However, all antibodies encoded by the nucleic acid molecules provided herein,
or
comprising the amino acid sequences provided herein, comprise the instant
invention,
independent of the glycosylation pattern the antibodies may have. Similarly,
in particular
embodiments, antibodies with a glycosylation pattern comprising only non-
fucosylated N-
glycans may be advantageous, because these antibodies have been shown to
typically exhibit
more potent efficacy than their fucosylated counterparts both in vitro and in
vivo (See for
example, Shinkawa et al., I Biol. Chem. 278: 3466-3473 (2003); U.S. Patent
Nos. 6,946,292
and 7,214,775). These antibodies with non-fucosylated N-glycans are not likely
to be
immunogenic because their carbohydrate structures are a normal component of
the
population that exists in human serum IgG.
[00151] The present invention further includes anti-CD103 antigen-binding
fragments of
the anti-CD103 antibodies disclosed herein. The antibody fragments include
F(ab)2
fragments, which may be produced by enzymatic cleavage of an IgG by, for
example, pepsin.
Fab fragments may be produced by, for example, reduction of F(ab)2 with
dithiothreitol or
mercaptoethylamine.
[00152] Immunoglobulins may be assigned to different classes depending on the
amino
acid sequences of the constant domain of their heavy chains. In some
embodiments, different
constant domains may be appended to humanized VL and VH regions derived from
the CDRs
provided herein. There are at least five major classes of immunoglobulins:
IgA, IgD, IgE,
IgG and IgM, and several of these may be further divided into subclasses
(isotypes), e.g.
IgGl, IgG2, IgG3 and IgG4; IgAl and IgA2. The invention comprises antibodies
and
antigen-binding fragments of any of these classes or subclasses of antibodies.
[00153] In one embodiment, the antibody or antigen-binding fragment comprises
a heavy
chain constant region, e.g. a human constant region, such as yl, y2, y3, or y4
human heavy
-58-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
chain constant region or a variant thereof. In another embodiment, the
antibody or antigen-
binding fragment comprises a light chain constant region, e.g. a human light
chain constant
region, such as lambda or kappa human light chain region or variant thereof.
By way of
example, and not limitation the human heavy chain constant region can be y4
and the human
light chain constant region can be kappa. In an alternative embodiment, the Fe
region of the
antibody is y4 with a Ser228Pro mutation (Schuurman, J et. al., Mal Immunol.
38: 1-8,
2001).
[00154] In one embodiment, the antibody or antigen-binding fragment comprises
a heavy
chain constant region of the IgG1 subtype. In one embodiment, the antibody or
antigen-
binding fragment comprises a heavy chain constant region of the IgG2 subtype.
In one
embodiment, the antibody or antigen-binding fragment comprises a heavy chain
constant
region of the IgG4 subtype.
Antibody Engineering
[00155] Further included are embodiments in which the anti-CD103 antibodies
and
antigen-binding fragments thereof are engineered antibodies to include
modifications to
framework residues within the variable domains the antibody, e.g. to improve
the properties
of the antibody or fragment. Typically, such framework modifications are made
to decrease
the immunogenicity of the antibody or fragment. This is usually accomplished
by replacing
non-CDR residues in the variable domains (i.e. framework residues) in a
parental (e.g.
rodent) antibody or fragment with analogous residues from the immune
repertoire of the
species in which the antibody is to be used, e.g. human residues in the case
of human
therapeutics. Such an antibody or fragment is referred to as a "humanized"
antibody or
fragment. In some cases, it is desirable to increase the affinity, or alter
the specificity of an
engineered (e.g. humanized) antibody. One approach is to mutate one or more
framework
residues to the corresponding germline sequence. More specifically, an
antibody or fragment
that has undergone somatic mutation can contain framework residues that differ
from the
germline sequence from which the antibody is derived. Such residues can be
identified by
comparing the antibody or fragment framework sequences to the germline
sequences from
which the antibody or fragment is derived. Another approach is to revert to
the original
parental (e.g., rodent) residue at one or more positions of the engineered
(e.g. humanized)
-59-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
antibody, e.g. to restore binding affinity that may have been lost in the
process of replacing
the framework residues. (See, e.g. ,U U.S. Patent No. 5,693,762, U.S. Patent
No. 5,585,089 and
U.S. Patent No. 5,530,101).
[00156] In certain embodiments, the anti-CD103 antibodies and antigen-binding
fragments thereof are engineered (e.g. humanized) to include modifications in
the framework
and/or CDRs to improve their properties. Such engineered changes can be based
on
molecular modelling. A molecular model for the variable region for the
parental (non-
human) antibody sequence can be constructed to understand the structural
features of the
antibody and used to identify potential regions on the antibody that can
interact with the
antigen. Conventional CDRs are based on alignment of immunoglobulin sequences
and
identifying variable regions. Kabat et al., (1991) Sequences of Proteins of
Immunological
Interest, Kabat, et al.; National Institutes of Health, Bethesda, MID; 5th
ed.; NIH Publ. No. 91-
3242; Kabat (1978) Ad-v. Prot. Chem. 32:1-75; Kabat, etal., (1977) 1 Biol.
Chem. 252:6609-
6616. Chothia and coworkers carefully examined conformations of the loops in
crystal
structures of antibodies and proposed hypervariable loops. Chothia, etal.,
(1987) .1- Mot Biol.
196:901-917 or Chothia, etal., (1989) Nature 342:878-883. There are variations
between
regions classified as "CDRs- and "hypervariable loops-. Later studies
(Raghunathan et al,
(2012) / Mol Recog. 25, 3, 103-113) analyzed several antibody -antigen crystal
complexes
and observed that the antigen binding regions in antibodies do not necessarily
conform
strictly to the "CDR" residues or "hypervariable" loops. The molecular model
for the
variable region of the non-human antibody can be used to guide the selection
of regions that
can potentially bind to the antigen. In practice the potential antigen binding
regions based on
the model differ from the conventional "CDR"s or "hypervariable" loops.
Commercial
scientific software such as Discovery Studio (BIOVIA, Dassault Systems)) can
be used for
molecular modeling. Human frameworks can be selected based on best matches
with the
non-human sequence both in the frameworks and in the CDRs. For FR4 (framework
4) in
VII, VJ regions for the human germlines are compared with the corresponding
non-human
region. In the case of FR4 (framework 4) in VL, J-kappa and J-Lambda regions
of human
germline sequences are compared with the corresponding non-human region. Once
suitable
human frameworks are identified, the CDRs are grafted into the selected human
frameworks.
In some cases, certain residues in the VL-VH interface can be retained as in
the non-human
-60-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
(parental) sequence. Molecular models can also be used for identifying
residues that can
potentially alter the CDR conformations and hence binding to antigen. In some
cases, these
residues are retained as in the non-human (parental) sequence. Molecular
models can also be
used to identify solvent exposed amino acids that can result in unwanted
effects such as
glycosylation, deamidation and oxidation. Developability filters can be
introduced early on in
the design stage to eliminate/minimize these potential problems.
[00157] Another type of framework modification involves mutating one or more
residues
within the framework region, or even within one or more CDR regions, to remove
T cell
epitopes to thereby reduce the potential immunogenicity of the antibody. This
approach is
also referred to as "deimmunization" and is described in further detail in
U.S. Patent No.
7,125,689.
[00158] In particular embodiments, it will be desirable to change certain
amino acids
containing exposed side-chains to another amino acid residue in order to
provide for greater
chemical stability of the final antibody, so as to avoid deamidation or
isomerization. The
deamidation of asparagine may occur on NG, DG, NG, NS, NA, NT, QG or QS
sequences
and result in the creation of an isoaspartic acid residue that introduces a
kink into the
polypeptide chain and decreases its stability (isoaspartic acid effect).
Isomerization can occur
at DG, DS, DA or DT sequences. In certain embodiments, the antibodies of the
present
disclosure do not contain deamidation or asparagine isomerism sites.
[00159] For example, an asparagine (Asn) residue may be changed to Gln or Ala
to reduce
the potential for formation of isoaspartate at any Asn-Gly sequences,
particularly within a
CDR. A similar problem may occur at a Asp-Gly sequence. Reissner and Aswad
(2003) Cell.
Mol Life Sci. 60:1281. Isoaspartate formation may debilitate or completely
abrogate binding
of an antibody to its target antigen. See, Presta (2005) 1 Allergy Clin.
Inimunol. 116:731 at
734. In one embodiment, the asparagine is changed to glutamine (GM). It may
also be
desirable to alter an amino acid adjacent to an asparagine (Asn) or glutamine
(GM) residue to
reduce the likelihood of deamidation, which occurs at greater rates when small
amino acids
occur adjacent to asparagine or glutamine. See, Bischoff & Kolbe (1994) 1
Chrornatog.
662:261. In addition, any methionine residues (typically solvent exposed Met)
in CDRs may
be changed to Lys, Leu, Ala, or Phe or other amino acids in order to reduce
the possibility
-61-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
that the methionine sulfur would oxidize, which could reduce antigen-binding
affinity and
also contribute to molecular heterogeneity in the final antibody preparation.
Id. Additionally,
in order to prevent or minimize potential scissile Asn-Pro peptide bonds, it
may be desirable
to alter any Asn-Pro combinations found in a CDR to Gln-Pro, Ala-Pro, or Asn-
Ala.
Antibodies with such substitutions are subsequently screened to ensure that
the substitutions
do not decrease the affinity or specificity of the antibody for CD103, or
other desired
biological activity to unacceptable levels.
TABLE 2. Exemplary stabilizing CDR variants
CDR Residue Stabilizing Variant
Sequence
Asn-Gly Gln-Gly, Ala-Gly, or Asn-Ala
(N-G) (Q-G), (A-G), or (N-A)
Asp-Gly Glu-Gly, Ala-Gly or Asp-Ala
(D-G) (E-G), (A-G), or (D-A)
Met Lys, Leu, Ala, or Phe
(M) (K), (L), (A), or (F)
Asn Gln or Ala
(N) (Q) or (A)
Asn-Pro Gln-Pro, Ala-Pro, or Asn-Ala
(N-P) (Q-P), (A-P), or (N-A)
[00160] Another type of framework modification involves mutating one or more
residues
within the framework regions to prevent aggregation. The risk of an antibody
to aggregate
can be assessed using the spatial aggregation propensity -See, Chennamsetty, N
et al (2010)
J. Phys. Chem. 114, 6614-6624. The method requires the calculation of the
Solvent
Accessible Area (SAA) for each atom. The molecular aggregation score is then
calculated as
the sum of all atomic scores. For a given radius and size of molecule, this is
an approximate
indication of its overall tendency to aggregate. Residues with a high
aggregation score are
replaced by residues with a lower score (e.g. more hydrophilic amino acids).
Antibody Engineering of the Fe region
[00161] The antibodies (e.g., humanized antibodies) and antigen-binding
fragments
thereof disclosed herein can also be engineered to include modifications
within the Fe region,
typically to alter one or more properties of the antibody, such as serum half-
life, complement
fixation, Fc receptor binding, and/or effector function (e.g., antigen-
dependent cellular
-62-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
cytotoxicity). Furthermore, the antibodies and antigen-binding fragments
thereof disclosed
herein can be chemically modified (e.g., one or more chemical moieties can be
attached to
the antibody) or be modified to alter its glycosylation, again to alter one or
more properties of
the antibody or fragment. Each of these embodiments is described in further
detail below.
The numbering of residues in the Fc region is that of the EU index of Kabat.
[00162] The antibodies and antigen-binding fragments thereof disclosed herein
also
include antibodies and fragments with modified (or blocked) Fc regions to
provide altered
effector functions. See, e.g.,U U.S. Pat. No. 5,624,821; W02003/086310;
W02005/120571;
W02006/0057702. Such modifications can be used to enhance or suppress various
reactions
of the immune system, with possible beneficial effects in diagnosis and
therapy. Alterations
of the Fc region include amino acid changes (substitutions, deletions and
insertions),
glycosylation or deglycosylation, and adding multiple Fc regions. Changes to
the Fc can also
alter the half-life of antibodies in therapeutic antibodies, enabling less
frequent dosing and
thus increased convenience and decreased use of material. See Presta (2005) J.
Allergy Clin.
Immunol. 116:731 at 734-35.
[00163] In one embodiment, the antibody or antigen-binding fragment of the
invention is
an IgG4 isotypc antibody or fragment comprising a Serino to Proline mutation
at a position
corresponding to position 228 (5228P; EU index; SEQ ID NO: 66) in the hinge
region of the
heavy chain constant region. This mutation has been reported to abolish the
heterogeneity of
inter-heavy chain disulfide bridges in the hinge region (Angal eta! (1993).
Mol. Immunol
30:105-108; position 241 is based on the Kabat numbering system).
[00164] In one embodiment of the invention, the hinge region of CH1 is
modified such
that the number of cysteine residues in the hinge region is increased or
decreased. This
approach is described further in U.S. Patent No. 5,677,425. The number of
cysteine residues
in the hinge region of CH1 is altered, for example, to facilitate assembly of
the light and
heavy chains or to increase or decrease the stability of the antibody.
[00165] In another embodiment, the Fc hinge region of an antibody or antigen-
binding
fragment of the invention is mutated to decrease the biological half-life of
the antibody or
fragment. More specifically, one or more amino acid mutations are introduced
into the CH2-
CH3 domain interface region of the Fc-hinge fragment such that the antibody or
fragment has
-63-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge
domain SpA
binding. This approach is described in further detail in U.S. Patent No.
6,165,745.
[00166] In another embodiment, the antibody or antigen-binding fragment of the
invention
is modified to increase its biological half-life. Various approaches are
possible. For example,
one or more of the following mutations can be introduced: T252L, T254S, T256F,
as
described in U.S. Patent No. 6,277,375. Alternatively, to increase the
biological half-life, the
antibody can be altered within the CHI or CL region to contain a salvage
receptor binding
epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as
described in
U.S. Patent Nos. 5,869,046 and 6,121,022.
[00167] In yet other embodiments, the Fc region is altered by replacing at
least one amino
acid residue with a different amino acid residue to alter the effector
function(s) of the
antibody or antigen-binding fragment. For example, one or more amino acids
selected from
amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced
with a
different amino acid residue such that the antibody has an altered affinity
for an effector
ligand and retains the antigen-binding ability of the parent antibody. The
effector ligand to
which affinity is altered can be, for example, an Fc receptor or the Cl
component of
complement. This approach is described in further detail in U.S. Patent Nos.
5,624,821 and
5,648,260.
[00168] In another example, one or more amino acids selected from amino acid
residues
329, 331 and 322 can be replaced with a different amino acid residue such that
the antibody
has altered Cl q binding and/or reduced or abolished complement dependent
cytotoxicity
(CDC). This approach is described in further detail in U.S. Patent No.
6,194,551.
[00169] In another example, one or more amino acid residues within amino acid
positions
231 and 239 are altered to thereby alter the ability of the antibody to fix
complement. This
approach is described further in PCT Publication WO 94/29351.
[00170] The proteins of the invention, which are preferably antibodies and
most preferably
IgG antibodies or fragments thereof, may have altered (e.g., relative to an
unmodified
antibody) Fc7R binding properties (examples of binding properties include but
are not
limited to, binding specificity, equilibrium dissociation constant (KD),
dissociation and
association rates (korr and kon respectively), binding affinity and/or
avidity) and that certain
-64-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
alterations are more or less desirable. It is known in the art that the
equilibrium dissociation
constant (KO is defined as korflkon, and Ka is the reciprocal of 1(130.
[00171] The affinities and binding properties of an Fe region for its ligand,
may be
determined by a variety of in vitro assay methods (biochemical or
immunological based
assays) known in the art for determining Fc-FcyR interactions, i.e., specific
binding of an Fc
region to an FcyR including but not limited to, equilibrium methods (e.g.,
enzyme-linked
immuno absorbent assay (ELISA) or radioimmunoassay (RIA)), or kinetics (e.g.
BIACORE , Octet , or KinExa analysis), and other methods such as indirect
binding
assays, competitive inhibition assays, fluorescence resonance energy transfer
(FRET), gel
electrophoresis and chromatography (e.g., gel filtration). These and other
methods may
utilize a label on one or more of the components being examined and/or employ
a variety of
detection methods including but not limited to chromogenic, fluorescent,
luminescent, or
isotopic labels.
[00172] In certain embodiments, the proteins of the present invention bind to
one or more
human FcyRs. In certain embodiments, the proteins of the present invention
bind to one or
more human FcyRs selected from the group consisting of FcyRI, FeyRIIB,
FcyRIIC,
FcyRIIIA-F158, and FcyRIIIA-V158 with an affinity at least 10-fold, preferably
at least 30-
fold, and more preferably at least 100-fold, less than equivalent protein
having a wild-type
human IgG1 heavy chain constant domain (SEQ ID NO: 119) Fe region. In certain
embodiments, the proteins of the present invention bind human FcyRI with an
affinity at least
10-fold, preferably at least 30-fold, and more preferably at least 100-fold,
less than
equivalent protein having a wild-type human IgG1 heavy chain constant domain
(SEQ ID
NO: 119) Fe region. In certain embodiments, the proteins of the present
invention bind
human FcyRIIB with an affinity at least 10-fold, preferably at least 30-fold,
and more
preferably at least 100-fold, less than equivalent protein having a wild-type
human IgG1
heavy chain constant domain (SEQ ID NO: 119) Fe region. In certain
embodiments, the
proteins of the present invention bind human FcyRIIC with an affinity at least
10-fold,
preferably at least 30-fold, and more preferably at least 100-fold, less than
equivalent protein
having a wild-type human IgG1 heavy chain constant domain (SEQ ID NO: 119) Fe
region.
In certain embodiments, the proteins of the present invention bind human
FcyRIIIA-F158
with an affinity at least 10-fold, preferably at least 30-fold, and more
preferably at least 100-
-65-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
fold, less than equivalent protein having a wild-type human IgG1 heavy chain
constant
domain (SEQ ID NO: 119) Fc region. In certain embodiments, the proteins of the
present
invention bind human FcyRIIIA-V158 with an affinity at least 10-fold,
preferably at least 30-
fold, and more preferably at least 100-fold, less than equivalent protein
having a wild-type
human IgG1 heavy chain constant domain (SEQ ID NO: 119). Fc region. In certain
embodiments, the proteins of the present invention bind to one or more human
FcyRs
selected from the group consisting of FcyRI, FcyRIIB, FcyRIIC, Fc7RIIIA-F158,
and
FcyRIIIA-V158 with an affinity at least 10-fold, preferably at least 30-fold,
and more
preferably at least 100-fold, less than equivalent protein having a wild-type
human IgG4
heavy chain constant domain (SEQ ID NO: 66) Fc region. In certain embodiments,
the
proteins of the present invention bind human Fc7RI with an affinity at least
10-fold,
preferably at least 30-fold, and more preferably at least 100-fold, less than
equivalent protein
having a wild-type human IgG4 heavy chain constant domain (SEQ ID NO: 66) Fc
region.
Fc region. In certain embodiments, the proteins of the present invention bind
human FcyRIIB
with an affinity at least 10-fold, preferably at least 30-fold, and more
preferably at least 100-
fold, less than equivalent protein having a wild-type human IgG4 heavy chain
constant
domain (SEQ ID NO: 66) Fc region. In certain embodiments, the proteins of the
present
invention bind human FcyRIIC with an affinity at least 10-fold, preferably at
least 30-fold,
and more preferably at least 100-fold, less than equivalent protein having a
wild-type human
IgG4 heavy chain constant domain (SEQ ID NO: 66) Fc region. In certain
embodiments, the
proteins of the present invention bind human Fc7RIIIA-F158 with an affinity at
least 10-fold,
preferably at least 30-fold, and more preferably at least 100-fold, less than
equivalent protein
having a wild-type human IgG4 heavy chain constant domain (SEQ ID NO: 66) Fc
region. In
certain embodiments, the proteins of the present invention bind human FcyRIIIA-
V158 with
an affinity at least 10-fold, preferably at least 30-fold, and more preferably
at least 100-fold,
less than equivalent protein having a wild-type human IgG4 heavy chain
constant domain
(SEQ ID NO: 66) Fc region.
[00173] In various embodiments, the proteins of the invention comprise an
immunoglobulin Fc region comprising an immunoglobulin C2 region and an
immunoglobulin C3 region and an immunoglobulin hinge region. By way of
example, the
immunoglobulin Fc region may be an IgG Fc region, an IgE Fc region, or an IgA
Fc region.
-66-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
In certain preferred embodiments, the protein comprises two immunoglobulin Fc
regions,
each immunoglobulin Fc region comprising an immunoglobulin C2 region and an
immunoglobulin C3 region and an immunoglobulin hinge region, wherein the hinge
region
of one of the immunoglobulin Fc regions is bound to the hinge region of the
other
immunoglobulin Fc region to form a dimeric Fc structure. Most preferably, such
a protein is
a human or humanized IgG protein.
[00174] In certain embodiments, the proteins of the invention comprise a
mutated IgG4 Fc
region, and preferably the protein is an IgG comprising two mutated IgG4 Fc
regions to form
a dimeric Fc structure. By way of example, a mutated IgG4 Fc region may
comprise one of
the mutations, or mutational combinations, recited in Table 3. The numbering
system of the
constant region referred to in this table is that of the EU index as set forth
in Kabat et al.
(1991, NTH Publication 91-3242, National Technical Information Service,
Springfield, VA).
In the table, the first letter and number represent the unmodified amino acid
and its position
and the second letter represents the substituted amino acid at said position.
For those entries
that include combinations of more than one mutation, each mutation in the
combination is
separated by a "I-. Deletions are indicated by "A
Table 3:
N297Q L235E N297Q/L235E
F234A Q268A
F234A/L235A/G237A/P238A
F234A/L235A/AG236 F234A/L235A/G237A
F234A/L235A/AG236/G237A
/G237A/P238A /P238A/Q268A /P238A/Q268A
F234A/L235A L235E/P329G L235A/G237A/E318A
F234A/L235A/G237A F234A/L235A/AG236 F234A/L235A/G237A
/P238S /G237A/P2385 /P238S/Q 268A
F234A/L235A/AG236
/G237A/P238S/Q268A
[00175] In certain embodiments, the proteins of the invention comprise a
mutated IgG1 Fc
region, and preferably the protein is an IgG comprising two mutated IgG1 Fc
regions to form
a dimeric Fc structure. By way of example, a mutated IgG1 Fc region may
comprise one of
the mutations recited in Table 4. The numbering system of the constant region
referred to in
this table is that of the EU index as set forth in Kabat et al. (1991, NIH
Publication 91-3242,
National Technical Information Service, Springfield, VA). In the table, the
first letter and
-67-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
number represent the unmodified amino acid and its position and the second
letter represents
the substituted amino acid at said position.
Table 4.
K222Y P232K A231K
E233N E233Q E233R
E233S E233T E233H
E233A E233V E233L
E233F E233M E233Y
E233W E233G L234D
L234E L234N L234Q
L234T L234H L234F
L234K L234R L234S
L234A L234M L234V
L235E L2351 L235F
L235K L235R L235A
L235M L235W L235N
L235Q L235H L235V
G236A G236N G236R
G236H G236L G236F
G236P G237A G237E
G237N G237Q G237K
G237R G237S G237T
G237H G237L G237I
G237F G237M G237Y
G237P P238K P238N
P238R P238S P238T
P23 8Y P23 8G P23 8A
S239A S239N S239F
S239K S239R S239V
S239W S239P S239H
S239Y D249H V240A
F241W F241L F243W
F243L F243E P244H
P245A P247V P247G
V253I V263I V263 T
V263M V264D V264E
V264K V264F V264M
V264H V264W V264G
V264Q V264A V264L
D265A D265E D265Q
D265S D265H D265V
D265L D265F D265M
D265Y D265N D265G
-68-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
V266T V266M V266A
S267G S267H S267N
S267P S267R S267T
S267F S267W E269A
E269K E269S E269V
E269F E2691 E269M
E269W E269H E269T
E269L E269N E269Y
E269R E269P E269G
D270A D270N D270E
D270Q D270T D270H
D270R D270S D270L
D270I D270F D270W
D270P D270G P27111
P271Q P271K P271R
P271 S P271V P271F
P271W D280L D280W
D280P E293F E294A
E293Y E294K E294R
E294S E294V E294L
E294F Q295A Q295W
Q295P Q295G Y296E
Y296Q Y296D Y296N
Y296S Y296T Y296L
Y296I Y296A Y296V
Y296M N297S N297D
N297Q N297A S2981
S298N S298K S298R
T299A T299H T299D
T299E T299N T299Q
T299K T299R T299I
T299F T299M T299Y
1299W T299S T299V
1299P T299G Y300E
Y3 00K Y300R Y300S
Y300P Y300W V303A
V3031) W313F F318A
E318V E318Q E318H
E318L E318Y K320A
K322A K322E N325A
N325V N325H N325K
N325Y N325W N325P
N325G N325Q N325D
N325E N325L N325I
A327Q A327E A327N
-69-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
A327L A3271 A327F
A327W L328N L328F
L32811 L328R L328T
L328V L328I L328P
L328M L328E L328A
P329A P329F P329D
P329N P329Q P329K
P329S P3291 P329H
P329V P329L P329M
P329Y P329W P329G
P329R A330L A330R
A330P A330T A330V
A330F A330H P331A
P331S P331N P331E
1332K I332N 1332Q
13321 I332H 1332Y
I332A I332R E333N
E333R I336E I336Y
S337H
[00176] In certain embodiments, a mutated IgG1 Fe region may comprise one of
the
mutational combinations recited in Table 5. The numbering system of the
constant region
referred to in this table is that of the EU index as set forth in Kabat et at
(1991, NTH
Publication 91-3242, National Technical Information Service, Springfield, VA).
In the table,
the first letter and number represent the unmodified amino acid and its
position and the
second letter represents the substituted amino acid at said position. For each
of the
combinations of more than one mutation, each mutation in the combination is
separated by a
"I" and deletions are indicated by a "A".
Table 5:
C220S/C226S/C229S/P238S C226S/C229S/E233P/L234V E233P/L234V/L235A
L235A
E233P/L234V/L235A/AG23 E233P/L234V/L235A/AG23 L234A/L235A
6 6/
A327G/A330S/P331S
L235A/G237A L235A/G237A/E318S/K320 L235A/G237A/P331A
S/
K322S
L234F/L235E L234F/L235E/D265A
L234F/L235E/D265A/
-70-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
N297Q/P331S
L234F/L235E/N297Q L234F/L235E/P329G
L234F/L235A/K322Q/
M252Y/5254T/T256E
L234F/L235Q/K322Q/M252 L234F/L235Q/P331G/M252 G236R/L328R
Y/ Y/
S254T/T256E S254T/T256E
S239D/D2651/N297D/1332E S239D/D265L/N297D/I332E S239D/D265F/N297D/
I332E
S239D/D265Y/N297D/I332 S239D/D265T/N297D/I332E S239D/N297D/A330Y/
I332E
S239D/F241 S/F243HN262T V264E/N297D/I332E D265A/P331S
N264 TiN297D/K326E/1332
D265A/N297Q N297D/D265Y/T299L/I332E N297D/D265Y/1332E
N297D/1332EN296D N297D/1332E N297D/I332EN296E
N297D/I332EN296N N297D/1332EN296Q N297D/1332EN296H
N297D/1332E/Y296T N297D/1332E/T299V
N297D/1332E/T2991
N297D/1332E/T299L N297D/1332E/T299F
N297D/I332E/T299H
N297D/1332E/T299E N297D/1332E/A330Y
N297D/1332E/S298A/
A330Y
N297E/D265F/I332E N297E/I332E
F241E/F243R/V262E/
V264R
F241 E/F243QN262TN264 F24 I L/F243LN262IN2641 F24IW/F 243W
F241W/F243WN262AN26 F241LN2621 F243LN2621N264W
4A
F241 Y/F243 YN262 TN264 F241E/F243R/V262EN264 F241E/F243 Q N262TN264
F241R/F243QN262TN264 F241E/F243 YN262TN264 P244H/P245A/P247V
F241E/F243R/V262EN264 F241E/F243 YN262TN264 F241E/F243 YN262T/
R/I332E R V264R/I332E
5239E/D265G S239E/D265N S239E/D265Q
M252Y/S254T/T256E S267Q/A327S S267L/A327S
N297S/I332E S239N/I332N S239N/1332Q
S239Q/I332N S239Q/I332Q S298N/Y300S
5298N/T299AN300S N297Q/5298N/Y300S E318 S/K3205
/1022S
E318S/K320S/K322S/P311A L328E/1332E L328N /1332E
L234A/L235A/G237A/P238 L234A/L235A/G237A/P238 L234A/L235A/G237A/P238
A S/1-1268A/A33 0 S/P331 S A/H268A/A330
S /P331 S
/H268A/A330S /P331 S
L328Q/I332E L328H/I332E
-71-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00177] In certain embodiments, the proteins of the invention comprise a wild
type or
mutated IgG2 Fc region, and preferably the protein is an IgG comprising two
wild type or
mutated IgG2 Fc regions to form a dimeric Fc structure. A mutated IgG2 Fc
region may
comprise one of the mutations, or mutational combinations, recited in Table 6.
The
numbering system of the constant region referred to in this table is that of
the EU index as set
forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical
Information
Service, Springfield, VA). In the table, the first letter and number represent
the unmodified
amino acid and its position and the second letter represents the substituted
amino acid at said
position. For those entries that include combinations of more than one
mutation, each
mutation in the combination is separated by a "/".
Table 6:
V234A G237A A235E/G237A
V234A/A235E/G237A V234A/G237A
V234A/G237A/P238S
H268Q/V309L/A330S/P33 I V234A/G237A/H268A/V309L/ V234A/G-237A/H268Q/V30
A330S/P331S
9L/A330S/P331S
V234A/G237A/P238S/H268 P233SN234A/G237A/P238S P233SN234A/G237A/H268
A/V309L/A330S/P331S
A/V309L/A330S/P331S
P233SN234A/G237A/H268 P233SN234A/G237A/P238S/
QN309L/A3305/P331S H268A1V309L/A3305/P331S
Production of Antibodies with Modified Glycosylation
[00178] In still another embodiment, the antibodies or antigen-binding
fragments of the
invention comprise a particular glycosylation pattern. For example, an
afucosylated or an
aglycosylated antibody or fragment can be made (i.e., the antibody lacks
fucose or
glycosylation, respectively). The glycosylation pattern of an antibody or
fragment may be
altered to, for example, increase the affinity or avidity of the antibody or
fragment for a
CD103 antigen. Such modifications can be accomplished by, for example,
altering one or
more of the glycosylation sites within the antibody or fragment sequence. For
example, one
or more amino acid substitutions can be made that result in removal of one or
more of the
variable region framework glycosylation sites to thereby eliminate
glycosylation at that site.
Such deglycosylation may increase the affinity or avidity of the antibody or
fragment for
antigen. See, e.g.,U U.S. Patent Nos. 5,714,350 and 6,350,861.
-72-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00179] Antibodies and antigen-binding fragments disclosed herein may further
include
those produced in lower eukaryote host cells, in particular fungal host cells
such as yeast and
filamentous fungi have been genetically engineered to produce glycoproteins
that have
mammalian- or human-like glycosylation patterns (See for example, Choi et al,
(2003) Proc.
Natl. Acad. Sci. 100: 5022-5027; Hamilton etal., (2003) Science 301: 1244-
1246; Hamilton
etal., (2006) Science 313: 1441-1443; Nett et al., Yeast 28(3):237-52 (2011);
Hamilton et al.,
Curr Opin Biotechnol. 18(5): 387-92 (2007)). A particular advantage of these
genetically
modified host cells over currently used mammalian cell lines is the ability to
control the
glycosylation profile of glycoproteins that are produced in the cells such
that compositions of
glycoproteins can be produced wherein a particular N-glycan structure
predominates (see,
e.g., U.S. Patent No. 7,029,872 and U.S. Patent No. 7,449,308). These
genetically modified
host cells have been used to produce antibodies that have predominantly
particular N-glycan
structures (See for example, Li et al , (2006) Nat. Biotechnol 24: 210-215).
[00180] In particular embodiments, the antibodies and antigen-binding
fragments thereof
disclosed herein further include those produced in lower eukaryotic host cells
and which
comprise fucosylated and non-fucosylated hybrid and complex N-glycans,
including bisected
and multiantennary species, including but not limited to N-glycans such as
GlcNAc(i_
4)Man3G1cNAc2; Gal(1_4)G1cNAc(1_4)Man3G1cNAc2; NANA(1_4)Gal(14)G1cNAc(1-
4)Man3G1cNAc2.
[00181] In particular embodiments, the antibodies and antigen-binding
fragments thereof
provided herein may comprise antibodies or fragments having at least one
hybrid N-glycan
selected from the group consisting of GlcNAcMan5G1cNAc2; GalG1cNAcMan5G1cNAc2;
and
NANAGalG1cNAcMan5G1cNAc2. In particular aspects, the hybrid N-glycan is the
predominant N-glycan species in the composition.
[00182] In particular embodiments, the antibodies and antigen-binding
fragments thereof
provided herein comprise antibodies and fragments having at least one complex
N-glycan
selected from the group consisting of GIcNAcMan3G1cNAc2; GaIG1cNAcMan3G1cNAc2;
NANAGalG1cNAcMan3G1cNAc2; GlcNAc2Man3G1cNAc2; GalG1cNAc2Man3G1cNAc2;
Gal2GlcNAc2Man3G1cNAc2; NANAGal2GlcNAc2Man3G1cNAc2; and
NANA2Gal2G1cNAc2Man3G1cNAc2. In particular aspects, the complex N-glycan are
the
-73-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
predominant N-glycan species in the composition. In further aspects, the
complex N-glycan is
a particular N-glycan species that comprises about 30%, 40%, 50%, 60%, 70%,
80%, 90%,
95%, 97%, 98%, 99%, or 100% of the complex N-glycans in the composition. In
one
embodiment, the antibody and antigen binding fragments thereof provided herein
comprise
complex N-glycans, wherein at least 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%,
99%, or
100% of the complex N-glycans comprise the structure
NANA2Ga12G1cNAc2Man3G1cNAc2,
wherein such structure is afucosylated. Such structures can be produced, e.g.,
in engineered
Pichia pastoris host cells.
[00183] In particular embodiments, the N-glycan is fucosylated. In general,
the fucose is
in an a1,3-linkage with the GlcNAc at the reducing end of the N-glycan, an
a1,6-linkage with
the GlcNAc at the reducing end of the N-glycan, an a1,2-linkage with the Gal
at the non-
reducing end of the N-glycan, an a1,3-linkage with the GlcNac at the non-
reducing end of the
N-glycan, or an a1,4-linkage with a GlcNAc at the non-reducing end of the N-
glycan.
[00184] Therefore, in particular aspects of the above the glycoprotein
compositions, the
glycoform is in an a1,3-linkage or a1,6-linkage fucose to produce a glycoform
selected from
the group consisting of Man5G1cNAc2(Fuc), GlcNAcMan5G1cNAc2(Fuc),
Man3G1cNAc2(Fuc), G1eNAcMan3G1cNAc2(Fuc), GleNAc2Man3G1cNAc2(Fuc),
Ga1G1cNAc2Man3GIcNAc2(Fuc), Gal2G1cNAc2Man3G1cNAc2(Fuc),
NANAGa12G1cNAc2Man3G1cNAc2(Fuc), and NANA2Gal2G1cNAc2Man3G1cNAc2(Fuc), in
an a1,3-linkage or a1,4-linkage fucose to produce a glycoform selected from
the group
consisting of GlcNAc(Fuc)Man5G1cNAc2, GleNAc(Fuc)Man3G1cNAc2, GlcNAc2(Fuci-
2)Man3G1cNAc2, GalG1eNAc2(Fuci-2)Man3G1cNAc2, Gal2G1cNAc2(Fucl-2)Man3G1cNAc2,
NANAGa12G1cNAc2(Fuci-2)Man3G1cNAc2, and NANA2Gal2G1cNAc2(Fuci-
2)Man3G1cNAc2; or in an a1,2-linkage fucose to produce a glycoform selected
from the
group consisting of Ga1(Fuc)G1cNAc2Man3G1cNAc2,
Gal2(Fuc1_2)G1cNAc2Man3G1cNAc2,
NANAGa12(Fuci_2)G1cNAc2Man3G1cNAc2, and NANA2Gal2(Fuci_2)G1cNAc2Man3G1cNAc2.
[00185] In further aspects, the antibodies (e.g., humanized antibodies) or
antigen-binding
fragments thereof comprise high mannose N-glycans, including but not limited
to,
Man8G1cNAc2, Man7G1cNAc2, Man6G1cNAc2, Man5G1cNAc2, Man4G1cNAc2, or N-glycans
that consist of the Man3G1cNAc2 N-glycan structure.
-74-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00186] In further aspects of the above, the complex N-glycans further include
fucosylated
and non-fucosylated bisected and multiantennary species.
[00187] As used herein, the terms "N-glycan" and "glycoform" are used
interchangeably
and refer to an N-linked oligosaccharide, for example, one that is attached by
an asparagine-
N-acetylglucosamine linkage to an asparagine residue of a polypeptide. N-
linked
glycoproteins contain an N-acetylglucosamine residue linked to the amide
nitrogen of an
asparagine residue in the protein. The predominant sugars found on
glycoproteins are
glucose, galactose, mannose, fucose, N-acetylgalactosamine (GaINAc), N-
acetylglucosamine
(GlcNAc) and sialic acid (e.g., N-acetyl-neuraminic acid (NANA)). The
processing of the
sugar groups occurs co-translationally in the lumen of the ER and continues
post-
translationally in the Golgi apparatus for N-linked glycoproteins.
[00188] /V-glycans have a common pentasaccharide core of Man3G1cNAc2 ("Man"
refers
to mannose; "Glc" refers to glucose; and "NAc" refers to N-acetyl; GlcNAc
refers to /V-
acetylglucosamine). Usually, N-glycan structures are presented with the non-
reducing end to
the left and the reducing end to the right. The reducing end of the N-glycan
is the end that is
attached to the Asn residue comprising the glycosylation site on the protein.
N-glycans differ
with respect to the number of branches (antennae) comprising peripheral sugars
(e.g.,
GlcNAc, galactose, fucose and sialic acid) that are added to the Man3G1cNAc2
("Man3") core
structure which is also referred to as the "trimannose core", the
"pentasaccharide core" or the
"paucimannose core". N-glycans are classified according to their branched
constituents (e.g.,
high mannose, complex or hybrid). A "high mannose" type N-glycan has five or
more
mannose residues. A "complex" type N-glycan typically has at least one GlcNAc
attached to
the 1,3 mannose arm and at least one GlcNAc attached to the 1,6 mannose arm of
a
"trimannose" core. Complex N-glycans may also have galactose ("Gal") or N-
acetylgalactosamine ("GalNAc") residues that are optionally modified with
sialic acid or
derivatives (e.g., "NANA" or "NeuAc", where "Neu" refers to neuraminic acid
and "Ac"
refers to acetyl). Complex N-glycans may also have intrachain substitutions
comprising
"bisecting" GlcNAc and core fucose ("Fuc"). Complex N-glycans may also have
multiple
antennae on the "trimannose core," often referred to as "multiple antennary
glycans." A
"hybrid" N-glycan has at least one GlcNAc on the terminal of the 1,3 mannose
arm of the
-75-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
trimannose core and zero or more mannoses on the 1,6 mannose arm of the
trimannose core.
The various N-glycans are also referred to as "glycoforms."
[00189] With respect to complex N-glycans, the terms "G-2", "G-1", "GO", "Gl",
"G2",
"Al", and "A2" mean the following. "G-2" refers to an N-glycan structure that
can be
characterized as Man3G1cNAc2; the term "G-1" refers to an N-glycan structure
that can be
characterized as GlcNAcMan3G1cNAc2; the term "GO" refers to an N-glycan
structure that
can be characterized as GlcNAc2Man3G1cNAc2; the term ''Gl" refers to an N-
glycan
structure that can be characterized as GalG1cNAc2Man3G1cNAc2; the term "C2"
refers to an
N-glycan structure that can be characterized as Ga12G1cNAc2Man3G1cNAc2; the
term 'Al"
refers to an N-glycan structure that can be characterized as
NANAGal2G1cNAc2Man3G1cNAc2; and, the term "A2" refers to an N-glycan structure
that
can be characterized as NANA2Gal2G1cNAc2Man3G1cNAc2. Unless otherwise
indicated,
the terms G-2", "G-1", "GO", "G1", "G2", "Al", and "A2" refer to N-glycan
species that lack
fucose attached to the GlcNAc residue at the reducing end of the N-glycan.
When the term
includes an "F", the "F" indicates that the N-glycan species contains a fucose
residue on the
GlcNAc residue at the reducing end of the N-glycan. For example, GOF, G1F,
G2F, AlF,
and A2F all indicate that the N-glycan further includes a fucose residue
attached to the
GlcNAc residue at the reducing end of the N-glycan. Lower eukaryotes such as
yeast and
filamentous fungi do not normally produce N-glycans that produce fucose.
[00190] With respect to multiantennary N-glycans, the term "multiantennary N-
glycan"
refers to N-glycans that further comprise a GlcNAc residue on the mannose
residue
comprising the non-reducing end of the 1,6 arm or the 1,3 arm of the N-glycan
or a GlcNAc
residue on each of the mannose residues comprising the non-reducing end of the
1,6 arm and
the 1,3 arm of the N-glycan. Thus, multiantennary N-glycans can be
characterized by the
formulas GlcNAc(2_4)Man3G1cNAc2, Gal( _4)G1cNAc(2_4)Man3G1cNAc2, or NANA(l _
4)Gal(1 _4)G1cNAc(2_4)Man3G1cNAc2. The term "1-4" refers to 1, 2, 3, or 4
residues.
[00191] With respect to bisected N-glycans, the term "bisected N-glycan"
refers to N-
glycans in which a GlcNAc residue is linked to the mannose residue at the
reducing end of
the N-glycan. A bisected N-glycan can be characterized by the formula
-76-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
GleNAc3Man3G1cNAc2 wherein each mannose residue is linked at its non-reducing
end to a
GlcNAc residue. In contrast, when a multiantennary N-glycan is characterized
as
GleNAc3Man3G1cNAc2, the formula indicates that two GlcNAc residues are linked
to the
mannose residue at the non-reducing end of one of the two arms of the N-
glycans and one
GlcNAc residue is linked to the mannose residue at the non-reducing end of the
other arm of
the N-glycan.
[00192] In certain embodiments, the proteins of the invention comprise an
aglycosylated
Fc region. By way of example, an IgG1 Fc region may be aglycosylayed by
deleting or
substituting residue N297.
Antibody Physical Properties
[00193] The antibodies and antigen-binding fragments thereof disclosed herein
may
further contain one or more glycosylation sites in either the light or heavy
chain
immunoglobulin variable region. Such glycosylation sites may result in
increased
immunogenicity of the antibody or fragment or an alteration of the pK of the
antibody due to
altered antigen-binding (Marshall etal. (1972) Annu Rev Biochern 41:673-702;
Gala and
Morrison (2004) ilinmunol 172:5489-94; Wallick eta! (1988)1 EAT Med 168.1099-
109;
Spiro (2002) Glycobiology 12:43R-56R; Parekh et al (1985) Nature 316:452-7;
Mimura et
al. (2000) Mol Immunol 37:697-706). Glycosylation has been known to occur at
motifs
containing an N-X-S/T sequence.
[00194] Each antibody or antigen-binding fragment will have a unique
isoelectric point
(pI), which generally falls in the pH range between 6 and 9.5. The pI for an
IgG1 antibody
typically falls within the pH range of 7-9.5 and the pI for an IgG4 antibody
typically falls
within the pH range of 6-8.
[00195] Each antibody or antigen-binding fragment will have a characteristic
melting
temperature, with a higher melting temperature indicating greater overall
stability in vivo
(Krishnamurthy Rand Manning MC (2002) Curr Pharm Biotechnol 3:361-71). In
general,
the Tmi (the temperature of initial unfolding) may be greater than 60 C,
greater than 65 C, or
greater than 70 C. The melting point of an antibody or fragment can be
measured using
differential scanning calorimetry (Chen eta! (2003) Phann Res 20:1952-60;
Ghirlando eta!
-77-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
(1999) Immunol Lett 68:47-52) or circular dichroism (Murray etal. (2002)1
(Jhromatogr Sci
40:343-9).
[00196] In a further embodiment, antibodies and antigen-binding fragments
thereof are
selected that do not degrade rapidly. Degradation of an antibody or fragment
can be
measured using capillary electrophoresis (CE) and MALDI-MS (Alexander AT and
Hughes
DE (1995) Anal Chem 67:3626-32).
[00197] In a further embodiment, antibodies and antigen-binding fragments
thereof are
selected that have minimal aggregation effects, which can lead to the
triggering of an
unwanted immune response and/or altered or unfavorable pharmacokinetic
properties.
Generally, antibodies and fragments are acceptable with aggregation of 25% or
less, 20% or
less, 15% or less, 10% or less, or 5% or less. Aggregation can be measured by
several
techniques, including size-exclusion column (SEC), high performance liquid
chromatography
(HPLC), and light scattering.
Antibody Conjugates
[00198] The anti-CD103 antibodies disclosed herein may also be conjugated to a
chemical
moiety. The anti-CD103 antigen-binding fragments disclosed herein may also be
conjugated
to a chemical moiety. The chemical moiety may be, inter alia, a polymer. The
chemical
moiety may be, inter alia, a radionucleotide. The chemical moiety may be,
inter alia, a
cytotoxic factor. In particular embodiments, the chemical moiety is a polymer
which
increases the half-life of the antibody or fragment in the body of a subject.
Suitable polymers
include, but are not limited to, hydrophilic polymers. Such hydrophilic
polymers may include
but are not limited to polyethylene glycol (PEG) (e.g., PEG with a molecular
weight of 2kDa,
kDa, 10 kDa, 12kDa, 20 kDa, 30kDa or 40kDa). Such hydrophilic polymers may
include
but are not limited to dextran. Such hydrophilic polymers may include but are
not limited to
monomethoxypolyethylene glycol (mPEG). Lee, et al., (1999) (Bioconj. Chem.
10:973-981)
discloses PEG conjugated single-chain antibodies. Wen, etal., (2001) (Bioconj.
Chem.
12:545-553) disclose conjugating antibodies with PEG which is attached to a
radiometal
chelator (diethylenetriaminpentaacetic acid (DTPA)).
-78-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00199] The antibodies and antigen-binding fragments thereof disclosed herein
may also
, ,
, ,
be conjugated with labels such as 99Tc, 99mTc, 86Y, 88Y, 90Y,
32p, 14C, 1231 1241 1251 3H
1311, 11C, 150, 13N, 18F, 19F, 35s, 51cr, 57T0, 226Ra, 60 -0,
u "Fe, 57Se, 152Eo, 61co, 62c.u, 64co,
67CU, 66Ga, 67Ga, 68Cia, 72Cia, 45Ti, 89Zr, 2170, 211At, 212pb, 177Lu, 44s o,
47s o, 109pd, 234Th, and
40K, 157Gd, 55mn, 52Tr, and 56Fe
[00200] The antibodies disclosed herein may also be PEGylated, for example to
increase
its biological (e.g., serum) half-life. The antigen-binding fragments
disclosed herein may also
be PEGylated. To PEGylate an antibody or fragment, the antibody or fragment,
typically is
reacted with a reactive form of polyethylene glycol (PEG), such as a reactive
ester or
aldehyde derivative of PEG, under conditions in which one or more PEG groups
become
attached to the antibody or antibody fragment. In particular embodiments, the
PEGylation is
carried out via an acylation reaction or an alkylation reaction with a
reactive PEG molecule
(or an analogous reactive water-soluble polymer). As used herein, the term
"polyethylene
glycol" is intended to encompass any of the forms of PEG that have been used
to derivatize
other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol
or
polyethylene glycol-maleimide. In certain embodiments, the antibody or
fragment to be
PEGylated is an aglycosylated antibody or fragment. Methods for PEGylating
proteins are
known in the art and can be applied to the antibodies of the invention. See,
e.g., EP 0 154 316
and EP 0 401 384.
[00201] The antibodies disclosed herein may also be conjugated with
fluorescent labels.
The antibodies disclosed herein may also be conjugated with chemilluminescent
labels. The
antigen-binding fragments disclosed herein may also be conjugated with
fluorescent labels.
The antigen-binding fragments disclosed herein may also be conjugated with
chemilluminescent labels. This includes fluorophores such as rare earth
chelates, fluorescein
and its derivatives, rhodamine and its derivatives, isothiocyanate,
phycoerythrin,
phycocyanin, allophycocyanin, o-phthaladehyde, fluorescamine, 152Eu, dansyl,
umbelliferone, luciferin, luminal label, isoluminal label, an aromatic
acridinium ester label,
an imidazole label, an acridimium salt label, an oxalate ester label, an
aequorin label, 2,3 -
dihydrophthalazinediones, biotin/avidin, spin labels and stable free radicals.
-79-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00202] The antibodies of the invention may also be conjugated to a cytotoxic
agent. The
antigen-binding fragments of the antibodies of the invention may also be
conjugated to a
cytotoxic agent. The antibodies and antigen-binding fragments thereof of the
invention may
also be conjugated to a cytotoxic agent such as auristatin F, paclitaxel,
docetaxel, vincristine,
CC-1065, SN-38, topotecan, morpholino doxorubicin, lysoxin, cyanomorpholino
doxorubicin, Dolastatin-10, echinomycin, combretatstatin, chalicheamicin,
maytansine, DM-
1, netropsin, diptheria toxin, Psettdomonas aertiginosa exotoxin A chain,
ricin A chain,
abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and
compounds (e.g.,
fatty acids), dianthin proteins, Phytoiacca americana proteins PAPI, PAPII,
and PAP-S,
momordiea eharantia inhibitor, curcin, crotin, saponaria officinahs inhibitor,
mitogellin,
restrictocin, phenomycin, and enomycin. This list is not meant to be limiting.
The antibodies
of the invention may be conjugated to auristatin F. The antibodies of the
invention may be
conjugated to paclitaxel. The antibodies of the invention may be conjugated to
docetaxel.
The antibodies of the invention may be conjugated to vincristine. The
antibodies of the
invention may be conjugated to CC-1065. The antibodies of the invention may be
conjugated
to SN-38. The antibodies of the invention may be conjugated to topotecan. The
antibodies of
the invention may be conjugated to morpholino doxorubicin. The antibodies of
the invention
may be conjugated to lysoxin. The antibodies of the invention may be
conjugated to
cyanomorpholino doxorubicin. The antibodies of the invention may be conjugated
to
Dolastatin-10. The antibodies of the invention may be conjugated to
echinomycin. The
antibodies of the invention may be conjugated to combretatstatin. The
antibodies of the
invention may be conjugated to chalicheamicin. The antibodies of the invention
may be
conjugated to maytansine. The antibodies of the invention may be conjugated to
DM-1. The
antibodies of the invention may be conjugated to netropsin. The antibodies of
the invention
may be conjugated to diptheria toxin. The antibodies of the invention may be
conjugated to
Pseudomonas aeruginosa exotoxin A chain. The antibodies of the invention may
be
conjugated to ricin A chain. The antibodies of the invention may be conjugated
to abrin A
chain. The antibodies of the invention may be conjugated to modeccin A chain.
The
antibodies of the invention may be conjugated to alpha-sarcin. The antibodies
of the
invention may be conjugated to Aleurites fordii proteins and compounds (e.g.,
fatty acids).
The antibodies of the invention may be conjugated to dianthin proteins. The
antibodies of the
-80-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
invention may be conjugated to Phytoiacca americana protein PAPI. The
antibodies of the
invention may be conjugated to Phytoiacca americana protein PAPII. The
antibodies of the
invention may be conjugated to Phytoiacca americana protein PAP-S. The
antibodies of the
invention may be conjugated to momordica charantia inhibitor. The antibodies
of the
invention may be conjugated to curcin. The antibodies of the invention may be
conjugated to
crotin. The antibodies of the invention may be conjugated to saponaria
qfficinalis inhibitor.
The antibodies of the invention may be conjugated to mitogellin. The
antibodies of the
invention may be conjugated to restrictocin. The antibodies of the invention
may be
conjugated to phenomycin. The antibodies of the invention may be conjugated to
enomycin.
The antigen-binding fragments of the antibodies of the invention may be
conjugated to
auristatin F. The antigen-binding fragments of the antibodies of the invention
may be
conjugated to paclitaxel. The antigen-binding fragments of the antibodies of
the invention
may be conjugated to docetaxel. The antigen-binding fragments of the
antibodies of the
invention may be conjugated to vincristine. The antigen-binding fragments of
the antibodies
of the invention may be conjugated to CC-1065. The antigen-binding fragments
of the
antibodies of the invention may be conjugated to SN-38. The antigen-binding
fragments of
the antibodies of the invention may be conjugated to topotecan. The antigen-
binding
fragments of the antibodies of the invention may be conjugated to morpholino
doxorubicin.
The antibodies of the invention may be conjugated to lysoxin. The antigen-
binding fragments
of the antibodies of the invention may be conjugated to cyanomorpholino
doxorubicin. The
antigen-binding fragments of the antibodies of the invention may be conjugated
to
Dolastatin-10. The antigen-binding fragments of the antibodies of the
invention may be
conjugated to echinomycin. The antigen-binding fragments of the antibodies of
the invention
may be conjugated to combretatstatin. The antigen-binding fragments of the
antibodies of the
invention may be conjugated to chalicheamicin. The antigen-binding fragments
of the
antibodies of the invention may be conjugated to maytansine. The antigen-
binding fragments
of the antibodies of the invention may be conjugated to DM-1. The antigen-
binding
fragments of the antibodies of the invention may be conjugated to netropsin.
The antigen-
binding fragments of the antibodies of the invention may be conjugated to
diptheria toxin.
The antigen-binding fragments of the antibodies of the invention may be
conjugated to
Pseudomonas aertiginosa exotoxin A chain. The antibodies of the invention may
be
-81 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
conjugated to ricin A chain. The antigen-binding fragments of the antibodies
of the invention
may be conjugated to abrin A chain. The antigen-binding fragments of the
antibodies of the
invention may be conjugated to modeccin A chain. The antigen-binding fragments
of the
antibodies of the invention may be conjugated to alpha-sarcin. The antigen-
binding
fragments of the antibodies of the invention may be conjugated to Aleurites
fordii proteins
and compounds (e.g., fatty acids). The antigen-binding fragments of the
antibodies of the
invention may be conjugated to dianthin proteins. The antigen-binding
fragments of the
antibodies of the invention may be conjugated to Phytoiacca americana protein
PAPI. The
antigen-binding fragments of the antibodies of the invention may be conjugated
to
Phytoiacca americana protein PAPII. The antigen-binding fragments of the
antibodies of the
invention may be conjugated to Phytoiacca americana protein PAP-S. The antigen-
binding
fragments of the antibodies of the invention may be conjugated to mom ordica
charantia
inhibitor. The antigen-binding fragments of the antibodies of the invention
may be
conjugated to curcin. The antigen-binding fragments of the antibodies of the
invention may
be conjugated to crotin. The antigen-binding fragments of the antibodies of
the invention
may be conjugated to saponaria officinalis inhibitor. The antigen-binding
fragments of the
antibodies of the invention may be conjugated to mitogellin. The antigen-
binding fragments
of the antibodies of the invention may be conjugated to restrictocin. The
antigen-binding
fragments of the antibodies of the invention may be conjugated to phenomycin.
The antigen-
binding fragments of the antibodies of the invention may be conjugated to
enomycin.
[00203] The antibodies of the invention may also be conjugated to an
anticancer agent.
The antibodies of the invention may also be conjugated to an anticancer agent
such as such as
erlotinib (TARCEVA , Genentech/OSI Pharm.), docetaxel (TAXOTERE , Sanofi-
Aventis), 5-FU (fluorouracil, 5-fluorouracil, CAS No. 51-21-8), gemcitabine
(GEMZAR ,
Lilly), PD-0325901 (CAS No. 391210-10-9, Pfizer), cisplatin (cis-diamine,
dichloroplatinum(II), CAS No. 15663-27-1), carboplatin (CAS No. 41575-94-4),
paclitaxel
(TAXOL , Bristol-Myers Squibb Oncology, Princeton, N.J.), trastuzumab
(IIERCEPTINC,
Genentech), temozolomide (4-methyl-5-oxo-2,3,4,6,8-pentazabicyclo [4.3.0] nona-
2,7,9-
triene-9-carboxamide, CAS No. 85622-93-1, TEMODAR , TEMODAL , Schering
Plough), tamoxifen ((Z)-2-[4-(1,2-diphenylbut-1-enyl)phenoxy]-N,N-
dimethylethanamine,
NOLVADEXC, ISTUBAL , VALODEX ), and doxorubicin (ADRIAMYCINS).
-82-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
Additional commercially or clinically available anti-cancer agents comprise
oxaliplatin
(ELOXATIN , Sanofi), bortezomib (VELCADE , Millennium Pharm.), sutent
(SUNITINIB , SU11248, Pfizer), letrozole (FEMARAS, Novartis), imatinib
mesylate
(GLEEVEC , Novartis), XL-518 (Mek inhibitor, Exelixis, W 0 2007/044515), ARRY-
886
(Mek inhibitor, AZD6244, Array BioPharma, Astra Zeneca), SF-1126 (PI3K
inhibitor,
Semafore Pharmaceuticals), BEZ-235 (PI3K inhibitor, Novartis), XL-147 (PI3K
inhibitor,
Exelixis), PTK787/ZK 222584 (Novartis), fulvestrant (FASLODEX , AstraZeneca),
leucovorin (folinic acid), rapamycin (sirolimus, RAPAMUNE , Wyeth), lapatinib
(TYKERBC, GSK572016, Glaxo Smith Kline), lonafarnib (SARASARTM, SCH 66336,
Schering Plough), sorafenib (NEXAVAR , BAY43-9006, Bayer Labs), gefitinib
(IRESSA , AstraZeneca), irinotecan (CAMPTOSAR , CPT-11, Pfizer), tipifarnib
(ZARNESTRATm, Johnson & Johnson), ABRAXANETM (Cremophor-free), albumin-
engineered nanoparticle formulations of paclitaxel (American Pharmaceutical
Partners,
Schaumberg, Ill.), vandetanib (rINN, ZD6474, ZACTIMA , AstraZeneca),
chloranmbucil,
AG1478, AG1571 (S17 5271, Sugen), temsirolimus (TORISEL , Wyeth), pazopanib
(GlaxoSmithKline), canfosfamide (TELCYTA TO, Telik), thi otepa and
cyclosphosphamide
(CYTOXAN , NEOSARO); vinorelbine (NAVELBINER); capecitabine (XELODA ,
Roche), tamoxifen (including NOLVADEX ; tamoxifen citrate, FARESTON
(toremifine
citrate) MEGASE (megestrol acetate), AROMASIN (exemestane; Pfizer),
formestanie,
fadrozole, RIVISOR (vorozole), FEMARA (letrozole; Novartis), and ARIMIDEX
(anastrozole; AstraZeneca). This list is not meant to be limiting.
[00204] The antigen-binding fragments of the antibodies of the invention may
also be
conjugated to an anticancer agent. The antigen-binding fragments of the
antibodies of the
invention may also be conjugated to an anticancer agent such as such as
erlotinib
(TARCEVAC, Genentech/OSI Pharm.), docetaxel (TAXOTEREC, Sanofi-Aventis), 5-FU
(fluorouracil, 5-fluorouracil, CAS No. 51-21-8), gemcitabine (GEMZARR, Lilly),
PD-
0325901 (CAS No. 391210-10-9, Pfizer), cisplatin (cis-diamine,
dichloroplatinum(II), CAS
No. 15663-27-1), carboplatin (CAS No. 41575-94-4), paclitaxel (TAXOL , Bristol-
Myers
Squibb Oncology, Princeton, N.J.), trastuzumab (HERCEPTIN , Genentech),
temozolomide
(4-methyl-5-oxo-2,3,4,6,8-pentazabicyclo [4.3.0] nona-2,7,9-triene-9-
carboxamide, CAS No.
85622-93-1, TEMODAR , TEMODAL , Schering Plough), tamoxifen ((Z)-2-[4-(1,2-
-83 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
diphenylbut-l-enyl)phenoxy]-N,N-dimethylethanamine, NOLVADEXO, ISTUBAL ,
VALODEX0), and doxorubicin (ADRIAMYCINS). Additional commercially or
clinically
available anti-cancer agents comprise oxaliplatin (ELOXATINS, Sanofi),
bortezomib
(VELCADE , Millennium Pharm.), sutent (SUNITINIB , SU11248, Pfizer), letrozole
(FEMARAR, Novartis), imatinib mesylate (GLEEVEC , Novartis), XL-518 (Mek
inhibitor,
Exelixis, W 0 2007/044515), ARRY-886 (Mek inhibitor, AZD6244, Array BioPharma,
Astra Zeneca), SF-1126 (PI3K inhibitor, Semafore Pharmaceuticals), BEZ-235
(PI3K
inhibitor, Novartis), XL-147 (PI3K inhibitor, Exelixis), PTK787/ZK 222584
(Novartis),
fulvestrant (FASLODEX , AstraZeneca), leucovorin (folinic acid), rapamycin
(sirolimus,
RAPAMUNE , Wyeth), lapatinib (TYKERB , GSK572016, Glaxo Smith Kline),
lonafarnib (SARASARTM, SCH 66336, Schering Plough), sorafenib (NEXAVAR , BAY43-
9006, Bayer Labs), gefitinib (IRESSAO, AstraZeneca), irinotecan (CAMPTOSAR ,
CPT-
11, Pfizer), tipifarnib (ZARNESTRATm, Johnson & Johnson), ABRAXANETM
(Cremophor-
free), albumin-engineered nanoparticle formulations of paclitaxel (American
Pharmaceutical
Partners, Schaumberg, Ill.), vandetanib (rINN, ZD6474, ZACTIVIAS,
Astra7eneca),
chloranmbucil, AGI 478, AGI 571 (SU 5271; Sugen), temsirolimus (TORISEL ,
Wyeth),
pazopanib (GlaxoSmithKline), canfosfamide (TELCYTAR, Telik), thiotepa and
cyclosphosphamide (CYTOXAN , NEOSAR ); vinorelbine (NAVELBINE0);
capecitabine (XELODA , Roche), tamoxifen (including NOLVADEX , tamoxifen
citrate,
FARESTON (toremifine citrate) MEGASES (megestrol acetate), AROMASIN
(exemestane; Pfizer), formestanie, fadrozole, RIVISOR (vorozole), FEMARA
(letrozole;
Novartis), and ARIMIDEXO (anastrozole; AstraZeneca). This list is not meant to
be
limiting.
[00205] The antibodies and antigen-binding fragments herein may be detectably
labeled
using paramagnetic chelates, microparticles, superparamagnetic particles;
incorporated into
ultrasound bubbles, microparticles, microspheres, emulsions, etc.
[00206] A metal chelator(s) is a molecule having one or more polar groups that
act as a
ligand for, and complex with, a paramagnetic metal. Suitable chelators are
known in the art
and include acids with methylene phosphonic acid groups, methylene
carbohydroxamine acid
groups, carboxyethylidene groups, or carboxymethylene groups. Examples of
chelators
include, but are not limited to, diethylenetriaminepentaacetic acid (DTPA),
1,4,7,10-
-84-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
tetraazacyclo-tetradecane-1,4,7,10-tetraacetic acid (DOTA), 1-substituted
1,4,7,-
tricarboxymethy1-1,4,7,10-teraazacyclododecane (DO3A),
ethylenediaminetetraacetic acid
(EDTA), and 1,4,8,11-tetra-azacyclotetradecane-1,4,8,11-tetraacetic acid
(TETA). Additional
chelating ligands are ethylene bis-(2-hydroxy-phenylglycine) (EHPG), and
derivatives
thereof, including 5-C1-EHPG, 5Br-EHPG, 5-Me-ERPG, 5t-Bu-EHPG, and 5sec-Bu-
EHPG;
benzodiethylenetriamine pentaacetic acid (benzo-DTPA) and derivatives thereof,
including
dibenzo-DTPA, phenyl-DTPA, diphenyl-DTPA, benzyl-DTPA, and dibenzyl DTPA; bis-
2
(hydroxybenzy1)-ethylene-diaminediacetic acid (HBED) and derivatives thereof;
the class of
macrocyclic compounds, which contain at least 3 carbon atoms, more preferably
at least 6,
and at least two heteroatoms (0 and/or N), which macrocyclic compounds can
consist of one
ring, or two or three rings joined together at the hetero ring elements, e.g.,
benzo-DOTA,
dibenzo-DOTA, and benzo-NOTA, where NOTA is 1,4,7-triazacyclononane N,N',N"-
triacetic acid, benzo-TETA, benzo-DOTMA, where DOTMA is 1,4,7,10-
tetraazacyclotetradecane-1,4,7,10-tetra(methyl tetraacetic acid), and benzo-
TETMA, where
TETMA is 1,4,8,11-tetraazacyclotetradecane-1,4,8,11-(methyltetraacetic acid);
derivatives
of 1,3-propylene-diaminetetraacetic acid (PDTA) and
triethylenetetraaminehexaacetic acid
(TTHA); derivatives of 1,5,10-N,N',N"-tris(2,3-dihydroxybenzoy1)-
tricatecholate (LICAM);
and 1,3,5-N,N',N"-tris(2,3-dihydroxybenzoyl) aminomethylbenzene (MECAM).
Examples of
representative chelators and chelating groups contemplated by the present
invention are
described in WO 98/18496, WO 86/06605, WO 91/03200, WO 95/28179, WO 96/23526,
WO 97/36619, PCT/US98/01473, PCT/US98/20182, and U.S. Pat. No. 4,899,755, U.S.
Pat.
No. 5,474,756, U.S. Pat. No. 5,846,519 and U.S. Pat. No. 6,143,274, all of
which are hereby
incorporated by reference.
[00207] Any method known in the art for conjugating the antibodies and antigen-
binding
fragments thereof of the invention to the various moieties may be employed,
including those
methods described by Hunter, etal., (1962) Nature 144:945; David, etal.,
(1974)
Biochemistry 13:1014; Pain, etal., (1981) J. Immunol. Meth. 40:219; and
Nygren, J., (1982)
Histochem. and Cytochem. 30:407. Methods for conjugating antibodies and
fragments are
conventional and very well known in the art.
[00208] Chemical cross-linkers may be classified on the basis of
the following:
-85-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
1. Functional groups and chemical specificity;
2. length and composition of the cross-bridge;
3. whether the cross-linking groups are similar (homobifunctional) or
different
(heterobifunctional);
4. whether the groups react chemically or photochemically;
5. whether the reagent is cleavable; and
6. whether the reagent can be radiolabeled or tagged with another label.
[00209] Reactive groups on antibodies and labels that can be targeted using a
cross-linker
include primary amines, carbonyls, carbohydrates and carboxylic acids. In
addition, many
reactive groups can be coupled nonselectively using a cross-linker such as
photoreactive
phenyl azides. For suitable reagents, see Pierce 2003-2004 Applications
Handbook and
Catalog # 1600926, which is hereby incorporated by reference.
[00210] Many factors must be considered to determine optimum cross-linker-to-
target
molar ratios. Depending on the application, the degree of conjugation is an
important factor.
For example, when preparing immunogen conjugates, a high degree of conjugation
is
normally desired to increase the immunogenicity of the antigen. However, when
conjugating
to an antibody or an enzyme, a low-to-moderate degree of conjugation may be
optimal to
ensure that the biological activity of the protein is retained. It is also
important to consider
the number of reactive groups on the surface of the protein. If there are
numerous target
groups, a lower cross-linker-to-protein ratio can be used. For a limited
number of potential
targets, a higher cross-linker-to-protein ratio may be required. This
translates into more
cross-linker per gram for a small molecular weight protein.
[00211] Conformational changes of proteins associated with a particular
interaction may
also be analyzed by performing cross-linking studies before and after the
interaction. A
comparison is made by using different arm-length cross-linkers and analyzing
the success of
conjugation. The use of cross-linkers with different reactive groups and/or
spacer arms may
-86-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
be desirable when the conformation of the protein changes such that hindered
amino acids
become available for cross-linking.
[00212] Cross-linkers are available with varying lengths of spacer arms or
bridges
connecting the reactive ends. The most apparent attribute of the bridge is its
ability to deal
with steric considerations of the moieties to be linked. Because steric
effects dictate the
distance between potential reaction sites for cross-linking, different lengths
of bridges may
be considered for the interaction. Shorter spacer arms are often used in
intramolecular cross-
linking studies, while intermolecular cross-linking is favored with a cross-
linker containing a
longer spacer arm.
[00213] The inclusion of polymer portions (e.g., polyethylene glycol ("PEG")
homopolymers, polypropylene glycol homopolymers, other alkyl-polyethylene
oxides, bis-
polyethylene oxides and co-polymers or block co-polymers of poly(alkylene
oxides)) in
cross-linkers can, under certain circumstances be advantageous. See, e.g.,
U.S. Patents
5,643,575, 5,672,662, 5,705,153, 5,730,990, 5,902,588, and 5,932,462; and
Topchieva et al.,
Bioconjug. Chem. 6: 380-8, 1995). For example, U.S. Patent 5,672,662 discloses
bifunctional
cross-linkers comprising a PEG polymer portion and a single ester linkage.
Such molecules
are said to provide a half-life of about 10 to 25 minutes in water.
[00214] Designing a cross-linker involves selection of the functional moieties
to be
employed. The choice of functional moieties is entirely dependent upon the
target sites
available on the species to be crosslinked. Some species (e.g., proteins) may
present a
number of available sites for targeting (e.g., lysine E-amino groups, cysteine
sulfhydryl
groups, glutamie acid carboxyl groups, etc.), and selection of a particular
functional moiety
may be made empirically in order to best preserve a biological property of
interest (e.g.,
binding affinity of an antibody, catalytic activity of an enzyme, etc.)
[00215] Coupling through Amine Groups
[00216] Imidoester and N-hydroxysuccinimidyl ("NETS") esters are typically
employed as
amine-specific functional moieties. NHS esters yield stable products upon
reaction with
primary or secondary amines. Coupling is efficient at physiological pH, and
NETS-ester cross-
linkers are more stable in solution than their imidate counterparts.
Homobifunctional NHS-
ester conjugations are commonly used to cross-link amine-containing proteins
in either one-
-87-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
step or two-step reactions. Primary amines are the principle targets for NHS-
esters.
Accessible a-amine groups present on the N-termini of proteins react with NHS-
esters to
form amides. However, because a-amines on a protein are not always available,
the reaction
with side chains of amino acids become important. While five amino acids have
nitrogen in
their side chains, only the e-amino group of lysine reacts significantly with
NHS-esters. A
covalent amide bond is formed when the NHS-ester cross-linking agent reacts
with primary
amines, releasing N-hydroxysuccinimide.
[00217] Coupling through Sulfhydryl Groups
[00218] Maleimides, alkyl and aryl halides, a-haloacyls, and pyridyl
disulfides are
typically employed as sulfhydryl-specific functional moieties. The maleimide
group is
specific for sulfhydryl groups when the pH of the reaction mixture is kept
between pH 6.5
and 7.5. At pH 7, the reaction of the maleimides with sulfhydryls is 1000-fold
faster than
with amines. Maleimides do not react with tyrosines, histidines or methi
nines. When free
sulfhydryls are not present in sufficient quantities, they can often be
generated by reduction
of available disulfide bonds.
[00219] Coupling Through Carboxyl Groups
[00220] Carbodiimides couple carboxyls to primary amines or hydrazides,
resulting in
formation of amide or hydrazone bonds. Carbodiimides are unlike other
conjugation
reactions in that no cross-bridge is formed between the carbodiimide and the
molecules being
coupled; rather, a peptide bond is formed between an available carboxyl group
and an
available amine group. Carboxy termini of proteins can be targeted, as well as
glutamic and
aspartic acid side chains. In the presence of excess cross-linker,
polymerization may occur
because proteins contain both carboxyls and amines. No cross-bridge is formed,
and the
amide bond is the same as a peptide bond, so reversal of the cross-linking is
impossible
without destruction of the protein.
[00221] Nonselective Labeling
[00222] A photoaffinity reagent is a compound that is chemically inert but
becomes
reactive when exposed to ultraviolet or visible light. Arylazides are
photoaffinity reagents
that are ph otolyzed at wavelengths between 250-460 nm, forming a reactive
aryl nitrene. The
-88-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
aryl nitrene reacts nonselectively to form a covalent bond. Reducing agents
must be used
with caution because they can reduce the azido group.
[00223] Carbonyl Specific Cross-Linkers
[00224] Carbonyls (aldehydes and ketones) react with amines and hydrazides at
pH 5-7.
The reaction with hydrazides is faster than with amines, making this useful
for site-specific
cross-linking. Carbonyls do not readily exist in proteins; however, mild
oxidation of sugar
moieties using sodium metaperiodate will convert vicinal hydroxyls to
aldehydes or ketones.
Experimental and Diagnostic Uses
[00225] The anti-CD103 antibodies disclosed herein may be used as affinity
purification
agents. The anti-CD103 antigen-binding fragments disclosed herein may be used
as affinity
purification agents. In this process, the anti-CD103 antibodies and antigen-
binding fragments
thereof are immobilized on a solid phase such a Sephadex, glass or agarose
resin or filter
paper, using methods well known in the art. The immobilized antibody or
fragment is
contacted with a sample containing the CD103 protein (or a fragment thereof)
to be purified,
and thereafter the support is washed with a suitable solvent that will remove
substantially all
the material in the sample except the CD103 protein, which is bound to the
immobilized
antibody or fragment. Finally, the support is washed with a solvent which
elutes the bound
CD103 (e.g., protein A). Such immobilized antibodies and fragments form part
of the present
invention.
[00226] Further provided are antigens for generating secondary antibodies
which are
useful for example for performing Western blots and other immunoassays
discussed herein.
[00227] anti-CD103 antibodies (e.g., humanized antibodies) and
antigen-binding
fragments thereof may also be useful in diagnostic assays for CD103 protein,
e.g., detecting
its expression in specific cells, tissues, or serum, e.g., myeloid cells such
as monocytes,
macrophages, neutrophils, basophils, eosinophils, and dendritic cells. Such
diagnostic
methods may be useful in various disease diagnoses.
[00228] The present invention includes ELIS A assays (enzyme-linked
immunosorbent
assay) incorporating the use of an anti-CD103 antibody or antigen-binding
fragment thereof
disclosed herein.
-89-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00229] For example, such a method comprises the following steps:
(a) coat a substrate (e.g., surface of a microtiter plate well, e.g., a
plastic plate) with anti-
CD103 antibody or antigen-binding fragment thereof;
(b) apply a sample to be tested for the presence of CD103 to the substrate;
(c) wash the plate, so that unbound material in the sample is removed;
(d) apply detectably labeled antibodies (e.g., enzyme-linked antibodies) which
are also
specific to the CD103 antigen;
(e) wash the substrate, so that the unbound, labeled antibodies are removed;
(f) if the labeled antibodies are enzyme linked, apply a chemical which is
converted by the
enzyme into a fluorescent signal, and
(g) detect the presence of the labeled antibody.
[00230] Detection of the label associated with the substrate indicates the
presence of the
CD103 protein.
[00231] In a further embodiment, the labeled antibody or antigen-binding
fragment thereof
is labeled with peroxidase which react with ABTS (e.g., 2,2'-azino-bis(3-
ethylbenzthiazoline-
6-sulphonic acid)) or 3,3',5,5'-Tetramethylbenzidine to produce a color change
which is
detectable. Alternatively, the labeled antibody or fragment is labeled with a
detectable
radioisotope (e.g., 3H) which can be detected by scintillation counter in the
presence of a
scintillant.
[00232] An anti-CD103 antibody or antigen-binding fragment thereof of the
invention
may be used in a Western blot or immune-protein blot procedure. Such a
procedure forms
part of the present invention and includes e.g.:
(1) optionally transferring proteins from a sample to be tested for the
presence of CD103
(e.g., from a PAGE, or SDS-PAGE electrophoretic separation of the proteins in
the
sample) onto a membrane or other solid substrate using a method known in the
art (e.g.,
semi-dry blotting or tank blotting); contacting the membrane or other solid
substrate to be
tested for the presence of bound CD103 or a fragment thereof with an anti-
CD103
antibody or antigen-binding fragment thereof of the invention.
(2) washing the membrane one or more times to remove unbound anti-CD103
antibody
or fragment and other unbound substances; and
-90-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
(3) detecting the bound anti-CD103 antibody or fragment.
[00233] Such a membrane may take the form of a nitrocellulose or vinyl-based
(e.g.,
polyvinylidene fluoride (PVDF)) membrane to which the proteins to be tested
for the
presence of CD103 in a non-denaturing PAGE (polyacrylamide gel
electrophoresis) gel or
SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) gel have
been
transferred (e.g., following electrophoretic separation in the gel). Before
contacting the
membrane with the anti-CD103 antibody or fragment, the membrane is optionally
blocked,
e.g., with non-fat dry milk or the like so as to bind non-specific protein
binding sites on the
membrane.
[00234] Detection of the bound antibody or fragment indicates that the CD103
protein is
present on the membrane or substrate and in the sample. Detection of the bound
antibody or
fragment may be by binding the antibody or fragment with a secondary antibody
(an anti-
immunoglobulin antibody) which is detectably labeled and, then, detecting the
presence of
the secondary antibody.
[00235] The anti-CD103 antibodies and antigen-binding fragments thereof
disclosed
herein may also be used for immunohistochemistry. Such a method forms part of
the present
invention and comprises, e.g.,
(1) contacting a cell (e.g., a sample containing myeloid cells such as
monocytes,
macrophages, neutrophils, basophils, eosinophils, and dendritic cells) to be
tested for
the presence of CD103 protein with an anti-CD103 antibody or antigen-binding
fragment thereof of the invention; and
(2) detecting the antibody or fragment on or in the cell.
[00236] If the antibody or fragment itself is detectably labeled, it can be
detected directly.
Alternatively, the antibody or fragment may be bound by a detectably labeled
secondary
antibody which is detected.
[00237]
Certain anti-CD103 antibodies and antigen-binding fragments thereof
disclosed
herein may also be used for in vivo tumor imaging. Such a method may include
injection of a
radiolabeled anti-CD103 antibody or antigen-binding fragment thereof into the
body of a
patient to be tested for the presence of a tumor associated with CD103
expression (e.g.,
-91 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
which expresses CD103, for example, on the tumor cell surface) followed by
nuclear
imaging of the body of the patient to detect the presence of the labeled
antibody or fragment
e.g., at loci comprising a high concentration of the antibody or fragment
which are bound to
the tumor. The detection of the loci indicates the presence of the CD10311
tumor and tumor
cells.
[00238] Imaging techniques include SPECT imaging (single photon emission
computed
tomography) or PET imaging (positron emission tomography). Labels include
e.g., iodine-
123 (1231) and technetium-99m (99mTc), e.g., in conjunction with SPECT imaging
or "C, 13N,
150 or 18F, e.g., in conjunction with PET imaging or Indium-111 (See e.g.,
Gordon et al.,
(2005) International Rev. Neurobiol. 67:385-440).
Pharmaceutical Compositions and Administration and Therapeutic Uses
[00239] Antibodies of the present invention can inhibit CD103
signaling and, accordingly,
in one aspect of the invention, certain antibodies disclosed herein are
candidates for treating,
or preventing certain conditions and diseases. The present invention provides
methods for
treating conditions and diseases wherein the course of the condition or
disease can be
influenced by CD103 signaling. The method includes administering to a subject
in need of
such treatment, a therapeutically effective amount of an antibody of the
present invention.
[00240] Integrin family heterodimers play diverse and redundant roles in T-
cell activation,
homing, and delivery of effector function. The CD103 integrin heterodimer was
initially
identified by its expression on T cells in the vertebrate gut mucosa, where it
is expressed at
high levels by >95% of intestinal intraepithelial lymphocytes (iIEL) and -40%
lamina propria
lymphocytes. CD103 recognizes the epithelial cell-specific ligand, E-cadherin.
In normal
mice and humans, CD8+ T cells that reside within the gut epithelium express
high levels of
CD103, and CD103 is widely expressed in intraepithelial lymphocytes, tumor
infiltrating
lymphocytes and certain dendritic cells. Previous studies have demonstrated
that CD103
serves an important role in the cell lysis caused by tumor-specific
infiltrating lymphocytes
via interacting with its ligand, E-cadherin, on the tumor cells, triggering
lytic granule
polarization and exocytosis. Furthermore, the ligation of CD103 and E-cadherin
promotes the
-92-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
adhesion of T cells to tumor cells and induces co-stimulation in activated
cytotoxic T cells.
These findings suggest that CD103 may be a target for enhancing tumor
immunity.
[00241] In various embodiments, antibodies of the present invention block
binding to E-
cadherin; are used to deplete CD103 I cells; deplete CD103 I CD8 I effector
cells; and/or are
used to deplete tissue-resident memory T cells (TRm).
[00242] The present invention also provides a method of treating a CD103
signaling-
mediated condition, comprising administering to a patient in need thereof an
effective
amount of one or more antibodies of the present invention. In some
embodiments, CD103
signaling-mediated condition is an autoimmune, inflammatory, or
neurodegenerative
condition or cancer (see Rayburn, E. R. et al., Mol Cell Pharmaco1.2009; 1(1):
29-43 and
Urbanska, A.M. et al., Cell Biochem Biophys.2015 Jul;72(3):757-69).
[00243] CD103 in Allograft Rejection
[00244] FACS analyses of transplant nephrectomy specimens revealed that a
major subset
of CD8 effectors that infiltrated allografts undergoing rejection episodes
expressed high
levels of CD103. Interestingly, CD103+CD8+ effectors are most abundant in
renal allografts
undergoing rejection episodes in the context of chronic allograft nephropathy.
Importantly,
CD103+CD8+ effectors are not present in peripheral lymphoid compartments
(i.e., peripheral
blood lymphocytes), and thus are not detectable by conventional immune
monitoring
approaches. However, CD103 mRNA is expressed by cells isolated from the urine
of renal
allograft recipients concomitant with clinical rejection, consistent with the
intratubular
localization of CD103+CD8+ effectors during rejection episodes. The clinical
observations
noted above are consistent with a key role for CD103 in promoting destruction
of graft
epithelial compartments by CD8 effector populations, and support the
hypothesis that CD103
expression is required for CD8-mediated destruction of graft epithelial
elements. Antibodies
of the invention as described herein can be used in the treatment of allograft
rejection.
Antibodies of the invention as described herein can be used in the prevention
of allograft
rejection. Antigen binding fragments of the invention as described herein can
be used in the
treatment of allograft rejection. Antigen binding fragments of the invention
as described
herein can be used in the prevention of allograft rejection.
[00245] Tissue-resident memory T cells
-93-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00246] It has long been known that the recurrence of cutaneous chronic
inflammation,
especially psoriasis and FDE, frequently occurs in previously affected sites.
Therefore,
immunological memory has been proposed to be involved in flare-up reactivity
and the
chronicity of inflammatory disorders. With respect to the striking
characteristics of TRm cells
(long-term survival and low migration in peripheral tissues), it has been
suggested that skin
TRM cells may actively participate in the recurrence of inflammatory skin
disorders.
[00247] The primary onset of psoriatic lesions is often followed by recurrence
in
previously resolved sites, and local resident memory T cells have been
suggested to play a
role in its development and flare-ups. CDS+ T cells in psoriatic lesions are
highly activated
and express large amounts of CD69 and CD103. In contrast, few T cells
constitutively
express these proteins in the peripheral blood, Furthermore, it is clear that
TEM cells interact
with the vascular addressin E-selectin and are trafficked to the skin during
infection or attack.
More importantly, recent studies have shown that TCRotr resident T cells
accumulate in
psoriatic resolved sites, even in normal-appearing skin, and that they are
capable of
producing IL-17 and IFN-y to trigger psoriasiform responses. These findings
support the
important role of lesion-resident T cells in psoriasis development. Antibodies
of the
invention as described herein can be used in the treatment of psoriasis.
Antibodies of the
invention as described herein can be used in the prevention of psoriasis.
Antigen binding
fragments of the invention as described herein can be used in the treatment of
psoriasis.
Antigen binding fragments of the invention as described herein can be used in
the prevention
of psoriasis.
[00248] Inflammatory Bowel Disease and CD103
[00249] An important pathological process increasingly recognised as driving
intestinal
inflammation and autoimmunity is the loss of immune homeostasis secondary to
qualitative
or quantitative defects in the regulatory T-cell (Treg) pool. Tregs can be
broadly divided into
two groups, thymic Tregs (tTregs) or peripherally induced Tregs (pTregs),
based on their
developmental origin. T cells could be converted into Foxp3-expressing
CD4+CD25+Tregs
by T-cell receptor (TCR) costimulation in the presence of transforming growth
factor 13
(TGF-13).14 pTreg conversion in gut-associated lymphoid tissues (GALTs) was
enhanced
when naive CD4+ T cells encountered antigen in the presence of TGF-13, IL-2
and retinoic
-94-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
acid (RA). 15 16 This is facilitated by CD103+DCs conditioned by the
intestinal
microenvironment to produce or activate TGF-I3 and provide RA.17 18 In the
absence of
CD103 expression, DCs fail to induce Treg development and produce
proinflammatory
cytokines. In patients with UC, it has been reported reported that CD103
expression on
colonic CD4- T cells was associated with increased production of
proinflammatory Thl,
Th17, and Thl/Thl 7 cytokines, and CD103+ DCs in patients with UC had an
ability to drive
Th1/Th2/Th17 cell responses. Therefore, the efficacy of targeting integrins
might be
explained by elimination of colitogenic CD103+ dendritic cells and blockade of
lymphocytes
recruitment. Antibodies of the invention as described herein can be used in
the treatment of
inflammatory bowel disease. Antibodies of the invention as described herein
can be used in
the prevention of inflammatory bowel disease. Antigen binding fragments of the
invention as
described herein can be used in the treatment of inflammatory bowel disease.
Antigen
binding fragments of the invention as described herein can be used in the
prevention of
inflammatory bowel disease.
[00250] CD103+ Lymphoproliferative Disorders
[00251] Flow cytometric immunophenotyping is vital in the diagnosis of B-cell
lymphoproliferative disorders (BC-LPDs), including B-cell chronic lymphocytic
leukemia
(CLL), mantle cell lymphoma (IVICL), and hairy cell leukemia (HCL). In the
diagnostic
evaluation of low-grade B-cell lymphoproliferative processes, demonstration of
CM 03
positivity is indicative of a diagnosis of hairy cell leukemia (HCL) or its
variant form HCLv.
[00252] In addition to these B-cell disorders, CD103 positivity is also a
feature in a subset
of T cell neoplasms. In one study of 184 cases representing most entities
within the current
World Health Organization classification of T cell neoplasms, 46% of
gastrointestinal
lymphomas, 40% of adult T cell leukaemia/lymphoma, and 6.9% of other neoplasms
exhibited CD103 positivity. Likewise, Blastic Plasmacytoid Dendritic Cell
Neoplasms
(BPDCN) express CD103.
[00253] Antibodies of the invention as described herein can be used in the
treatment of
lymphoproliferative disorders. Antigen binding fragments of the invention as
described
herein can be used in the treatment of lymphoproliferative disorders.
Lymphoproliferative
disorders expressing CD103 that may be treated using the antibodies of the
present invention
-95-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
include, but are not limited to, Hairy Cell leukemia, HCLv, intestinal and
extraintestinal
lymphomas, enteropathy-associated T-cell lymphoma (EATL), T-lymphoblastic
leukemia/lymphoma (T-ALL), T-cell prolymphocytic leukemia (T-PLL), adult T
cell
leukemia/lymphoma (ATLL), mycosis fungoides ( MF), anaplastic large cell
lymphoma
ALCL, cutaneous T-cell lymphoma (CTCL), and Blastic Plasmacytoid Dendritic
Cell
Neoplasm.
[00254] CD103 in Tumorigenesis
[00255] It has been reported that tumor-associated CD103+ CD8 T cells have a
tolerogenic phenotype with increased expression of CTLA-4 and IL-10 and
decreased
expression of IFN-y, TNF-a, and granzymes. Moreover, CD103 has been described
as a
marker of CD4+ regulatory cells and is present on tolerogenic DCs. Direct
targeting of
CD103 by an anti-CD103 antibody that reduces CD103+ CD8 T cells in mice
reportedly
provides a therapeutic effect in the B16 melanoma and MC38 CRC models.
Antibodies of
the invention as described herein can be used in the treatment of
tumorigenesis. Antibodies
of the invention as described herein can be used in the prevention of
tumorigenesis. Antigen
binding fragments of the invention as described herein can be used in the
treatment of
tumorigenesis. Antigen binding fragments of the invention as described herein
can be used in
the prevention of tumorigenesis. Antibodies of the invention as described
herein can be used
in mitigating the progression of tumorigenesis.
[00256] Therapeutic Applications of CD103 Antibodies of the present invention
[00257] The present invention provides the use of one or more antibodies of
the present
invention for inhibiting CD103 signaling in a cell.
[00258] The present invention provides the use of one or more antibodies of
the present
invention for inhibiting CD103 binding to E-cadherin and to E-cadherin-
expressing cells.
[00259] The present invention further provides the use of one or more
antibodies of the
present invention for the treatment of a CD103-mediated condition.
[00260] The present invention provides the use of one or more antibodies of
the present
invention for depleting CD103-expressing cells.
-96-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00261] The present invention further provides the use of one or more
antibodies of the
present invention in the manufacture of a medicament for one of the foregoing
uses.
[00262] Antibodies of the invention as described herein, can be useful in
treating a variety
of diseases, where the modulation of CD103 signaling can provide therapeutic
benefit. In
some aspects, a compound of the invention inhibits CD103 signaling, and can be
useful in
treating a disease selected from the group consisting of atopic dermatitis,
allergy, asthma,
systemic inflammatory response syndrome (SIRS), sepsis, septic shock,
atherosclerosis,
celiac disease, dermatomyositis, scleroderma, interstitial cystitis,
transplant rejection, graft-
versus-host disease, Aicardi-Goutieres Syndrome, Hutchison Guilford progeria
syndrome,
Singleton- Merten Syndrome, proteasome-associated autoinflammatory syndrome,
SAVI
(STING- associated vasculopathy with onset in infancy), CANDLE (Chronic
Atypical
Neutrophilic Dermatosis with Lipodystrophy and Elevated Temperature) syndrome,
chilblain
lupus erythematosus, systemic lupus erythematosus, rheumatoid arthritis,
juvenile
rheumatoid arthritis, Wegener's disease, inflammatory bowel disease (e.g.
ulcerative colitis,
Crohn's disease), idiopathic thrombocytopenic purpura, thrombotic
thrombocytopenic
purpura, autoimmune thrombocytopenia, multiple sclerosis, psoriasis, IgA
nephropathy, IgM
polyneuropathies, glomerulonephritis, autoimmune myocarditis, myasthenia
gravis,
vasculitis, Type 1 diabetes, Type 2 diabetes, Sjorgen's syndrome, X-linked
reticulate
pigmentary disorder, polymyositis, spondyloenchondrodysplasia, age-related
macular
degeneration, Alzheimer's disease and Parkinson's disease. In some
embodiments,
compounds of the invention are useful in treating Aicardi-Goutieres Syndrome,
X-linked
reticulate pigmentary disorder, dermatomyositis, systemic lupus erythematosus,
rheumatoid
arthritis, multiple sclerosis, or Type I or Type II diabetes. Antibodies of
the invention as
described herein are preferably used in the treatment of inflammatory bowel
disease.
Antibodies of the invention as described herein are preferably used in the
treatment of
psoriasis.
[00263] The present invention provides a method of treating an autoimmune
disease in a
subject, comprising administering to the subject in need thereof a
therapeutically effective
amount of one or more antibodies of the present invention. In some
embodiments, the
autoimmune disease can be a type I interferonopathy (e.g., Aicardi- Goutieres
Syndrome,
Sjogren's syndrome, Singleton-Merten Syndrome, proteasome- associated
autoinflammatory
-97-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
syndrome, SAVI (STING-associated vasculopathy with onset in infancy), CANDLE
syndrome, chilblain lupus erythematosus, systemic lupus erythematosus,
spondyloenchondrodysplasia), rheumatoid arthritis, juvenile rheumatoid
arthritis, idiopathic
thrombocytopenic purpura, autoimmune myocarditis, thrombotic thrombocytopenic
purpura,
autoimmune thrombocytopenia, psoriasis, Type 1 diabetes, or Type 2 diabetes.
[00264] The present invention provides a method of treating an inflammatory
disease in a
subject, comprising administering to the subject in need thereof a
therapeutically effective
amount of one or more antibodies of the present invention. For example, the
inflammatory
disease can be selected from the group consisting of atopic dermatitis,
allergy, asthma,
systemic inflammatory response syndrome (SIRS), sepsis, septic shock,
atherosclerosis,
celiac disease, dermatomyositis, scleroderma, interstitial cystitis,
transplant rejection, graft-
versus-host disease, Aicardi-Goutieres Syndrome, Hutchison Guilford progeria
syndrome,
Singleton- Merten Syndrome, proteasome-associated autoinflammatory syndrome,
SAVI
(STING- associated vasculopathy with onset in infancy), CANDLE (Chronic
Atypical
Neutrophilic Dermatosis with Lipodystrophy and Elevated Temperature) syndrome,
chilblain
lupus erythematosus, systemic lupus erythematosus, rheumatoid arthritis,
juvenile
rheumatoid arthritis, Wegener's disease, inflammatory bowel disease (e.g.
ulcerative colitis,
Crohn's disease), idiopathic thrombocytopenic purpura, thrombotic
thrombocytopenic
purpura, autoimmune thrombocytopenia, multiple sclerosis, psoriasis, IgA
nephropathy, IgM
polyneuropathies, glomerulonephritis, autoimmune myocarditis, myasthenia
gravis,
vasculitis, Type 1 diabetes, Type 2 diabetes, Sjorgen's syndrome, X-linked
reticulate
pigmentary disorder, polymyositis, spondyloenchondrodysplasia, age-related
macular
degeneration, Alzheimer's disease and Parkinson's disease. In some
embodiments,
compounds of the invention are useful in treating A i cardi-Gouti eres
Syndrome, X-linked
reticulate pigmentary disorder, dermatomyositis, systemic lupus erythematosus,
rheumatoid
arthritis, multiple sclerosis, or Type I or Type II diabetes.
[00265] The present invention further provides a method of treating
neurodegenerative
diseases in a subject, comprising administering to the subject in need thereof
a
therapeutically effective amount of one or more antibodies of the present
invention. For
example, the neurodegenerative disease can be Alzheimer's disease, Parkinson's
disease,
multiple sclerosis, IgM polyneuropathies, or myasthenia gravis.
-98-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00266] The present invention further provides a method of treating
malignancies
expressing CD103. For example, the malignancies may be T- and B-cell
lymphomas, and
particularly Hairy Cell leukemia, HCLv, intestinal and extraintestinal
lymphomas,
enteropathy-associated T-cell lymphoma (EATL), T-lymphoblastic
leukemia/lymphoma (T-
ALL), T-cell prolymphocytic leukemia (T-PLL), adult T cell leukemia/lymphoma
(ATLL),
mycosis fungoides ( MF), anaplastic large cell lymphoma ALCL, cutaneous T-cell
lymphoma (CTCL), Sezary Syndrome (SS).
[00267] To prepare pharmaceutical or sterile compositions of the anti-CD103
antibodies
and antigen-binding fragments of the invention, the antibody or antigen-
binding fragment
thereof is admixed with a pharmaceutically acceptable carrier or excipient.
See, e.g.,
Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary,
Mack
Publishing Company, Easton, PA (1984).
[00268] Formulations of therapeutic and diagnostic agents may be prepared by
mixing
with acceptable carriers, excipients, or stabilizers in the form of, e.g.,
lyophilized powders,
slurries, aqueous solutions or suspensions (see, e.g., Hardman, et at. (2001)
Goodman and
Gilman 's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York,
NY;
Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott,
Williams,
and Wilkins, New York, NY; Avis, et at. (eds.) (1993) Pharmaceutical Dosage
Forms:
Parenteral Medications, Marcel Dekker, NY; Lieberman, etal. (eds.) (1990)
Pharmaceutical
Dosage Forms: Tablets, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990)
Pharmaceutical
Dosage Forms: Disperse Systems, Marcel Dekker, NY; Weiner and Kotkoskie (2000)
Excipient Toxicity and Safety, Marcel Dekker, Inc., New York, NY).
[00269] Toxicity and therapeutic efficacy of the antibodies of the invention,
administered
alone or in combination with another therapeutic agent, can be determined by
standard
pharmaceutical procedures in cell cultures or experimental animals, e.g., for
determining the
LD50 (the dose lethal to 50% of the population) and the ED50 (the dose
therapeutically
effective in 50% of the population). The dose ratio between toxic and
therapeutic effects is
the therapeutic index (LD5o/ ED5o). The data obtained from these cell culture
assays and
animal studies can be used in formulating a range of dosage for use in human.
The dosage of
such compounds lies preferably within a range of circulating concentrations
that include the
-99-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
ED50 with little or no toxicity. The dosage may vary within this range
depending upon the
dosage form employed and the route of administration.
[00270] In a further embodiment, a further therapeutic agent that is
administered to a
subject in association with an anti-CD103 antibody or antigen-binding fragment
thereof of
the invention in accordance with the Physicians' Desk Reference 2003 (Thomson
Healthcare;
57th edition (November 1, 2002)).
[00271] The mode of administration can vary. Routes of administration include
oral,
rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous,
intradermal,
intramedullary, intrathecal, direct intraventricular, intravenous,
intraperitoneal, intranasal,
intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or
intra-arterial.
[00272] In particular embodiments, the anti-CD103 antibodies or antigen-
binding
fragments thereof of the invention can be administered by an invasive route
such as by
injection. In further embodiments of the invention, an anti-CD103 antibody or
antigen-
binding fragment thereof, or pharmaceutical composition thereof, is
administered
intravenously, subcutaneously, intramuscularly, intraarterially,
intratumorally, or by
inhalation, aerosol delivery. Administration by non-invasive routes (e.g,
orally; for example,
in a pill, capsule or tablet) is also within the scope of the present
invention.
[00273]
The present invention provides a vessel (e.g., a plastic or glass vial,
e.g., with a
cap or a chromatography column, hollow bore needle or a syringe cylinder)
comprising any
of the antibodies or antigen-binding fragments of the invention or a
pharmaceutical
composition thereof. The present invention also provides an injection device
comprising any
of the antibodies or antigen-binding fragments of the invention or a
pharmaceutical
composition thereof. An injection device is a device that introduces a
substance into the body
of a patient via a parenteral route, e.g., intramuscular, subcutaneous or
intravenous. For
example, an injection device may be a syringe (e.g., pre-filled with the
pharmaceutical
composition, such as an auto-injector) which, for example, includes a cylinder
or barrel for
holding fluid to be injected (e.g., antibody or fragment or a pharmaceutical
composition
thereof), a needle for piecing skin and/or blood vessels for injection of the
fluid; and a
plunger for pushing the fluid out of the cylinder and through the needle bore.
In an
embodiment of the invention, an injection device that comprises an antibody or
antigen-
-100-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
binding fragment thereof of the present invention or a pharmaceutical
composition thereof is
an intravenous (IV) injection device. Such a device includes the antibody or
fragment or a
pharmaceutical composition thereof in a cannula or trocar/needle which may be
attached to a
tube which may be attached to a bag or reservoir for holding fluid (e.g.,
saline; or lactated
ringer solution comprising NaC1, sodium lactate, KC1, CaCl2 and optionally
including
glucose) introduced into the body of the patient through the cannula or
trocar/needle. The
antibody or fragment or a pharmaceutical composition thereof may, in an
embodiment of the
invention, be introduced into the device once the trocar and cannula are
inserted into the vein
of a subject and the trocar is removed from the inserted cannula. The IV
device may, for
example, be inserted into a peripheral vein (e.g., in the hand or arm); the
superior vena cava
or inferior vena cava, or within the right atrium of the heart (e.g., a
central IV); or into a
subclavian, internal jugular, or a femoral vein and, for example, advanced
toward the heart
until it reaches the superior vena cava or right atrium (e.g., a central
venous line). In an
embodiment of the invention, an injection device is an autoinjector; a jet
injector or an
external infusion pump. A jet injector uses a high-pressure narrow jet of
liquid which
penetrate the epidermis to introduce the antibody or fragment or a
pharmaceutical
composition thereof to a patient's body_ External infusion pumps are medical
devices that
deliver the antibody or fragment or a pharmaceutical composition thereof into
a patient's
body in controlled amounts. External infusion pumps may be powered
electrically or
mechanically. Different pumps operate in different ways, for example, a
syringe pump holds
fluid in the reservoir of a syringe, and a moveable piston controls fluid
delivery, an
elastomeric pump holds fluid in a stretchable balloon reservoir, and pressure
from the elastic
walls of the balloon drives fluid delivery. In a peristaltic pump, a set of
rollers pinches down
on a length of flexible tubing, pushing fluid forward. In a multi-channel
pump, fluids can be
delivered from multiple reservoirs at multiple rates.
[00274] The pharmaceutical compositions disclosed herein may also be
administered with
a needleless hypodermic injection device; such as the devices disclosed in
U.S. Patent Nos.
6,620,135; 6,096,002; 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880;
4,790,824 or
4,596,556. Such needleless devices comprising the pharmaceutical composition
are also part
of the present invention. The pharmaceutical compositions disclosed herein may
also be
administered by infusion. Examples of well-known implants and modules for
administering
-101-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
the pharmaceutical compositions include those disclosed in: U.S. Patent No.
4,487,603,
which discloses an implantable micro-infusion pump for dispensing medication
at a
controlled rate; U.S. Patent No. 4,447,233, which discloses a medication
infusion pump for
delivering medication at a precise infusion rate; U.S. Patent No. 4,447,224,
which discloses a
variable flow implantable infusion apparatus for continuous drug delivery;
U.S. Patent. No.
4,439,196, which discloses an osmotic drug delivery system having multi-
chamber
compartments. Many other such implants, delivery systems, and modules are well
known to
those skilled in the art and those comprising the pharmaceutical compositions
of the present
invention are within the scope of the present invention.
[00275] Alternately, one may administer the anti-CD103 antibody or antigen-
binding
fragment of the invention in a local rather than systemic manner, for example,
via injection
of the antibody or fragment directly into a tumor. Furthermore, one may
administer the
antibody or fragment in a targeted drug delivery system, for example, in a
liposome coated
with a tissue-specific antibody, targeting, for example, a tumor. The
liposomes will be
targeted to and taken up selectively by the afflicted tissue. Such methods and
liposomes are
part of the present invention.
[00276] The administration regimen depends on several factors, including the
scrum or
tissue turnover rate of the therapeutic antibody or antigen-binding fragment,
the level of
symptoms, the immunogenicity of the therapeutic antibody, and the
accessibility of the target
cells in the biological matrix. Preferably, the administration regimen
delivers sufficient
therapeutic antibody or fragment to effect improvement in the target disease
state, while
simultaneously minimizing undesired side effects. Accordingly, the amount of
biologic
delivered depends in part on the particular therapeutic antibody and the
severity of the
condition being treated. Guidance in selecting appropriate doses of
therapeutic antibodies or
fragments is available (see, e.g., Wawrzynczak (1996) Antibody Therapy, Bios
Scientific
Pub. Ltd, Oxfordshire, UK; Kresina (ed.) (1991) Monoclonal Antibodies,
Cytokines and
Arthritis, Marcel Dekker, New York, NY; Bach (ed.) (1993) Monoclonal
Antibodies and
Peptide Therapy in Alltoimmune Diseases, Marcel Dekker, New York, NY; Baert,
et al.
(2003) New Engl. J. Med. 348:601-608; Milgrom et al. (1999) New Engl. J. Med.
341:1966-
1973; Slamon et al. (2001) New Engl. J. Med. 344:783-792; Beniaminovitz et al.
(2000) New
-102-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
EngL J. Med. 342:613-619; Ghosh etal. (2003) New Engl. J. Med. 348:24-32;
Lipsky etal.
(2000) New Engl. J. Med. 343:1594-1602).
[00277] Determination of the appropriate dose is made by the clinician, e.g.,
using
parameters or factors known or suspected in the art to affect treatment.
Generally, the dose
begins with an amount somewhat less than the optimum dose and it is increased
by small
increments thereafter until the desired or optimum effect is achieved relative
to any negative
side effects. Important diagnostic measures include those of symptoms of,
e.g., the
inflammation or level of inflammatory cytokines produced. In general, it is
desirable that a
biologic that will be used is derived from the same species as the animal
targeted for
treatment, thereby minimizing any immune response to the reagent. In the case
of human
subjects, for example, humanized and fully human antibodies may be desirable.
[00278] Antibodies or antigen-binding fragments thereof disclosed herein may
be
provided by continuous infusion, or by doses administered, e.g., daily, 1-7
times per week,
weekly, bi-weekly, monthly, bimonthly, quarterly, semiannually, annually etc.
Doses may be
provided, e.g., intravenously, subcutaneously, topically, orally, nasally,
rectally,
intramuscular, intracerebrally, intraspinally, or by inhalation. A total
weekly dose is
generally at least 0.05 Kg/kg body weight, more generally at least 0.2 Kg/kg,
0.5 Kg/kg, 1
Kg/kg, 10 jig/kg, 100 Kg/kg, 0.25 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 5.0 mg/mL, 10
mg/kg, 25
mg/kg, 50 mg/kg or more (see, e.g., Yang, etal. (2003) New EngL J. Med.
349:427-434;
Herold, etal. (2002) New Engl. J. Med. 346:1692-1698; Liu, et al. (1999) J.
Neural.
Neurosurg. Psych. 67: 451-456; Portielji, et al. (20003) Cancer ImmunoL
Ininiunother. 52:
151-144). Doses may also be provided to achieve a pre-determined target
concentration of
anti-CD103 antibody in the subject's serum, such as 0.1, 0.3, 1, 3, 10, 30,
100, 300 lig/mL or
more. In other embodiments, An anti-CD103 antibody of the present invention is
administered, e.g., subcutaneously or intravenously, on a weekly, biweekly,
"every 4 weeks,"
monthly, bimonthly, or quarterly basis at 10, 20, 50, 80, 100, 200, 500, 1000
or 2500
mg/subject.
[00279] As used herein, the term "effective amount" refer to an amount of an
anti-CD103
or antigen-binding fragment thereof of the invention that, when administered
alone or in
combination with an additional therapeutic agent to a cell, tissue, or
subject, is effective to
-103 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
cause a measurable improvement in one or more symptoms of disease, for example
cancer or
the progression of cancer. An effective dose further refers to that amount of
the antibody or
fragment sufficient to result in at least partial amelioration of symptoms,
e.g., tumor
shrinkage or elimination, lack of tumor growth, increased survival time. When
applied to an
individual active ingredient administered alone, an effective dose refers to
that ingredient
alone. When applied to a combination, an effective dose refers to combined
amounts of the
active ingredients that result in the therapeutic effect, whether administered
in combination,
serially or simultaneously. An effective amount of a therapeutic will result
in an
improvement of a diagnostic measure or parameter by at least 10%; usually by
at least 20%;
preferably at least about 30%; more preferably at least 40%, and most
preferably by at least
50%. An effective amount can also result in an improvement in a subjective
measure in cases
where subjective measures are used to assess disease severity.
Kits
[00280] Further provided are kits comprising one or more components that
include, but
are not limited to, an anti-CD103 antibody or antigen-binding fragment, as
discussed herein
in association with one or more additional components including, but not
limited to a
pharmaceutically acceptable carrier and/or a therapeutic agent, as discussed
herein. The
antibody or fragment and/or the therapeutic agent can be formulated as a pure
composition or
in combination with a pharmaceutically acceptable carrier, in a pharmaceutical
composition.
[00281] In one embodiment, the kit includes an anti-CD103 antibody or antigen-
binding
fragment thereof of the invention or a pharmaceutical composition thereof in
one container
(e.g., in a sterile glass or plastic vial) and/or a therapeutic agent and a
pharmaceutical
composition thereof in another container (e.g., in a sterile glass or plastic
vial).
[00282] In another embodiment, the kit comprises a combination of the
invention,
including an anti-CD103 antibody or antigen-binding fragment thereof of the
invention along
with a pharmaceutically acceptable carrier, optionally in combination with one
or more
therapeutic agents formulated together, optionally, in a pharmaceutical
composition, in a
single, common container.
-104-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00283] If the kit includes a pharmaceutical composition for parenteral
administration to a
subject, the kit can include a device for performing such administration. For
example, the kit
can include one or more hypodermic needles or other injection devices as
discussed above.
[00284] The kit can include a package insert including information concerning
the
pharmaceutical compositions and dosage forms in the kit. Generally, such
information aids
patients and physicians in using the enclosed pharmaceutical compositions and
dosage forms
effectively and safely. For example, the following information regarding a
combination of
the invention may be supplied in the insert: pharmacokinetics,
pharmacodynamics, clinical
studies, efficacy parameters, indications and usage, contraindications,
warnings, precautions,
adverse reactions, overdosage, proper dosage and administration, how supplied,
proper
storage conditions, references, manufacturer/distributor information and
patent information.
Detection Kits
[00285] Also provided are diagnostic or detection reagents and kits comprising
one or
more such reagents for use in a variety of detection assays, including for
example,
immunoassays such as ELISA (sandwich-type or competitive format). The kit's
components
may be pre-attached to a solid support, or may be applied to the surface of a
solid support
when the kit is used. In some embodiments of the invention, the signal
generating means may
come pre-associated with an antibody or fragment of the invention or may
require
combination with one or more components, e.g., buffers, antibody-enzyme
conjugates,
enzyme substrates, or the like, prior to use. Kits may also include additional
reagents, e.g.,
blocking reagents for reducing nonspecific binding to the solid phase surface,
washing
reagents, enzyme substrates, and the like. The solid phase surface may be in
the form of a
tube, a bead, a microtiter plate, a microsphere, or other materials suitable
for immobilizing
proteins, peptides, or polypeptides. In particular aspects, an enzyme that
catalyzes the
formation of a chemilluminescent or chromogenic product or the reduction of a
chemilluminescent or chromogenic substrate is a component of the signal
generating means.
Such enzymes are well known in the art. Kits may comprise any of the capture
agents and
detection reagents described herein. Optionally the kit may also comprise
instructions for
carrying out the methods of the invention.
-105-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00286] The detection kits disclosed herein may also be prepared that comprise
at least
one of the antibody, peptide, antigen-binding fragment, or polynucleotide
disclosed herein
and instructions for using the composition as a detection reagent. Containers
for use in such
kits may typically comprise at least one vial, test tube, flask, bottle,
syringe or other suitable
container, into which one or more of the detection composition(s) may be
placed, and
preferably suitably aliquoted. The kits disclosed herein will also typically
include a means for
containing the vial(s) in close confinement for commercial sale, such as,
e.g., injection or
blow-molded plastic containers into which the desired vial(s) are retained.
Where a
radiolabel, chromogenic, fluorigenic, or other type of detectable label or
detecting means is
included within the kit, the labeling agent may be provided either in the same
container as the
detection or therapeutic composition itself, or may alternatively be placed in
a second distinct
container means into which this second composition may be placed and suitably
aliquoted.
Alternatively, the detection reagent and the label may be prepared in a single
container
means, and in most cases, the kit will also typically include a means for
containing the vial(s)
in close confinement for commercial sale and/or convenient packaging and
delivery.
GENERAL METHODS
[00287] Standard methods in molecular biology are described Sambrook, Fritsch
and
Maniatis (1982 & 1989 2nd Edition, 2001 3rd Edition) Molecular Cloning, A
Laboratory
Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; Sambrook
and
Russell (2001) Molecular Cloning, 3rd ed., Cold Spring Harbor Laboratory
Press, Cold
Spring Harbor, NY; Wu (1993) Recombinant DNA, Vol. 217, Academic Press, San
Diego,
CA). Standard methods also appear in Ausbel, et al. (2001) Current Protocols
in Molecular
Biology, Vols. 1-4, John Wiley and Sons, Inc. New York, NY, which describes
cloning in
bacterial cells and DNA mutagenesis (Vol. 1), cloning in mammalian cells and
yeast (Vol. 2),
glycoconjugates and protein expression (Vol. 3), and bioinformatics (Vol. 4).
[00288] Methods for protein purification including immunoprecipitation,
chromatography,
electrophoresis, centrifugation, and crystallization are described (Coligan,
et al. (2000)
Current Protocols in Protein Science, Vol. /, John Wiley and Sons, Inc., New
York).
Chemical analysis, chemical modification, post-translational modification,
production of
fusion proteins, glycosylation of proteins are described (see, e.g., Coligan,
etal. (2000)
-106-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
Current Protocols in Protein Science, Vol. 2, John Wiley and Sons, Inc., New
York;
Ausubel, etal. (2001) Current Protocols in Molecular Biology, Vol. 3, John
Wiley and Sons,
Inc., NY, NY, pp. 16Ø5-16.22.17; Sigma-Aldrich, Co. (2001) Products for Life
Science
Research, St. Louis, MO; pp. 45-89; Amersham Pharmacia Biotech (2001)
BioDirectory,
Piscataway, N.J., pp. 384-391). Production, purification, and fragmentation of
polyclonal and
monoclonal antibodies are described (Coligan, etal. (2001) Current Protcols in
Immunology,
Vol. 1, John Wiley and Sons, Inc., New York; Harlow and Lane (1999) Using
Antibodies,
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; Harlow and Lane,
supra).
Standard techniques for characterizing ligand/receptor interactions are
available (see, e.g.,
Coligan, etal. (2001) Current Protocols in Immunology, Vol. 4, John Wiley,
Inc., New
York).
[00289] Monoclonal, polyclonal, and humanized antibodies can be prepared (see,
e.g.,
Sheperd and Dean (eds.) (2000) Monoclonal Antibodies, Oxford Univ. Press, New
York,
NY; Kontermann and Dubel (eds.) (2001) Antibody Engineering, Springer-Verlag,
New
York; Harlow and Lane (1988) Antibodies A Laboratory Manual, Cold Spring
Harbor
Laboratory Press, Cold Spring Harbor, NY, pp. 139-243; Carpenter, etal.
(2000)1 Immunol.
165:6205; He, etal. (1998)1 Immunol. 160:1029; Tang etal. (1999) J. Biol.
Chem.
274:27371-27378; Baca etal. (1997) 1 BioL Chem. 272:10678-10684; Chothia etal.
(1989)
Nature 342:877-883; Foote and Winter (1992)1 MoL BioL 224:487-499; U.S. Pat.
No.
6,329,511).
[00290] An alternative to humanization is to use human antibody libraries
displayed on
phage or human antibody libraries in transgenic mice (Vaughan et al. (1996)
Nature
Biotechnol. 14:309-314; Barbas (1995) Nature Medicine 1:837-839: Mendez etal.
(1997)
Nature Genetics 15:146-156; Hoogenboom and Chames (2000) Immunol. Today 21:371-
377;
Barbas etal. (2001) Phage Display: A Laboratory Manual, Cold Spring Harbor
Laboratory
Press, Cold Spring Harbor, New York; Kay et al. (1996) Phage Display o/
Peptides and
Proteins: A Laboratoiy Manual, Academic Press, San Diego, CA; de Bruin etal.
(1999)
Nature Biotechnol. 17:397-399).
[00291] Single chain antibodies and diabodies are described (see,
e.g., Malecki et al.
(2002) Proc. Natl. Acad. Sci. USA 99:213-218; Conrath etal. (2001)1 Biol.
Chem.
-107-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
276:7346-7350; Desmyter etal. (2001) 1 Biol. (Jhem. 276:26285-26290; Hudson
and Kortt
(1999) 5 Immunol. Methods 231:177-189; and U.S. Pat. No. 4,946,778).
Bifunctional
antibodies are provided (see, e.g., Mack, etal. (1995) Proc. Natl. Acad. Sci.
USA 92:7021-
7025; Carter (2001) 1 Immunol. Methods 248:7-15; Volkel, etal. (2001) Protein
Engineering 14:815-823; Segal, etal. (2001) 1 ImmunoL Methods 248:1-6;
Brennan, etal.
(1985) Science 229:81-83; Raso, etal. (1997) 1 Biol. Chem. 272:27623; Morrison
(1985)
Science 229:1202-1207; Traunecker, et al. (1991) FMB J. 10:3655-3659; and
U.S. Pat.
Nos. 5,932,448, 5,532,210, and 6,129,914).
[00292] Bispecific antibodies are also provided (see, e.g., Azzoni et al.
(1998) J. Immunol.
161:3493; Kita et al. (1999) / Immunol. 162:6901; Merchant etal. (2000) /
Biol. Chem.
74:9115; Pandey etal. (2000) 1 Biol. Chem. 275:38633; Zheng etal. (2001) 1
Biol Chem.
276:12999; Propst etal. (2000) 1 Immunol 165:2214; Long (1999) Ann. Rev.
Immunol.
17:875).
Purification of antigen is not necessary for the generation of antibodies.
Animals can be
immunized with cells bearing the antigen of interest. Splenocytes can then be
isolated from
the immunized animals, and the splenocytes can fused with a myeloma cell line
to produce a
hybridoma (sec, e.g., Mcyaard etal. (1997) Immunity 7:283-290; Wright etal.
(2000)
Immunity 13:233-242; Preston et al., supra; Kaithamana et al. (1999) /
Immunol. 163:5157-
5164).
[00293] Antibodies can be conjugated, e.g., to small drug molecules, enzymes,
liposomes,
polyethylene glycol (PEG). Antibodies are useful for therapeutic, diagnostic,
kit or other
purposes, and include antibodies coupled, e.g., to dyes, radioisotopes,
enzymes, or metals,
e.g., colloidal gold (see, e.g., Le Doussal etal. (1991) 1 Immunol. 146:169-
175; Gibellini et
al. (1998) 1 Immunol. 160:3891-3898; Hsing and Bishop (1999) / Immunol.
162:2804-
2811; Everts etal. (2002)1 Immunol. 168:883-889).
[00294] Methods for flow cytometry, including fluorescence activated cell
sorting
(FACS), are available (see, e.g., Owens, et al. (1994) Flow Cytometty
Principles for Clinical
Laboratory Practice, John Wiley and Sons, Hoboken, NJ; Givan (2001) Flow
Cytometry, 2nd
ed.; Wiley-Liss, Hoboken, NJ; Shapiro (2003) Practical Flow Cytometty, John
Wiley and
Sons, Hoboken, NJ). Fluorescent reagents suitable for modifying nucleic acids,
including
-108-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
nucleic acid primers and probes, polypeptides, and antibodies, for use, e.g.,
as diagnostic
reagents, are available (Molecular Probes (2003) Catalogue, Molecular Probes,
Inc., Eugene,
OR; Sigma-Aldrich (2003) Catalogue, St. Louis, MO).
[00295] Standard methods of histology of the immune system are described (see,
e.g.,
Muller-Harmelink (ed.) (1986) Human Thymus: Histopathology and Pathology,
Springer
Verlag, New York, NY; Hiatt, et al. (2000) Color Atlas of HistoloDc
Lippincott, Williams,
and Wilkins, Phila, PA; Louis, et al. (2002) Basic Histology: Text and Atlas,
McGraw-Hill,
New York, NY).
[00296] Software packages and databases for determining, e.g., antigenic
fragments,
leader sequences, protein folding, functional domains, glycosylation sites,
and sequence
alignments, are available (see, e.g., GenBank, Vector NTT Suite (Informax,
Inc, Bethesda,
MD); GCG Wisconsin Package (Accelrys, Inc., San Diego, CA); DeCyphere
(TimeLogic
Corp., Crystal Bay, Nevada); Menne, et al. (2000) Bioinformatics 16: 741-742;
Menne, et al.
(2000) Bioinformatics. Applications Note 16:741-742; Wren, etal. (2002)
Comput. Methods
Programs Biomed. 68:177-181; von Heijne (1983) Eur. I Biochem. 133:17-21; von
Heijne
(1986) Nucleic Acids Res. 14:4683-4690).
EXAMPLES
[00297] The following examples serve to illustrate the present invention.
These examples
are in no way intended to limit the scope of the invention.
[00298] Example 1: Reagents
[00299] The details of reagents and antibodies used for the following examples
are
provided in Table 1:
Antibody/reagents Dilutions/ Catalog Vendor
concentration number/clone
IL-2 6000 U/mL Proleukin Novartis
recombinant TGFI3 10 ng/mL 100-21C Peprotech
PHA 10 g/mL L1668-5MG Sigma
Aldrich
Recombinant E-cadherin 2 lig/mL 648-EC R&D systems
(1)
Recombinant E-cadherin 2 1.1g/mL 10204-H02H Sino
Biological
-109-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
(1)
CD103 (2G5.1) antibody 10-20 [ig/mL MCA708 Bio-rad
CD103 (Ber-ACT8) 10-201Ag/mL 550258 BD
antibody
CD103 (Ber-ACT8)-FITC 15 L, per test 561677 BD
antibody
CD3-PE antibody 2 p.L per test 12-0038-41/42
eBioscience
CD8a-APC-eFlour 780 2 1_, per test 47-0088-42
eBioscience
antibody
CD33 -PE-Cy7 antibody 2 ILL per test 25-0338-42
eBioscience
CD3 -PerCP-Cy 5. 5 2 ILL per test 45-0037-42 Thermo
Fisher
antibody Scientific
CD324 (E-Cadherin) - 1 hg/test 46-3249-82 eBioscience
PerCP-eFluor 710 antibody
Mouse IgG1 cIsotype 10-20 hg/mL 554721 BD
biosciences
Control
Human IgG, Fab fragment 10-201Ag/mL 009-000-007 Jackson
Immunoresearch
Zombie AquaTM Fixable 1:100 423102 BioLegend
(ITK
Viability kit
diagnostics)
Goat anti-mouse Ig-PE 1:50 1010-9 Southern
Biotech
F(ab')2 Fragment Goat 1:50 109-136-088 Jackson
Anti-Human IgG (H+L)-
Immunoresearch
APC
Murine CD3-FITC 2 1_, per test 11-0032-82
eBioscience
antibody
Murine CD8a-PE-Cy7 2 1_, per test 25-0081-82
eBioscience
antibody
Murine CD103-PE 2 pL per test 12-1031-82 eBioscience
antibody
[00300] Example 2: Primary material and cell lines
[00301] Chinese hamster ovary (CH0)-K1 cells and the human adenocarcinoma cell
line
MCF7 were obtained from the American Type Culture Collection (ATCC). Cells
were
quarantined until screening for microbial contamination and mycoplasma was
performed and
proven to be negative. CHO-Kl cells were grown in DME1VI/F12 (Gibco), 1%
PenStrep
(Gibco), 5% NCBS (Biowest) and incubated in a humidified atmosphere with 5%
CO2 at
37 C. MCF7 cells were grown in EMEM (ATCC), 1% PenStrep (Gibco), 10% FBS
(Gibco)
and incubated in a humidified atmosphere with 5% CO2 at 37 C. A CHO-
K1 .hCD103/hBeta7 cell line was generated by transfecting CHO-Kl cells with
pCI-neo and
-110-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
pcDNA3.1(+)-hygro vectors encoding the full length open reading frames of
human integrin
AlphaE (UniProt P38570) and human integrin Beta 7 (UniProt P26010),
respectively. Stable
clones were obtained by limiting dilution in CHO medium supplemented with
geneticin (50
ug/mL, Gibco) and hygromycin B (50 ug/mL, Invitrogen). CHO-Kl.hAlpha4/hBeta7
expressing cells were generated by transient transfection of CHO-Kl cells with
pCI-neo and
pcDNA3.1(+)-hygro vectors encoding the full length open reading frames of
human integrin
Alpha4 (UniProt P13612) and human integrin Beta 7, respectively. CHO-
Kl.rhCD103/rhBeta7 expressing cells were generated by transient transfection
of CHO-K1
cells with pCI-neo and pcDNA3.1(+)-hygro vectors encoding the full length open
reading
frames of rhesus integrin AlphaE (UniProt H9Z8N2) and rhesus integrin Beta 7
(NCBI
XP 015007317.1), respectively.
[00302] The human non-small cell lung cancer cell line A549 was obtained from
the
American Type Culture Collection (ATCC). Cells were quarantined until
screening for
microbial contamination and mycoplasma was performed and proven to be
negative. Cells
were grown in DMEM/F-12, GlutaMAXTm Supplement + 5% FCS +25 mM 1-1EPES for
CHO-Kl and RPMI + 10% FCS for A549, and incubated in a humidified atmosphere
with
5% CO2 at 37'C. The A549 cell line was subjected to knockout of CDH1 (E-
cadherin) by
nonliposomal transfection (Fugene) using a plasmid encoding guide RNAs, a
fully functional
CAS9 cassette and GFP (plasmid pSpCas9(BB)-2A-GFP (PX458) (Ran et al. Nature
Protocols 8:2281-2308 (2013)) (Addgene plasmid # 48138;
n2t.net/addgene:48138;RRID:Addgene 48138)). GFP-positive single-cell clones
were
isolated using a Moflo Astrios sorter (Beckman Coulter). Disruption was
confirmed by
Sanger sequencing with tracking of indels.
[00303] CD103 positive T cells were generated as follows. Human peripheral
blood
mononuclear cells (PBMC) were isolated via Ficoll-Paque density gradient
centrifugation
(Ficoll-Paque PLUS, GE Healthcare Life Sciences, Marlborough, MA, USA) of
buffy coats
from healthy volunteers after informed consent (Sanquin). Next, CD8 positive T
cells were
negatively selected using a MagniSortTM Human CD8 T cell Enrichment Kit
according to
standard protocol (Thermo Fisher Scientific). Subsequently, cells were
stimulated with 10
lag/mL PHA, 6000 U/mL IL-2 and 10 ng/mL recombinant TGFI3, and cultivated in
RPMI
-111 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
supplemented with 10% FCS and penicillin/streptomycin (100 U/mL). Cells were
cultured
for at least 10 days to obtain > 80% CD103 positive CD8 cells.
[00304] Fresh tumor material was obtained from ovarian cancer patients
undergoing
cytoreductive surgery. With a scalpel, tumor pieces of approximately 1 mm3
were cut, and
subjected to enzymatic digestion (RPMI supplemented with 1 mg/ml collagenase
type IV
(Life technologies), 31 U/ml rhDNase (Pulmozyme, Genentech, California, USA)
and 10%
FCS) for 30 minutes at 37 C or overnight at room temperature. Subsequently,
the digestion
medium containing remaining tumor pieces was filtered over a 70 pm cell
strainer (Corning,
Amsterdam, The Netherlands). For flow cytometric analyses, cells were
pelleted, washed,
and cryopreserved until further use.
[00305] Spleens from immunocompentent Balb/c and C57/BL6 mice, and the thymus
from Balb/c mice were harvested, followed by mincing of the tissue on a 70 p.m
strainer with
a plunger. Red blood cells were removed using Red Blood Cell Lysis Buffer
(Biolegend).
Cells were pelleted, washed, and cryopreserved until further use.
[00306] Example 3: Monoclonal antibody generation
[00307] To generate human CD103 antibodies, mice were immunized with the cDNA
plasmid constructs encoding full length open reading frames of human CD103
(integrin
alpha-E) and human integrin beta-7. The pCI-neo and pcDNA3.1(+) were custom-
based
synthesized and obtained from GeneArt/ThermoFisher (Regensburg, Germany). Mice
were
immunized by gene gun immunization using a Helios Gene gun (BioRad, Hercules,
CA,
USA) and DNA coated gold bullets (BioRad) following manufacturer's
instructions at
Envigo (Horst, The Netherlands). Briefly, 1 i.tm gold particles were coated
with pCI-neo-
hCD103 and pcDNA3.1(+)-hBeta7 cDNA and commercial expression vectors for mouse
Flt3L and mouse GM-CSF (both from Aldevron) in a 1:1:1:1 ratio. A total of 50
tig of
plasmid DNA was used to coat 25 mg of gold particles. Specifically, 7-8 weeks
old female
BALB/C mice (Harlan) were immunized in the ears with a gene gun, receiving 3
administration cycles in both ears.
[00308] Antibody titer was assessed by cell ELISA ("CELISA"), using a CHO-
K1 .hCD103/hBeta7 stable cell line. Cells were seeded into 96-well flat-bottom
tissue culture
plates at 8x 104 cells/well and cultured at 37 Celsius, 5% CO2 and 95%
humidity until cell
-112-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
layers were confluent. Cells were incubated with each sample of the diluted
mouse sera for I
hour at 37 C., 5% CO2 and 95% humidity. Next, cells were washed with phosphate
buffered
saline (PBS)/0.05% Tween-20 (PBS-T) and incubated with goat-anti-mouse IgG-HRP
conjugate (Southern Biotech) for I hour at 37 C., 5% CO2 and 95% humidity.
Subsequently,
cells were washed three times with PBS-T and anti-hCD103/hBeta7
immunoreactivity was
visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped
with 0.5 M
H2504 and absorbances were read at 450 and 610 nm. The anti-hCD103/hBeta7
titer was
higher than 1:2500 in each individual mouse serum sample as detected after two
DNA
immunizations. All mice were immunized for a final, third time and sacrificed
4 days later.
Erythrocyte-depleted spleen and lymph-node cell populations were prepared
according to
published protocols.
[00309] To select anti-hCD103 antibody producing B-cells, a selection strategy
was
designed and developed that preferentially bound B-cells expressing antibodies
that bind
specifically to hCD103, preferably with cross-reactivity to monkey CD103. As
cynomolgus
CD103 sequences were not known, cross-reactivity studies were performed using
rhesus
CD103. Splenocytes and lymphocytes from the hCD103/hBeta7 immunized mice were
incubated with hCD103 negative MCF-7 that were seeded into T25 culture flasks
and
irradiated at 30 Gray. After 1 hour unbound cells were gently removed by
moving the flask
back and forth. Medium containing unbound cells was then transferred to a new
T25 flask
containing irradiated CHO-Kl.hAlpha4/hBeta7 cells (transient transfection).
This procedure
was repeated one more time on ice in order to negatively select hBeta7-
reactive B-cells.
Next, medium containing unbound B-cells was incubated with CHO-
Kl.hCD103/hBeta7
cells that were irradiated with 30 Gy. After 1.5 hours incubation on ice
unbound cells were
removed with multiple wash steps using culture medium. Subsequently, T25
flasks
containing CHO-K1.hCD103/hBeta7 cells with bound lymphocytes were harvested
with
Trypsin-EDTA (Sigma). Selected B-cells were mixed with 10% (v/v) T-cell
supernatant and
50,000 irradiated (25 Gy) EL-4 B5 feeder cells in a final volume of 200 [11
medium in 96-
well flat-bottom tissue culture plates. On day four, cell culture medium was
refreshed. On
day eight, supernatants were screened for hCD103/hBeta7 reactivity by cell
ELISA as
described below. CHO-Kl.hCD103/hBeta7, CHO.K1.rhCD103/rhBeta7 (transient
transfection) and CHO-Kl.hAlpha4/hBeta7 (transient transfection) were seeded
in culture
-113 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
medium (DMEM-F12 (Gibco) supplemented with 10% Fetal Bovine Serum (Hyclone)
and
80 U Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and
cultured at 37 C.,
5% CO2 and 95% humidity until they were confluent. Subsequently, culture
medium was
removed and cells were incubated for 1 hour at 37 C, 5% CO2 and 95% humidity
with
supernatants from the B-cell cultures. Next, cells were washed with PBS-T and
incubated for
1 hour at 37 C., 5% CO2 and 95% humidity with goat-anti-mouse IgG-HRP
conjugate
(Southern Biotech). Subsequently, cells were washed three times with PBS-T and
anti-
hCD103/hBeta7, and anti-hAlpha4/hBeta7 immunoreactivity was visualized with
TMB
Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H250.4
and
absorbances were read at 450 and 610 nm.
[00310] B-cell clones from the hCD103/hBeta7 reactive supernatants, which were
not or
which were minimally reactive to hAlpha4/hBeta7 were immortalized by mini-
electrofusion
following a published procedure (Steenbakkers et al. (1992)MoL Biol. Rep. 19:
125) with
some minor deviations. Briefly, B-cells were mixed with 106 Sp2/0-Ag14 murine
myeloma
cells (ATCC CRL-1581) in Electrofusion Isomolar Buffer (Eppendorf).
Electrofusions were
performed in a 50 nf, fusion chamber by an alternating electric field of 15 s,
1 MHz, 23 Vrms
AC followed by a square, high field DC pulse of 10 as, 180 Volt DC and again
by an
alternating electric field of 15 s, 1 MHz, 23 Vrms AC. Content of the chamber
was
transferred to hybridoma selective medium and plated in a 96-well plate under
limiting
dilution conditions. On day 8 following the electrofusion, hybridoma
supernatants were
screened for hCD103/hBeta7, rhCD103/rhBeta7, and hAlpha4/hBeta7 binding
activity by
cell ELISA as described above. Hybridomas that secreted antibodies in the
supernatant that
specifically bound CD103 were frozen at -180 C. ( -1 batch) and subcloned by
limited
dilution to safeguard their integrity and stability. Stable hybridomas were
frozen at -180 C. (-
LD1 batch) until cell layers were confluent.
[00311] Selected stable hybridomas were cultured in serum-free media for 7
days;
supernatants were harvested and antibodies were purified using MabSelect Sure
Protein A
resin according to the manufacturer's instructions (GE Healthcare). Antibody
concentrations
were quantified using spectrophotometry. Antibody monomericity was assessed by
SEC-
HPLC. Supernatants of the hybridoma cultures were used to isotype the
hybridomas. In short,
isotyping was done using a mouse monoclonal antibody isotyping kit (Biorad)
based on a
-114-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
dipstick with immobilized goat-anti-mouse antibody bands to each of the common
mouse
isotypes and light chains. Recovered antibodies were all identified as mouse
IgGl. Antibody
sequences were elucidated by sequencing of variable regions of the mouse IgG 1
hybridoma
material performed at LakePharma (CA, USA), using the following method: the
total RNA
of the hybridoma cells was extracted, which allowed cDNA synthesis. Rapid
Amplification
of cDNA Ends (RACE) was performed that allowed cloning of positive fragments
in a TOPO
(Thermo Fisher Scientific) vector. TOPO clones were sequenced and sequences
were
annotated using VBASE2.
[00312] The mAb discovery campaign yielded 6 different mAb candidates that
showed
specific binding to the human CD103 (integrin alpha-E) domain of the integrin
heterodimer
hCD103/hBeta7. The 6 selected candidates were produced from hybridoma and
purified.
Figure 1 presents the cell binding data of the purified anti-hCD103 mAbs to
CHO.K1-
hCD103/hBeta7, CHO.K1-rhCD103/rhBeta7, and CHO.K1-hAlpha4/hBeta7. Expression
of
the integrin heterodimers by the transfected CHO-Kl cell lines was confirmed
by
commercial mAbs against integrin human CD103, integrin human Alpha-4, and
integrin
human Beta-7. Selected hybridomaswere sequenced and a phylogenetic tree was
built using
Discovery Studio (Figure 2), showing that all VH and VL sequences are unique
with
different degrees of similarity. As shown, the antibodies exhibit binding to
hCD103, but no
binding to hBeta7. Binding to rhesusCD103/rhBeta7 is different for the various
candidates
[00313] Example 4: Generation of anti-hCD103 Fab fragments
[00314] Anti-hCD103 Fab candidates were produced by ImmunoPrecise (Oss, the
Netherlands). Synthetic vectors encoding for the DNA sequences of the VII and
VL domains
of candidates hCD103.01A, hCD103.05A, and hCD103.06A were synthesized and
subsequently cloned into ImmunoPrecise's human IgGl-Fab-K vector and human
kappa light
chain vector, respectively, followed by transfection of FIEK293 cells. Fab
fragments from
harvested supernatants were purified by endotoxin-free purification using
CaptureSelect IgG-
CH1 affinity matrix. Fab concentrations were quantified using
Spectrophotometry and Fab
purity was assessed by SDS-PAGE and HP-SEC. Endotoxin levels were determined
by LAL
assay.
[00315] Example 5: Fluorescent labelling of mAbs and Fabs
-115-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00316] Fabs and mAbs were conjugated with a 6x molar excess of Alexa Fluor
647-NETS
(Thermo Scientific). In short, mAbs / Fabs were rebuffered to 0.2M sodium
bicarbonate pH
8.3 using Zeba 7K MWCO spin columns. A 6-fold molar excess of Alexa Fluor 647-
NHS
(from a 10mg/mL stock in DMSO) was added. The reaction was allowed for lh in
the dark at
room temperature. Non-reacted Alexa Fluor-NHS was removed using Zeba 7K MWCO
spin
columns. Antibody and AF647 concentrations were measured using
spectrophotometry at
280 nm and 650 nm, respectively. The amount of residual non-reacted AF647 was
determined by HP-SEC using a dual detector system (280 nm and 650 nm).
Labeling yields
of +/- 4 dyes per mAb and +/- 2-3 dyes per Fab were observed.
[00317] Example 6: Immunoreactivity to CHO cells expressing human CD103/Beta7
[00318] Non-labeled mAbs and Fabs were analysed for cellular binding to CHO.K1-
hCD103/hBeta7 by CELTS A as described earlier. Next, cellular binding
experiments were
also performed using flow cytrometry to determine the binding profiles of the
AF647 labeled
mAbs/Fabs on CHO.K1-hCD103/hBeta7 and CHO.K1. 1 x 105 detached cells were
incubated with mAb / Fab at 4 C for 30 min. After washing, the cells were
resuspended in
1% BSA/DPBS/1xDAPI and analysed on the FACS-Cantoll (BD Biosciences).
[00319] Figure 3 presents the binding data of the various non-labeled
mAbs/Fabs in cell
ELISA. Potent binding of hCD103.01 mAb/Fab and hCD103.05 mAb to both
CHO.K1.hCD103/beta7 and recombinant hCD103/beta7, somewhat reduced binding of
hCD103.05 Fab to both CHO.Kl.hCD103/beta7 and recombinant hCD103/beta7 and
weak/minimal binding of hCD103.06 mAb/Fab to recombinant hCD103/beta7 (Acro
Biosystems), while strong binding of hCD103.06 mAb to CHO.K1.hCD103/hBeta7
[00320] Figure 4 presents the binding data of the various AF647-labeled
mAbs/Fabs in
flow cytometry. No dose dependent binding of the mAb and Fab reagents was
observed on
non-transfected CHO.K1 (data not shown).
[00321] Example 7: Immunoreactivity to recombinant human CD103/Beta7
[00322] Immunoreactivity to human CD103/Beta7 was assessed by ELISA using
recombinant hCD103/hBeta7 Fc-protein (Acro-Biosystems) coated 96-well MaxiSorp
flat-
bottom plates. Protein coated 96-well plates were blocked in protein-free
blocking buffer
-116-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
(Pierce) for 1.5 hour at 37 oC. Plates were washed and incubated for 1 hour at
RT with
mAb/Fab in 0.1% Tween-20 in PBS. Next, plates were washed with PBS-T and
incubated for
1 hour at RT with goat-anti-mouse IgG-HRP conjugate (Southern Biotech) for
mAbs, and
goat-anti-human Fab-HRP conjugate (Jackson Immuno Research) for the Fab
fragments in
0.1% Tween-20 in PBS. Subsequently, wells were washed three times with PBS-T
and anti-
hCD103 immunoreactivity was visualized with TMB Stabilized Chromogen
(Invitrogen).
Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and
610 nm.
[00323] Example 8: Flow cytometry analysis
[00324] For binding assays of anti-CD103 mAbs and Fab fragments in tumor
digests,
samples were divided in multiple aliquots and stained using either a live/dead
marker and
commercial antibodies against human CD3, CD8a, CD33 and CD103, or commercial
antibodies against CD3, CD8a, CD33 and our anti-CD103 mAbs or Fabs with
secondary
detection reagent. For binding assays of anti-CD103 with murine CD103 positive
T cells
spleen and thymus single cells suspensions were divided in multiple aliquots
and stained
using either a live/dead marker and commercial antibodies against murine CD8
and CD103.
Additional aliquots were stained with relevant isotype controls or as
fluorescence minus one
controls ("FMO" controls arc cells stained with all the fluorophorcs minus one
fluorophorc;
the relevant isotype controls contain either a directly labeled unspecific
isotype antibody or
an unspecific isotype antibody combined with secondary detection reagent).
Percentage
binding of fluorescently labeled mAbs was determined using flow cytometry.
Maximum
binding was set at 100%. Measurement was performed on a BD FACSVerse (BD
Biosciences). Data analysis was performed with FlowJo v10 (Tree Star) and
surface receptor
levels were expressed as mean fluorescent intensity (MFI).
[00325] Using ex vivo human tumor digests, the anti-CD103 mAbs were assessed
against
a benchmark commercial anti-CD103 mAb (BD bioscience) routinely used in flow
cytometry, gating on CD3+ CD8+ T cells. The anti-CD103 mAbs readily identified
the
CD103+ CD8+ T cell subpopulation at frequencies identical to that observed for
the
commercial anti-CD103 mAb (Figure 5). No binding to CD4+ T cells or CD33+
(myeloid)
cells was detected in these digests. mAb binding to the CD103+ CD8+ T cell
subpopulation
in ten independent patients was highest for clone 01A, whereas clone 03A
showed the lowest
-117-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
binding (Figure 6). Additionally, recombinant Fab fragments from antibody
clone 01A, 05A
and 06A. showed respectively the strongest binding to the CD103+ CD8+ T cell
subpopulation for Fab.hCD103.01.C1, whereas Fab.hCD103.06.C1 showed the lowest
binding in human tumor digests (Figure 7), in line with the mAb binding data.
[00326] To assess differences in affinity and competition between the mAbs,
CD103+
CD8+ T cells were pre-incubated with our anti-CD103 mAbs or the commercial
anti-CD103
mAbs in FACS medium for 1 hour at 4 C and subsequently incubated with their
fluorescently labeled counterparts for 1 hour at 4 C. Percentage binding of
fluorescently
labeled mAbs was determined using flow cytometry. Maximum binding was set at
100%
[00327] Flow cytometry was used to determine whether the CD103 mAb clones
cross-
react with murine CD103+ T cells. Mouse spleen and thymus were examined for
expression
of CD103 using a commercial anti-mouse CD103 mAb. Approximately half of the
CD8 cells
were positive for CD103. However, the anti-human CD103 mAb clones showed no
specific
binding to murine CD103 (data not shown). Competition assays revealed that
binding of
most of the mAbs in our panel, except clone 03A and 06A, inhibited binding of
the
commercial CD103 mAb and vice-versa, indicating binding to the same region on
CD103
(Figure 8). Nevertheless, differences in binding characteristics were
observed. Clone 01A
and 02A blocked binding of most other mAb clones in a competition assay,
whereas clone
03A, 05A, 06A and 07A did not, suggesting distinct binding epitopes.
Additionally,
fluorescently labeled 05A, 06A and 07A showed binding after saturation with
the same
clone, indicating lower binding affinities.
[00328] Internalization and dissociation of anti-CD103 mAbs and Fab fragments,
and
membranous turnover of CD103 were determined using a previously described
protocol.
Briefly, CHO.K1-hCD103/hBeta7 cells or CD103 positive T cells were stained on
ice with
the anti-CD103 mAbs and Fab fragments (20 p.g/mL final concentration). After
staining; 1)
cells were washed with ice-cold FACS buffer and incubated with secondary
antibody diluted
1:50 in FACS medium for 1 hour at 4 C to measure surface expression. 2) Cells
were washed
with ice-cold FACS buffer, incubated in culture medium at 37 C for 4 hours
and
subsequently incubated with secondary antibody for 1 hour at 4 C to measure
non-
internalized CD103-antibody complexes since the secondary antibodies only bind
to surface
-118-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
bound CD103 mAbs or Fab fragments. 3) Cells were washed with ice-cold FACS
buffer,
incubated in culture medium at 37 C for 4 hours and subsequently re-incubated
with the
CD103 mAbs or Fab fragments, followed by secondary antibody to measure non-
internalized, reappeared receptors and possible de novo synthesis of
receptors. Duplicate
samples were measured for each treatment condition, and corrected for
background
fluorescence and unspecific binding of the secondary antibody. Measurement was
performed
on a BD FACSVerse or BD Accuri C6 (BD Biosciences). Data analysis was
performed with
FlowJo v10 (Tree Star) and surface receptor expression was expressed as mean
fluorescent
intensity (MFI). Four hours incubation at 37 C resulted in different amounts
of remaining
mAbs and Fab fragments bound at the cell surface. A decrease could indicate
internalized
mAb and Fab fragments. However, performing the same experiment using directly
labeled
mAbs and Fab fragments showed that the decrease in remaining mAb or Fab
fragment at the
cells surface was due to dissociation. Of note, CD103 surface expression
levels were only
marginally changed by the incubation with mAbs or Fab fragments (data not
shown)
[00329] Example 9: CD103+ T Cell adhesion assays
[00330] CD103+ T cell adhesion assays were performed as follows. One day
before the
experiment, 96 wells plates were coated overnight at 4 C with 100 p..L
recombinant E-
cadherin at 2 lag/mL in Dulbecco's PBS (DPBS) containing 1 mM Ca2 and Mg2 .
Next,
wells were blocked for at least 1 hour using 1% bovine serum albumin (BSA) in
DPBS.
CD103+ T cells were labeled with CFSE (Thermo Fisher Scientific) as described
earlier (3)
and resuspended in RPMI + 10% FCS + 1 mM Mn2 . CFSE labeled cells were either
preincubated with 10 iig/mL antibody or Fab fragments for 30 minutes on ice
followed by
incubation in E-cadherin coated wells (50,000 cells/well) for 30 minutes at 37
C or cells
were directly transferred to E-cadherin coated wells for 30 minutes at 37 C
followed by 10
gg/mL antibody or Fab fragment treatment for 30 minutes at 37 C.
[00331] For adhesion assays using A549 wild-type and E-cadherin knock-out
cells, one
day before the experiment, tumor cells (30,000 cells/well) were seeded in 96
wells plates.
Next, CFSE labeled CD103+ T cells were preincubated with 10 i.ig/mL antibody
for 30
minutes on ice followed by incubation in tumor cell seeded wells for 60
minutes at 37 C.
-119-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00332] After incubation, unbound cells were removed by inverting the plate
and washing
with DPBS. Finally, cells were fixed using 3.7% formalin in DPBS. Images were
captured
using a conventional fluorescent microscope (InvitrogenTM EVOSTM FL Imaging
System).
Bound T cells were quantified using Image J software analysis (1.50v).
[00333] As shown in Figure 9, CD103 mAb clone 01A, 02A, 03A and 07A showed the
strongest inhibition of T cell binding, whereas 06A partially inhibited the
binding to E-
cadherin. Clone 05A was the only clone that did not interfere with CD103-
mediated T cell
adhesion. Similar effects were observed for Fab.hCD103.01.C1,
Fab.hCD103.05.C1, and
Fab.hCD103.06.C1 (data not shown). CRISPR-knockout of CDH1 (E-cadherin) in
A549
tumor cells resulted in reduced CD103+ T cell adhesion, however no clear
effects of our
CD103 mAbs were observed in E-cadherin wild-type and E-cadherin-knockout
cells.
[00334] Example 10: Cell based ELISA
[00335] One day before the procedure, CD103/137 transfected CHO cells (30,000
cells/well) were seeded in 96 wells plates. Subsequently, serial dilutions of
CD103 mAbs,
Fab fragments and isotype controls were added to each well of a 96-well plate
and incubated
for 1 h at 37 C. Wells were washed with PBS and incubated with Rabbit anti-
Mouse/IgG-
HRP (1:4000, Dako) or Fab specific Goat anti-Human/IgG-HRP (1:4000; Sigma
Aldrich) for
1 h at 37 C. Next, wells were washed with PBS and TMB substrate (KPL) was
added. The
color reaction was stopped by adding 1M HC1 solution and the absorbance was
measured by
a microplate reader (Thermo Scientific).
[00336] Example 11: 89Zr-hCD103.01A, 89Zr-hCD103.05A, 89Zr-Fab.hCD103.01.C1
and
89Zr-hCD103.05.C1 tracer development and quality control
[00337] hCD103.01A, hCD103.05A,Fab. hCD103. 01. Cl and Fab. hCD103. 05. CI
were
incubated with a 3 or 4-fold molar excess of TFP-N-Suc-desferal-Fe (Df, ABX
GmbH,
Hamburg, Germany) and subsequent 89Zr-labeling was performed using clinical
grade 89Zr
(Perkin Elmer, Groningen, The Netherlands). Maximal attainable specific
activity was
determined using varying amounts of 89Zr per mg antibody or Fab fragment
ranging between
250 and 1000 MBq/mg. Radiochemical purity (RCP) was assessed by
trichloroacetic acid
(TCA) precipitation test. Radiochemical purity for 89Zr-Fab.hCD103.01.C1 and
Fab.hCD103.05.C1 was >96% for three 89Zr levels tested (250, 500, and 750 MBq
89Zr). Df-
-120-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
mAb and -Fab conjugates were checked for aggregation and fragmentation by size
exclusion
ultra-performance liquid chromatography (SE-UPLC). The Waters SE-UPLC system
was
equipped with a dual wavelength absorbance detector, in-line radioactivity
detector and TSK-
GEL G3000SWXL column (JSB, Eindhoven, The Netherlands).
[00338] CD103 binding affinity of the two Df-conjugated CD103 mAbs and Fab
fragments was similar to their unmodified counterparts (Figure 10). In
addition, both the Df-
conjugated mAbs and the Fab fragments achieved a specific activity of 5001VIBq
89Zr/mg at
a radiochemical purity of >95%, without further purification (Figure 11). As
such, these
tracers are suitable for PET imaging with amounts as low as 10 jig (PET
imaging) or even
less when used in biodistribution studies. In vitro, hCD103.01A and hCD103.05A
showed
specific binding to a CD103 transfected CHO-Kl model cell line (CHO.K1-
hCD103/hBeta7), but not to CHO-Kl wild type cells (CHO.WT) (Figure 12).
[00339] Example 12: Animal studies
[00340] Figure 13A depicts an exemplary PET imaging protocol for 89Zr-
hCD103.01A
and 89Zr-hCD103.05A. Male nude mice (BALB/cOlaHsd-Foxnlnu, Envigo, The
Netherlands) were subcutaneously (sc) inoculated with CHO.K1 or CHO.CD103
(5x106 in
300 [IL 1:1 PBS and high growth factor Matrigel (BD Biosciences, Breda, The
Netherlands)). Xenografts were allowed to grow to at least 200 mm3. For
microPET imaging
with mAbs, xenograft-bearing mice (n = 3 per group) were injected
intravenously (iv) via
the penile vein with 8.7 0.48 jig 89Zr-CD103.01A or 8.76 0.42 jig 89Zr-
CD103.05A.
MicroPET scans were made 1, 3 and 6 days post injection (pi) using a Focus 220
PET
scanner (CTI Siemens), followed by ex vivo biodistribution analysis after the
final scan. For
biodistribution experiments with Fab fragments, xenograft-bearing mice (n = 2
or 3 per
group) were injected intravenously (iv) via the penile vein with ¨10 jig 89Zr-
Fab.hCD103.01.C1 or 89Zr-Fab.hCD103.05.C1 followed by ex vivo biodistribution
analysis
after 24 hours.
[00341] Scans were reconstructed and in vivo quantification was performed
using AMIDE
(v1Ø4, Stanford University, Stanford, CA, USA). MicroPET data are presented
as mean
standardized uptake value (SUVmean). Region of interests (ROT) were drawn for
tumor
based upon ex vivo weight, assuming 1 g/ml tissue density. For blood pool
measurements, a
-121 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
fixed-sized sphere was drawn in the center of the heart, for liver and spleen
a fixed-sized
ellipsoid ROT was drawn in representative parts of the organs. After the final
scan, mice were
sacrificed and organs of interest collected for biodistribution studies.
Organs and standards of
the injected tracer were counted in a calibrated well type LKB-1282-Compu-
gamma system
(LKB WALLAC) and weighed. After decay correction, ex vivo tissue activity was
expressed
as the percentage of injected dose per gram tissue (%ID/g).
[00342] CD103 membrane expression in CHO.K1-hCD103/hBeta7 is comparable to
CD103 expression in TILs (data not shown). PET scans of CHO.K1-hCD103/hBeta7
tumor
bearing mice showed that 89Zr-hCD103.01A and 89Zr-hCD103.05A tumor uptake
increased
over time (Figure 13B), with highest tumor and least background organ uptake
observed at
day 6 post injection (median mean standardized uptake value (SUVraean) tumor:
2.7, median
SUVinean blood: 0.9 for 89Zr-hCD103.01A and median ST Tv¨ Dann tumor: 3.0,
median ST Tv¨ man
blood: 0.9 for 89Zr-hCD103.05A; Figure 13 C, D and E). 89Zr-hCD103.01A showed
no
accumulation in CHO.K1 WT xenografts (SUVmean tumor: 1.5, SUVmean blood: 1.4),
which was used as a non-specific control group. Similarly, ex vivo
biodistribution analysis on
day 6 showed high CD103 specific 89Zr-hCD103.01A and 89Zr-hCD103.05A tumor
uptake
(17.0 and 32.8 percentage of injected dose per gram tissue (%ID/g),
respectively, for
CHO.K1-hCD103/hBeta7 vs. 7.8 %ID/g for CHO.K1 WT) and no major sink organs
(Figure
14). For the Fab fragments, ex vivo biodistribution analysis after 24 hours
post injection
showed CD103 specific 89Zr-Fab.hCD103.01.C1 and 89Zr-Fab.hCD103.05.C1 tumor
uptake
(2.44 and 1.27 %ID/g, respectively, for CHO.K1-hCD103/hBeta7 vs. 0.64 %ID/g
for
CHO.K1 WT) (Figure 15).
[00343] Example 13: Use of a CD103 targeting radiopharmaceutical to monitor
treatment
[00344] Prior to initiation of (immuno)therapy, a 'CD103 PET' scan is
performed, alone or
combined with a low-dose CT scan. Uptake of the CD103 radiopharmaceutical is
quantified.
CD103 PET-CT scans may be repeated and quantified at intervals during
(immuno)therapy.
Baseline uptake, on-treatment uptake, or treatment-induced changes in uptake
from baseline
are used to guide clinical decision making. This may include, but is not
limited to,
continuation of therapy, cessation of therapy or dose-adjustments.
-122-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00345] Example 14: Sequences
SEQ
Description SEQUENCE
ID NO:
hCD103.01A heavy 1 GDSITSGY
chain CDR1 (amino
acid sequence)
hCD103.01A heavy 2 ITYSGST
chain CDR2 (amino
acid sequence)
hCD103.01 A heavy 3 'TRHYYGSDAMDY
chain CDR3 (amino
acid sequence)
hCD103.01A light 4 QDVSIA
chain CDR1 (amino
acid sequence)
hCD103.01A light 5 SAS
chain CDR2 (amino
acid sequence)
hCD103.01A light 6 QQHYSTPWT
chain CDR3 (amino
acid sequence)
hCD103.01A heavy 7 EVQLQESGPSLVKPSQTLSLTCSVTGDSITSGYVVN
chain (amino acid WIRKFPGNKLEYMGYITYSGSTYYNPSLKSRISITR
sequence) DTSKNQYYLQLNSVTTEDTATYYCTRHYYGSDA
MDYVVGQGTSV'TVSS
hCD103.01A light 8 DIVIVITQSLIKFMSTSVGDRVSITCKASQDVSIAVAW
chain (amino acid YQQRPGQSPKLLIYS ASYRYTGVPDRF TGSGSGTD
sequence) FTFTISSVQAEDLAVYYCQQHYSTPWTFGGGTKLE
IK
hCD103.02A heavy 9 GDSITSGY
chain CDR1 (amino
acid sequence)
hCD103.02A heavy 10 ITYSGST
chain CDR2 (amino
acid sequence)
hCD103.02A heavy 11 ARGYYGSDAIVIDY
chain CDR3 (amino
acid sequence)
hCD103.02A light 12 QDVSTA
chain CDR1 (amino
acid sequence)
hCD103.02A light 13 SAS
chain CDR2 (amino
acid sequence)
-123 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
SEQ
Description ID NO: SEQUENCE
hCD103.02A light 14 QQHYSPPWT
chain CDR3 (amino
acid sequence)
hCD103.02A heavy 15 EVQLQESGPSLVKF'SQTLSLTCSVTGDSITSGYWN
chain (amino acid WIRKFPGNKLEYMGYITYSGSTYYNPSLKSRISITR
sequence) DTSKNQYYLQFNSVTTEDTATYYCARGYYGSDA
MDYWGQGTSVTVSS
hCD103.02A light 16 DIVIVITQSHKEMSTSVGDRVSITCKASQDVSTAVA
chain (amino acid WYQQKPGQSPKWYSASYRYTGVPDRFTGSGSGT
sequence) DFTFTISSVQAEDLAVYYCQQHYSPPWTFGGGTKL
EIK
hCD103.05A heavy 17 GYSFTGYN
chain CDR1 (amino
acid sequence)
hCD103.05A heavy 18 IDPYYGGT
chain CDR2 (amino
acid sequence)
hCD103.05A heavy 19 ARSFYGYDAGSPYNYAMDY
chain CDR3 (amino
acid sequence)
hCD103.05A light 20 QDVGTF
chain CDR1 (amino
acid sequence)
hCD103.05A light 21 WAS
chain CDR2 (amino
acid sequence)
hCD103.05A light 22 HQYSSYPYT
chain CDR3 (amino
acid sequence)
hCD103.05A heavy 23 EVQLQQSGPELEKPGASAKISCKASGYSFTGYNMN
chain (amino acid WVKQSNGKSLEWIGNIDPYYGGTSYNQKFKGKAT
sequence) LTVDKSSSTAYMQLKSLTSEDSAVYYCARSFYGY
DAGSPYNYAMDYWGQGTPVTVSP
hCD103.05A light 24 DIVIVITQSHKEMSTSVGDRVSITCKASQDVGTFVA
chain (amino acid WYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSG
sequence) TDFTLTISNVQSEDLADYFCHQYSSYPYTFGGGTQ
LEIK
hCD103.06A heavy 25 GYTFTSYVV
chain CDR1 (amino
acid sequence)
hCD103.06A heavy 26 IYPGSGST
chain CDR2 (amino
acid sequence)
hCD103.06A heavy 27 TRGVYDNPYYFDY
-124-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
SEQ
Description ID NO: SEQUENCE
chain CDR3 (amino
acid sequence)
hCD103.06A light 28 DHINNW
chain CDR1 (amino
acid sequence)
hCD103.06A light 29 GAT
chain CDR2 (amino
acid sequence)
hCD103.06A light 30 QQYWSIPLT
chain CDR3 (amino
acid sequence)
hCD103.06A heavy 31 QVQLQQPGSELVRPGASVKLSCKASGYTFTSYWM
chain (amino acid HWVKQRHGQGLEWIGNIYPGSGSTNYDEKFKSKG
sequence) TLTVDTSSSTAYMHLSSLTSEDSAVYYCTRGVYDN
PYYFDYWGQGTTLTVSS
hCD103.06A light 32 DIQMTQSSSNLSVSLGGRVTITCKASDHINNWLAW
chain (amino acid YQQKPGNAPRVLISGATSLETGVPSRFSGSGSGKD
sequence) YTLSITSLQTEDVATYYCQQYWSIPLTFGAGTKLE
LK
hCD103.07A heavy 33 GDSITSGY
chain CDR1 (amino
acid sequence)
hCD103.07A heavy 34 ITYSGST
chain CDR2 (amino
acid sequence)
hCD103.07A heavy 35 ARNYYGSSS1VIDY
chain CDR3 (amino
acid sequence)
hCD103.07A light 36 QNVGSD
chain CDR1 (amino
acid sequence)
hCD103.07A light 37 SAS
chain CDR2 (amino
acid sequence)
hCD103.07A light 38 QQYNSYPST
chain CDR3 (amino
acid sequence)
hCD103.07A heavy 39 EVQLQESGPSLVKPSQTLSLTCSVTGDSITSGYWN
chain (amino acid WIRKFPGNKLEYMGYITYSGSTYYNPSLKSRISITR
sequence) DTSKNQYYLQLNSVTTEDTATYYCARNYYGSSSM
DYWGQGTSVTVSS
hCD103.07A light 40 DIVMTQSQKFMSTSVADRVSVTCKASQNVGSDVA
chain (amino acid WYQQKPGQSPKSLIY SAS YRY SGVPDRFIGSGSGT
sequence) DFTLTISNVQSEDLAEYFCQQYNSYPSTFGGGTKL
-125-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
SEQ
Description ID NO: SEQUENCE
EIK
human integrin 41
MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGA
Alpha-E (amino acid
PFVLS SLLHQDP S TNQTWLLVTSPRTKRTPGPLIIR
sequence)
CSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGV
LICIQVLVRRPHSLS SELTGTCSLLGPDLRPQAQAN
FFDLENLLDPDARVD TGD CY SNKEGGGEDDVNTA
RQRRALEKEEEEDKEEEEDEEEEEAGTEIMILDGS
GSIDPPDFQRAKDFISNMMRNEYEKCFECNFALVQ
YGGVIQ'TEFDLRDSQDVMASLARVQNITQVGSVT
KTASAMQHVLDSIFTS SHGSRRKASKV1VIVVLTD G
GIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSAR
TARELNLIASDPDETHAFKVTNYMALDGLLSKLRY
NII S ME GTVGD ALHYQ LAQ IGF SAQILDERQVLLG
AVGAFDWS GGALLYDTRSRRGRFLNQTAAAAAD
AEAAQYSYLGYAVAVLHKTC SL S YIAGAPRYKHH
GAVFELQKEGREASFLPVLEGEQMGSYF GS ELCPV
DIDMD GS TDFLLVAAPFYHVHGEE GRVYVYRL SE
QDGSF SLARILSGHPGFTNARF GFAMAAMGDL SQ
DKLTDVAIGAPLEGFGADDGASFGSVYIYNGHWD
GLS A SPS QRIRAS TVAPGLQYF GMSMAGGFDISGD
GLADITVGTLGQAVVFRSRPVVRLKVSMAFTPSAL
PIGFNGVVNVRLCFEIS SVT T A SESGLREALLNF'TL
DVDVGKQRRRLQCSDVRSCLGCLREWS S GS QL CE
DLLLMPTEGELCEEDCF SNASVKVSYQLQTPEGQ T
DHPQPILDRY'lEPFAIFQLPYEKACKNKLFCVAELQ
LAT TV S Q QELVVGL TKELTLNINL TN S GED S YlVIT S
MALNYPRNLQLKRMQKPP SPNIQCDDPQPVASVLI
MNCRIGHPVLKRS SAHVSVVVVQLEENAFPNRTAD
ITVTVTN SNERRS LANE THTLQFRHGFVAVLSKP SI
MYVNTGQGLSHHKEFLFHVHGENLFGAEYQLQIC
VP TKLRGL QVVAVKKLTRTQ A S TVC TW S QERAC A
YSSVQHVEEWHSVSCVIASDKENVTVAAEISWDH
SEELLKDVTELQILGEISFNKSLYEGLNAENHRTKI
TVVFLKDEKYHSLPIIIKGSVGGLLVLIVILVILFKC
GFFKRKYQQLNLESIRKAQLKSENLLEEEN
human integrin Beta- 42
MVALPMVLVLLLVLSRGESELDAKIPS TGDATEW
7 (amino acid
RNPHL S ML GS C QPAP S C QKCIL S HP S CAWCKQLNF
sequence)
TASGEAEARRCARREELLARGCPLEELEEPRGQQE
VLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQ
QLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERV
RQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPFVS
TVP SKLRHP CP TRLERC Q SPF SFHHVLSLTGDAQAF
EREVGRQ S V S GNLD SPE GGFD AIL Q AALC Q E QIGW
RNVSRLLVF T S DD TFHTA GD GKLGGIF1VIP SD GHCH
-126-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
SEQ
Description ID NO: SEQUENCE
LDSNGLYSRSTEFDYP S VGQVAQAL S AANI QPIF A
V TS AALPV Y QELSKLIPKS AV GEL SEDS SN V V QUIVI
DAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKRE
GKAEDRGQCNHVRINQTVTFWVSLQATHCLPEPH
LLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCS
DGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLE
S GCRAPNGTGPLC S GKGHCQC GRC S C S GQS S GHL
CE CDD A S CERHE GIL C GGF GRCQ C GVCHCHANRT
GRAC EC SGDMD S CI SPE G GL C S GHGRCKC NRC Q C
LD GYYGAL CD Q CP GC KTP CERHRD C AE C GAFRTG
PLATNC STACAHTNVTLALAPILDDGWCKERTLD
NQLFFFLVEDDARGTVVLRVRPQEKGADHTQAIV
LGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEK
EQQQLNWKQDSNPLYKSAITTTINPRFQEADSPTL
rhesus integrin 43
MWLVHTLLCMASLAPLAAFNVDVARPWLTPKGG
Alpha-E (amino acid
APFVLSSLLHQDPGTNHTWLLVTSPRTERTPVPLH
sequence)
RCSLVQDEILCHSVEHVPIPKGRHRGVTVARSHHG
VLICIQVLARRPYSLSSEFTGTCGLLGPDLRPQAQA
NF'FDLENLLDPDARVDTGDCYSNKEGSRGEDVNT
ARRRRALEKEEEEEDEEEEEDEEEEAGTEIMILDGS
GSIDPPDFQRAKDFISNM_MRNFYEKCFECNFALVQ
YGGVIQ'TEFDLRDSQDVIVIASLAKVQNITQVGSVT
KTASAMQHVLDNIFTSSHGSRRKASKV1VIVVLTDG
GIFEDPLDLTTVINSPKMHGVERFAIGVGEEFKSAR
TERELNLIASDPDETHAFKVTNYMALDGLLSKLRY
NII S ME GTVGD ALHYQ LAQ IGF SAQILDERQVLLG
AVGAFDWS GGALLYNTRSRRGRFLNQTAAAVDG
EAAQYSYLGYAVAVLEEKTCSVSYVAGAPRYKHH
GAVFELQKEGTETSFLPVLEGEQMGSYFGSELCPV
DIDMDGTTDFLLVAAPFYHVHGEEGRVYVYRLSE
QDGSFSLARILSGHPGFASARFGFAMAAVGDISQD
KLTDV A IGA PLEGF GA GD GA SF GS VYIYNGHWDG
LSAGPSQRIRASAVAPGLQYFGMSVAGGFDISGDG
LADITVGTLGRAVVFRSRPVVRLEVSMAFTPSALPI
GFNGVVNVRLCFEISSVATVSASGLRGAFLNFTLD
VDVGKERKRLQCSDGRSCLGCLREWSSGSRLCED
LLLVPTEGELFIEEDCFSNATVKVGYQLQTPEGQTD
HPQPILDRYAETFAIFQLPYEKACKNKLFCVAELQL
ATTV S Q Q ELVV GLTKEL TLNI SLTNS GED S YMT S M
ALNYPRNLQFKRMQKPPSPNIQCDDPQPAASVLV
MT CRI GEIPVLRRS SAHVSVVWQLEENAFPNRTADI
TVTVTNSNERRSVAEETHTLQFRHGFVAVLSKPSI
MYVHTGQVLSHIIKEFVFHIHGENLFGAEYQLRIC
VPTKLRGLQIVTVKNLTRTQAFTVCTWSQERACGF
-127-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
SEQ
Description ID NO: SEQUENCE
IPVQHVEEWHSVSCVIASDKENVTVAAEISVDHSE
ELLKD V TELQ IL GEI SF NKSLYEGLNAENHRTKITV
VFLKDEKYHSLPVIIKGSIGGLLVLIVILVILFKC GFF
KRKYQQLNLENIRKAQLKSETLLEEEN
rhesus integrin Beta- 44 MGF CH VD Q GMV ALP V
VLVLLLVLSRGESELDAKT
7 (amino acid PSTGEATEWGNPHLSLLGSCQPAPSCQKCIVSHPSC
sequence) AWCKQLNFTASGEAEARRCARREELLARGCPLEE
LEEPRGQQEVLQDQPLSQ GAR GEGA TQLAP Q RVRI
TLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSM
KDDLERVRQLGHALLVRLQEVTHSVRIGFGSFVD
KTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLS
LT GD AQ AFEREVGRQ S V S GNLD SPE GGFD AILQ AA
LC QE QI GWRNVSRLLVF TSDD TFHTAGD GKLGGIF
MP SD GHCHLD SNGL Y SRS TEFD YP S V GQVAQ AL S
AANIQPIFAVTSAALPVYQELSKLIPKSAVGELSED
SSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYES
QCEGPEKTEGKAEDRGQCNHVQINQ TVTFWVSLQ
ATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQAQAPHCSDGQGHLQCGVCSCAPGRLGRLCECS
EAELS SLDLESGCRAPNGTGPLCSGKGQCQCGHCS
CNGQ S S GHLC E CDD A S CERHE GILC GGF GRCQCG
VCHCH A NR TGR A CEC SGDMD S CI SPEGGL C S GHG
RCKCNRCQC SD GYYGAL CD Q CP GC KTP CERHRD C
AEC GAF GT GLLATNC S TACAHTNVTLVLAPILDDG
WCKERTLDNIILFFFLVEDDARGRVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRL SVEIYDR
REYSRFEKEQQQLNWKQDSNPLYKSAITTTINPRF
QEADSPIL
human integrin 45 MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPY
Alpha-4 (amino acid NVDTESALLYQ GPHNTLF GYSVVLHSHGANRWLL
sequence) V GAP TAN WLAN A S VINPGAIYRCRIGKNPGQ
TCEQ
LQLGSPNGEPCGKTCLEERDNQWLGVTL SRQP GE
NGSIVTCGEIRWKNIFYIKNENKLPTGGCYGVPPDL
RTELSKRIAPCYQDYVKKFGENFAS CQAGIS SF YT
KDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDK
QNQVKF GS YLGY SVGAGHFRS QHTTEVVGGAPQH
EQIGKAYIFSIDEKELNILHEMKGKKLGS YFGASVC
AVDLNADGFSDLLVGAPMQ STIREEGRVFVYINSG
SGAVMNAMETNLVGSDKYAARF GE SIVNL GDIDN
DGFEDVAIGAPQEDDLQ GAIYIYNGRAD GI S S TF SQ
RIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVG
AFRSD SAVLLRTRPVVIVDASLSHPESVNRTKFDC
VENGWPSVCIDLTLCF SYKGKEVPGYIVLFYNMSL
DVNRKAESPPRFYF S SNGTSD VI T GS I QV S SREANC
-128-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
SEQ
Description ID NO: SEQUENCE
RTHQAFMRKDVRDILTPIQIEAAYHLGPHVISKRST
EEFPPLQPILQQKKEKDIMKKTINFARFCAH_ENCSA
DLQVSAKIGFLKPHENKTYLAVGS1VIKTLMLNVSL
FNAGDDAYETTLHVKLPVGLYFIKILELEEKQINCE
VTDNSGVVQLDCSIGYIYVDHLSRIDISFLLDVSSLS
RAEEDLSITVHATCENEEEMDNLKHSRVTVAIPLK
YEVKLTVHGFVNPTSFVYGSNDENEPETCMVEKM
NLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF
NILDVQTTTGECLIFENYQRVCALEQQKSAMQTLK
GIVRFLSKTDKRLLYCIKADPHCLNFLCNFGKMES
GKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEP
NPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVIIS
SSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENR
RDSWSYINSKSNDD
[00346] Example 15: References
[00347] Khalil, D. N., Smith, E. L., Brentjens, R. J. & Wolchok, J. D. The
future of cancer
treatment: immunomodulation, CARs and combination immunotherapy. Nat. Rev.
Clin.
Oncol. 2016;13: 273-290.
[00348] Rizvi, N. A., Hellmann, M. D., Snyder, A., Kvistborg, P.,
Makarov, V., Havel, J.
J., Lee, W., Yuan, J., Wong, P., Ho, T. S., Miller, M. L., Rekhtman, N.,
Moreira, A. L.,
Ibrahim, F., Bruggeman, C., Gasmi, B., Zappasodi, R., Maeda, Y., Sander, C.,
Garon, E. B.,
Merghoub, T., Wolchok, J. D., Schumacher, T. N. & Chan, T. A. Mutational
landscape
determines sensitivity to PD-1 blockade in non-small cell lung cancer. Science
2015;348:
124-128.
[00349] McGranahan, N., Furness, A. J. S., Rosenthal, R., Ramskov, S., Lyngaa,
R., Saini,
S. K., Jamal-Hanjani, M., Wilson, G. A., Birkbak, N. J., Hiley, C. T.,
Watkins, T. B. K.,
Shafi, S., Murugaesu, N., Mitter, R., Akarca, A. U., Linares, J., Marafioti,
T., Henry, J. Y.,
Van Allen, E. M., Miao, D., Schilling, B., Schadendorf, D., Garraway, L. A.,
Makarov, V.,
Rizvi, N. A., Snyder, A., Hellmann, M. D., Merghoub, T., Wolchok, J. D.,
Shukla, S. A.,
Wu, C. J., Peggs, K. S., Chan, T. A., Hadrup, S. R., Quezada, S. A. & Swanton,
C. Clonal
neoantigens elicit T cell immunoreactivity and sensitivity to immune
checkpoint blockade.
Science 2016;351: 1463-1469.
-129-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00350] Le, D. T., Durham, J. N., Smith, K. N., Wang, H., Bartlett, B. R.,
Aulakh, L. K.,
Lu, S., Kemberling, H., Wilt, C., Luber, B. S., Wong, F., Azad, N. S., Rucki,
A. A., Laheru,
D., Donehower, R., Zaheer, A., Fisher, G. A., Crocenzi, T. S., Lee, J. J.,
Greten, T. F., Duffy,
A. G., Ciombor, K. K., Eyring, A. D., Lam, B. H., Joe, A., Kang, S. P.,
Holdhoff, M.,
Danilova, L., Cope, L., Meyer, C., Zhou, S., Goldberg, R. M., Armstrong, D.
K., Bever, K.
M., Fader, A. N., Taube, J., Housseau, F., Spetzler, D., Xiao, N., Pardo11, D.
M.,
Papadopoulos, N., Kinzler, K. W., Eshleman, J. R., Vogelstein, B., Anders, R.
A. & Diaz, L.
A. Mismatch-repair deficiency predicts response of solid tumors to PD-1
blockade. Science
2017; doi:10.1126/science.aan6733.
[00351] Sharma, P. & Allison, J. P. The future of immune checkpoint therapy.
Science
2015;348: 56-61.
[00352] Adams, J. L., Smothers, J., Srinivasan, R. & Hoos, A. Big
opportunities for small
molecules in immuno-oncology. Nat. Rev. Drug Discov. 2015;14: 603-22.
[00353] Topalian, S. L., Drake, C. G. & Pardo11, D. M. Immune checkpoint
blockade: A
common denominator approach to cancer therapy. Cancer Cell 2015;27: 450-61.
[00354] Postow, M. A., Callahan, M. K. & Wolchok, J. D. Immune checkpoint
blockade
in cancer therapy. J. Clin. Oncol. 2015;33: 1974-82.
[00355] Buchbinder, E. & Hodi, F. S. Cytotoxic T lymphocyte antigen-4 and
immune
checkpoint blockade. J. Clin. Invest. 2015;125: 3377-83.
[00356] Mahoney, K. M., Rennert, P. D. & Freeman, G. J. Combination cancer
immunotherapy and new immunomodulatory targets. Nat. Rev. Drug Discov.
2015;14: 561-
584.
[00357] Lesterhuis, W. J., Bosco, A., Millward, M. J., Small, M., Nowak, A. K.
& Lake,
R. A. Dynamic versus static biomarkers in cancer immune checkpoint blockade:
unravelling
complexity. Nat. Rev. Drug Discov. 2017;16: 264-272.
[00358] Gnjatic, S., Bronte, V., Brunet, L. R., Butler, M. 0.,
Disis, M. L., Galon, J.,
Hakansson, L. G., Hanks, B. A., Karanikas, V., Khleif, S. N., Kirkwood, J. M.,
Miller, L. D.,
Schendel, D. J., Tanneau, I., Wigginton, J. M. & Butterfield, L. H.
Identifying baseline
-130-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
immune-related biomarkers to predict clinical outcome of immunotherapy. J.
Immunother.
Cancer 20175: 44.
[00359] Nishino, M., Ramaiya, N. H., Hatabu, H. & Hodi, F. S. Monitoring
immune-
checkpoint blockade: response evaluation and biomarker development. Nat. Rev.
Clin.
Oncol. 2017;doi:10.1038/nrclinonc.2017.88.
[00360] Djenidi, F., Adam, J., Goubar, A., Durgeau, A., Meurice, G., de
Montpreville, V.,
Validire, P., Besse, B. & Mami-Chouaib, F. CD8+ CD103+ tumor¨infiltrating
lymphocytes
are tumor-specific tissue-resident memory T cells and a prognostic factor for
survival in lung
cancer patients. J. Immunol. 2015;194: 3475-3486.
[00361] Webb, J. R., Milne, K. & Nelson, B. H. PD-1 and CD103 are widely
coexpressed
on prognostically favorable intraepithelial CD8 T cells in human ovarian
cancer. Cancer
Immunol. Res. 2015;3: 926-935.
[00362]
BOsmtiller, H.-C., Wagner, P., Peper, J. K., Schuster, H., Pham, D. L.,
Greif, K.,
Beschorner, C., Rammensee, H.-G., Stevanovie, S., Fend, F. & Staebler, A.
Combined
immunoscore of CD103 and CD3 identifies long-term survivors in high-grade
serous ovarian
cancer. Int. J. Gynecol. Cancer 2016;26: 671-679.
[00363] Workel, H. H., Komdeur, F. L., Wouters, M. C. A., Plat, A., Klip, H.
G., Eggink,
F. A., Wisman, G. B. A., Arts, H. J. G., Oonk, M. H. M., Mounts, M. J. E.,
Yigit, R.,
Versluis, M., Duiker, E. W., Hollema, H., de Bruyn, M. & Nijman, H. W. CD 103
defines
intraepithelial CD8+ PD1+ tumour-infiltrating lymphocytes of prognostic
significance in
endometrial adenocarcinoma. Eur. J. Cancer 2016;60: 1-11.
[00364] Santoiemma, P. P., Reyes, C., Wang, L.-P., McLane, M. W., Feldman, M.
D.,
Tanyi, J. L. & Powell, D. J. Systematic evaluation of multiple immune markers
reveals
prognostic factors in ovarian cancer. Gynecol. Oncol. 2016;143: 120-127.
[00365] Komdeur, F. L., Wouters, M. C. A., Workel, H. H., Tijans, A. M.,
Terwindt, A. L.
J., Brunekreeft, K. L., Plat, A., Klip, H. G., Eggink, F. A., Leffers, N.,
Helfrich, W.,
Samplonius, D. F., Bremer, E., Wisman, G. B. A., Daemen, T., Duiker, E. W.,
Hollema, H.,
Nijman, H. W. & de Bruyn, M. CD103+ intraepithelial T cells in high-grade
serous ovarian
-131 -
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
cancer are phenotypically diverse TCRal3+ CD8af3+ T cells that can be targeted
for cancer
immunotherapy. Oncotarget 2016;7: 75130-75144.
[00366] Boutet, M., Gauthier, L., Leclerc, M., Gros, G., de Montpreville, V.,
Theret, N.,
Donnadieu, E. & Mami-Chouaib, F. TGFI3 signaling intersects with CD103
integrin signaling
to promote T-lymphocyte accumulation and antitumor activity in the lung tumor
microenvironment. Cancer Res. 2016;76: 1757-1769.
[00367] Ganesan, A.-P., Clarke, J., Wood, 0., Garrido-Martin, E.
M., Chee, S. J.,
Mellows, T., Samaniego-Castruita, D., Singh, D., Seumois, G., Alzetani, A.,
Woo, E.,
Friedmann, P. S., King, E. V, Thomas, G. J., Sanchez-Elsner, T., Vijayanand,
P. &
Ottensmeier, C. H. Tissue-resident memory features are linked to the magnitude
of cytotoxic
T cell responses in human lung cancer. Nat. Immunol. 2017;18: 940-950.
[00368] Wang, B., Wu, S., Zeng, H., Liu, Z., Dong, W., He, W., Chen, X., Dong,
X.,
Zheng, L., Lin, T. & Huang, J. CD103+ tumor infiltrating lymphocytes predict a
favorable
prognosis in urothelial cell carcinoma of the bladder. J. Urol. 2015;194: 556-
562.
[00369] Wang, Z. Q., Milne, K., Derocher, H., Webb, J. R., Nelson, B. H. &
Watson, P.
H. CD103 and intratumoral immune response in breast cancer. Clin. Cancer Res.
2016;22:
6290-6297.
[00370] Kato R., Yamasaki M., Urakawa S., Nishida K., M_akino T., Morimoto-
Okazawa
A., Kawashima A., Iwahori K., Suzuki S., Ueda R., Mori M., Satoh T., Doki Y.,
Wada H.
Increased Tim-3+ T cells in PBMCs during nivolumab therapy correlate with
responses and
prognosis of advanced esophageal squamous cell carcinoma patients. Cancer
Immunol
Immunother. 2018. doi: 10.1007/s00262-018-2225-x.
[00371] Rocha P., Hardy-Werbin M., Naranjo D., Taus A., Rodrigo M., Zuccarino
F.,
Roth R., Wood 0., Ottensmeier C. H., Arriola E. CD103+CD8+ Lymphocytes
Characterize
the Immune Infiltration in a Case With Pseudoprogression in Squamous NSCLC. J
Thorac
Oncol. 2018;13):e193-e196.
[00372] Edwards J., Wilmott J. S., Madore J., Gide T. N., Quek C., Tasker A.,
Ferguson
A., Chen J., Hewavisenti R., Hersey P., Gebhardt T., Weninger W., Britton W.
J., Saw R. P.
M., Thompson J. F., Menzies A. M., Long G. V., Scolyer R. A., Palendira U.
CD103+
-132-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
Tumor-Resident CD8+ T Cells Are Associated with Improved Survival in
Immunotherapy-
Naive Melanoma Patients and Expand Significantly During Anti-PD-1 Treatment.
Clin
Cancer Res. 2018;24:3036-3045van Kruchten, M., de Vries, E. G. E., Brown, M.,
de Vries,
E. F. J., Glaudemans, A. W. J. M.,Dierckx, R. A. J. 0., Schroder, C. P. &
Hospers, G. A. P.
PET imaging of oestrogen receptors in patients with breast cancer. Lancet
Oncol. 2013; 14:
e465-75.
[00373] van Kruchten, M., Hospers, G. A. P., Glaudemans, A. W. J. M., Hollema,
H.,
Arts, H. J. G. & Reyners, A. K. L. Positron emission tomography imaging of
oestrogen
receptor-expression in endometrial stromal sarcoma supports oestrogen receptor-
targeted
therapy: case report and review of the literature. Eur. J. Cancer 2013;49:
3850-5.
[00374] Talbot, J. N., Gligorov, J., Nataf, V., Montravers, F.,
Huchet, V., Michaud, L.,
Ohnona, J., Balogova, S., Cussenot, 0., Darai, E., Lotz, J. P. & Kerrou, K.
Current
applications of PET imaging of sex hormone receptors with a fluorinated
analogue of
estradiol or of testosterone. Q. J. Nucl. Med. Mol. Imaging 2015;59: 4-17.
[00375] Grootjans, W., de Geus-Oei, L.-F., Troost, E. G. C.,
Visser, E. P., Oyen, W. J. G.
& Bussink, J. PET in the management of locally advanced and metastatic NSCLC.
Nat. Rev.
Clin. Oncol. 2015;12: 395-407.
[00376] Houshmand, S., Boursi, B., Salavati, A., Simone, C. B. & Alavi, A.
Applications
of Fluorodeoxyglucose PET/Computed tomography in the assessment and prediction
of
radiation therapy-related complications. PET Clin. 2015;10: 555-71.
[00377] Bernard-Gauthier, V., Bailey, J. J., Berke, S. & Schirrmacher, R.
Recent advances
in the development and application of radiolabeled kinase inhibitors for PET
imaging.
Molecules 2015;20: 22000-27.
[00378] Challapalli, A. & Aboagye, E. 0. Positron emission tomography imaging
of
tumor cell metabolism and application to therapy response monitoring. Front.
Oncol. 2016;6:
44.
[00379] Spick, C., Herrmann, K. & Czernin, J. 18F-FDG PET/CT and PET/MRI
perform
equally well in vancer: Evidence from studies on more than 2,300 patients. J.
Nucl. Med.
2016;57: 420-30.
-133-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00380] Bollineni, V. R., Kramer, G. M., Jansma, E. P., Liu, Y. & Oyen, W. J.
G. A
systematic review on [(18)F]FLT-PET uptake as a measure of treatment response
in cancer
patients. Eur. J. Cancer 2016;55: 81-97.
[00381] Eggink, F. A., Van Gool, I. C., Leary, A., Pollock, P.
M., Crosbie, E. J.,
Mileshkin, L., Jordanova, E. S., Adam, J., Freeman-Mills, L., Church, D. N.,
Creutzberg, C.
L., De Bruyn, M., Nijman, H. W. & Bosse, T. Immunological profiling of
molecularly
classified high-risk endometrial cancers identifies POLE -mutant and
microsatellite unstable
carcinomas as candidates for checkpoint inhibition. Oncoimmunology
2017;6:e1264565.
[00382] F. A. Ran, P. D. Hsu, J. Wright, V. Agarwala, D. A. Scott, F. Zhang,
Genome
engineering using the CRISPR-Cas9 system, Nat. Protoc. 8,2281-2308 (2013).
[00383] A. Kol, A. T. van Scheltinga, M. Pool, C. Gerdes, E. de Vries, S. de
Jong, ADCC
responses and blocking of EGFR-mediated signaling and cell growth by combining
the anti-
EGFR antibodies imgatuzumab and cetuximab in NSCLC cells., Oncotarget 8,45432-
45446
(2017).
[00384] B. J. C. Quah, H. S. Warren, C. R. Parish, Monitoring lymphocyte
proliferation in
vitro and in vivo with the intracellular fluorescent dye carboxyfluorescein
diacetate
succinimidyl ester., Nat. Protoc. 2,2049-2056 (2007).
[00385] E. C. F. Dijkers, J. G. W. Kosterink, A. P. Rademaker, L. R. Perk, G.
a M. S. van
Dongen, J. Bart, J. R. de Jong, E. G. E. de Vries, M. N. Lub-de Hooge,
Development and
characterization of clinical-grade 89Zr-trastuzumab for IIER2/neu immunoPET
imaging., J.
Nucl. Med. 50,974-981 (2009).
[00386] F.A. Ran, P.D. Hsu, J. Wright, V. Agarwala, D.A. Scott, F. Zhang.
Genome
engineering using the CRISPR-Cas9 system. Nat. Protoc. 8: 2281-2308 (2013)
[00387] P.G. Steenbakkers, F. van Meel, W. Olijve. A new approach to the
generation of
human or murine antibody producing hybridomas. J Immunol Methods. 152: 69-77
(1992).
[00388] All references cited herein are incorporated by reference to the same
extent as if
each individual publication, database entry (e.g. Genbank sequences or GeneID
entries),
patent application, or patent, was specifically and individually indicated to
be incorporated
by reference. This statement of incorporation by reference is intended by
Applicants,
-134-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
pursuant to 37 C.F.R. 1.57(b)(1), to relate to each and every individual
publication, database
entry (e.g. Genbank sequences or GeneID entries), patent application, or
patent, each of
which is clearly identified in compliance with 37 C.F.R. 1.57(b)(2), even if
such citation is
not immediately adjacent to a dedicated statement of incorporation by
reference. The
inclusion of dedicated statements of incorporation by reference, if any,
within the
specification does not in any way weaken this general statement of
incorporation by
reference. Citation of the references herein is not intended as an admission
that the reference
is pertinent prior art, nor does it constitute any admission as to the
contents or date of these
publications or documents. To the extent that the references provide a
definition for a
claimed term that conflicts with the definitions provided in the instant
specification, the
definitions provided in the instant specification shall be used to interpret
the claimed
invention.
[00389] While the invention has been described and exemplified in sufficient
detail for
those skilled in this art to make and use it, various alternatives,
modifications, and
improvements should be apparent without departing from the spirit and scope of
the
invention. The examples provided herein are representative of preferred
embodiments, are
exemplary, and are not intended as limitations on the scope of the invention.
Modifications
therein and other uses will occur to those skilled in the art. These
modifications are
encompassed within the spirit of the invention and are defined by the scope of
the claims.
[00390] It will be readily apparent to a person skilled in the art that
varying substitutions
and modifications may be made to the invention disclosed herein without
departing from the
scope and spirit of the invention.
[00391] All patent applications, patents, publications and other references
mentioned in
the specification are indicative of the levels of those of ordinary skill in
the art to which the
invention pertains and are each incorporated herein by reference. The
references cited herein
are not admitted to be prior art to the claimed invention.
[00392] Unless otherwise defined, all technical and scientific terms used
herein have the
same meaning as commonly understood by one of ordinary skill in the art to
which this
-135-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
invention belongs. In the case of conflict, the present specification,
including definitions, will
control.
[00393] The use of the articles -a", -an", and -the" in both the description
and claims are
to be construed to cover both the singular and the plural, unless otherwise
indicated herein or
clearly contradicted by context. The terms "comprising-, "having", "being of'
as in "being of
a chemical formula", "including", and "containing" are to be construed as open
terms (i.e.,
meaning -including but not limited to") unless otherwise noted. Additionally
whenever
"comprising" or another open-ended term is used in an embodiment, it is to be
understood
that the same embodiment can be more narrowly claimed using the intermediate
term
"consisting essentially of' or the closed term "consisting of'.
[00394] The term "about", "approximately", or "approximate", when used in
connection
with a numerical value, means that a collection or range of values is
included. For example,
"about X" includes a range of values that are 20%, 10%, 5%, 2%, 1%,
0.5%, 0.2%,
or 0.1% of X, where X is a numerical value. In one embodiment, the term
"about" refers to
a range of values which are 10% more or less than the specified value. In
another
embodiment, the term "about" refers to a range of values which are 5% more or
less than the
specified value. In another embodiment, the term "about- refers to a range of
values which
are 1% more or less than the specified value.
[00395] Recitation of ranges of values are merely intended to serve as a
shorthand method
of referring individually to each separate value falling within the range,
unless otherwise
indicated herein, and each separate value is incorporated into the
specification as if it were
individually recited herein. A range used herein, unless otherwise specified,
includes the two
limits of the range. For example, the terms "between X and Y" and "range from
X to Y, are
inclusive of X and Y and the integers there between. On the other hand, when a
series of
individual values are referred to in the disclosure, any range including any
of the two
individual values as the two end points is also conceived in this disclosure.
For example, the
expression "a dose of about 100 mg, 200 mg, or 400 mg" can also mean "a dose
ranging
from 100 to 200 mg", "a dose ranging from 200 to 400 mg", or "a dose ranging
from 100 to
400 mg".
-136-
CA 03176894 2022- 10- 26
WO 2021/219871
PCT/EP2021/061450
[00396] The invention illustratively described herein suitably may be
practiced in the
absence of any element or elements, limitation or limitations which is not
specifically
disclosed herein. Thus, for example, in each instance herein any of the terms
"comprising",
consisting essentially of' and "consisting of' may be replaced with either of
the other two
terms. The terms and expressions which have been employed are used as terms of
description
and not of limitation, and there is no intention that in the use of such terms
and expressions
of excluding any equivalents of the features shown and described or portions
thereof, but it is
recognized that various modifications are possible within the scope of the
invention claimed.
Thus, it should be understood that although the present invention has been
specifically
disclosed by preferred embodiments and optional features, modification and
variation of the
concepts herein disclosed may be resorted to by those skilled in the art, and
that such
modifications and variations are considered to be within the scope of this
invention as
defined by the appended claims.
-137-
CA 03176894 2022- 10- 26
