Note: Descriptions are shown in the official language in which they were submitted.
CA 02220116 1997-11-03
WO 96/34940 PCT/U1596/06035
-1-
TITLE OF THE INVENTION
DNA ENCODING GLUTAMATE GATED CHLORIDE CHANNELS
BACKGROUND OF THE INVENTION
Glutamate-gated chloride channels, or H-receptors, have
been identified in arthropod nerve and muscle [Lingle, C. & Marder, E.
Brain Res. 212, 481-488 (1981)], [Horseman, B.G., Seymour, C.,
Bermudez, I. & Beadle, D.J. Neurosci. Lett. 85, 65-70 (1988)], [Wafford,
K.A. & Sattelle, D.B. J. Exp. Bio. 144, 449-462 (1989)], [Lea, T.J. &
Usherwood, P.N.R. Comp. Gen. Parmacol. 4, 333-350 (1973)], [Cull-
Candy, S.G. J. Physiol. 255, 449-464 (1976)], and cloned from the soil
nematode Caenorhabditis elegans [Cully, D.F., Vassilatis, D.K., Liu,
K.K., Paress, P.S., Van der Ploeg, L.H.T., Schaeffer, J.M. & Arena, J.P.
Nature 371, 707-711 (1994)]. They are important targets for the widely
used avermectin class of anthelmintic and insecticidal compounds. The
avemiectins are a family of macrocyclic lactones originally isolated from
the actinomycete Streptomyces avermitilis. The semisynthetic avermectin
derivative, ivermectin (22,23-dihydro-avermectin B 1 a), is used
throughout the world to treat parasitic helminths and insect pests of man
and animals. Discovered some 15 years ago, the avermectins remain the
most potent broad spectrum endectocides exhibiting low toxicity to the
host. Avermectins exhibit an essentially irreversible interaction with a
high affinity site in nematode [Schaeffer, J.M. & Haines, H.W. Biochem.
Pharm. 38, 2329-2338 (1989); Cully, D.F. & Paress P.S., Molecular
Pharm. 40:326-332 (1991)] and insect [Rohrer, S.P., Meinke, P.T.,
Hayes, E.C., Mrozik, H. & Schaeffer, J.M. Proc. Natl. Acad. Sci, 89,
4168-4172 (1992)] membranes and induce an increase in membrane
chloride permeability in nematodes [Martin, R.J. & Pennington, A.J. Br.
J. Pharmacol. 98, 747-756 (1989)], arthropods [Scott, R.H. & Duce, I.R.
Pestic.. Sci. 16, 599-604 (1985)], [Duce, I.R. & Scott, R.H. Brit. J.
Pharmacol. 85, 395-401 (1985)] and crustaceans [Zufall, F., Franke, C. &
Hatt, H. J. Exp. Biol. 142, 191-205 (1989)]. Avermectins have been
shown to directly activate glutamate-gated chloride channels from C.
elegans [Arena, J.P., Liu, K.K., Paress, P.S. & Cully, D.F. Mol.
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-2-
Pharmacol. 40, 368-374 (1991); Arena, J.P., Liu, K.K., Paress, P.S.,
Schaeffer, J.M. & Cully, D.F. Mol. Brain Res. 15, 339-348 (1992); Cully,
D.F., Vassilatis, D.K., Liu, K.K., Paress, P.S., Van der Ploeg, L.H.T.,
Schaeffer, J.M. & Arena, J.P. Nature 371, 707-711 (1994)], and to
directly activate or potentiate glutamate-gated chloride channel current in
locust muscle [Scott, R.H. & Duce, I.R. Pestic, Sci. 16, 599-604 (1985);
Aydar, E., Harding, L., Beadle, D.J. & Bermudez, I. Proceedings of the
British Pharmacological Society p24 (1993)].
SUMMARY OF THE INVENTION
A target of avermectin action in arthropods has been cloned
and characterized and it represents a new member of the glutamate-gated
chloride channel class of ligand-gated channels. Using a reverse
transcription PCR approach a functional DNA molecule encoding the
Drosophila glutamate-, and avermectin-sensitive chloride channel has
been isolated. The electrophysiological and structural properties of the
protein is disclosed, as is the amino acid and nucleotide sequence. The
recombinant protein is useful to identify modulators of the channel.
Modulators identified in this process are useful as therapeutic agents,
including insecticides, ectoparasiticides, endoparasiticides, acaracides and
anthelminthics.
BRIEF DESCRIPTION OF THE DRAWING
Figure 1 - The nucleotide sequence of Dros GluC1 is shown.
Figure 2 - The amino acid sequence of Dros GluCl is shown.
Figure 3 - Electrophysiological properties Dros GluCl expressed in
Xenopus oocytes is shown.
Figure 4 - Structure of Compound-1 is shown.
Figure 5 - A phylogenetic analysis of Dros GluCl is shown.
DETAILED DESCRIPTION
The present invention relates to DNA encoding an arthropod
glutamate- and avermectin-sensitive chloride channel (G1uC1) which was
isolated from G1uC1 producing cells. GluCl, as used herein, refers to
CA 02220116 1997-11-03
WO 96/34940 PCT/U596/06035
-3-
protein which can specifically function as an anion channel gated by
glutamate or avermectin.
The amino acid sequence of the Dros G1uC1 was not
previously known, nor was the nucleotide sequence encoding Dros GluCl
known. This is the first reported cloning of a glutamate-gated chloride
chanael from arthropods. Dros G1uC1 is related to the previously cloned
C. elegans GluCla and GluClP [Cully, D.F., Vassilatis, D.K., Liu, K.K.,
Paress, P.S., Van der Ploeg, L.H.T., Schaeffer, J.M. & Arena, J.P. supra].
Unlike the C. elegans channel Dros GluCl requires only a single
polypeptide for direct activation with avermectin or glutamate. In
addition, Dros GluCl is directly activated by the insectidal agent,
Compound-1 (Fig. 5) which is the subject of U.S. Patent 5,399,582 ,and is
fully described therein. It is predicted that all Drosophila -related
organisms sensitive to the avermectins will contain the described
glutamate and avermectin-sensitive channels. Drosophila cells capable
of producing G1uC1 include, but are not limited to muscle or nerve cells
isolated from organisms that show sensitivity to the avermectins.
Avennectin sensitive animals are diverse and include invertebrates
belonging to the phyla Arthropoda and Nematoda.
Other cells and cell lines may also be suitable for use to
isolate G1uC1 cDNA. Selection of suitable cells may be done by
screening for GluCl activity in cell extracts. GluCl activity can be
monitored by performing a radiolabeled-ivermectin or radiolabeled
Compound-1, or derivative thereof, binding assay (Cully and Paress,
supra; Rohrer et al, supra) or by direct electrophysiological me tsurnaeni:
of a glutamate-, Compound-1 or avermectin-sensitive chloride channel
[Martin, R.J. & Pennington, A.J. Br. J. Pharmacol. 98, 747-756 (1989);
Scott, R.H. & Duce, I.R. Pestic. Sci. 16, 599-604 (1985); Duce, I.R. &.
Scott, R.H. Brit. J. Pharmacol. 85, 395-401 (1985); Zufall, F., Franke, C.
& Hatt, H. J. Exp. Biol. 142, 191-205 (1989)]. Cells which possess GIuCI
activity in this assay may be suitable for the isolation of GluCl DNA or
RNA.
Any of a variety of procedures known in the art may be used
to molecularly clone GluCl DNA. These methods include, but are not
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-4-
limited to, direct functional expression of the GIuCI genes following the
construction of a G1uC1-containing DNA library in an appropriate
expression vector system. Another method is to screen GIuC1-containing
DNA library constructed in a bacteriophage or plasmid shuttle vector
with a labelled oligonucleotide probe designed from the amino acid
sequence of the GluC1 protein. An additional method consists of
screening a GluCl-containing DNA library constructed in a bacteriophage
or plasmid shuttle vector with a partial cDNA encoding the G1uC1
protein. This partial cDNA is obtained by the specific PCR amplification
of GluCl DNA fragments through the design of degenerate
oligonucleotide primers from the amino acid sequence of the purified
GluCl proteins.
Another method is to isolate RNA from GluCl-producing
cells and translate the RNA into protein via an in vitro or an in vivo
translation system. The translation of the RNA into a peptide or a protein
will result in the production of at least a portion of the GluCl protein
which can be identified by, for example, immunological reactivity with
an anti-GluCl antibody or by biological activity of GluCl protein. In this
method, pools of RNA isolated from GIuCI-producing cells are analyzed
for the presence of an RNA which encodes at least a portion of the GIuCI
protein. Further fractionation of the RNA pool can be done to purify the
GluCl RNA from non-GIuC1 RNA. The peptide or protein produced by
this method may be analyzed to provide amino acid sequences which in
turn are used to provide primers for production of GluCl cDNA, or the
RNA used for translation can be analyzed to provide nucleotide
sequences encoding GluCl and produce probes for this production of
GIuCI cDNA. This method is known in the art and can be found in, for
example, Sambrook, J., Fritsch, E.F., Maniatis, T. in Molecular Cloning:
A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory
Press, Cold Spring Harbor, NY. 1989.
It is readily apparent to those skilled in the art that other
types of libraries, as well as libraries constructed from other cells or cell
types, may be useful for isolating G1uCl-encoding DNA. Other types of
libraries include, but are not limited to, cDNA libraries derived from
CA 02220116 1997-11-03
WO 96/34940 PCT/USi96/06035
-5-
other cells, and genomic DNA libraries that include YAC (yeast artificial
chromosome) and cosmid libraries.
It is readily apparent to those skilled in the art that suitable
cDNA libraries may be prepared from cells or cell lines which have.
G1uC1 activity. The selection of cells or cell lines for use in preparing a
cDNA library to isolate G1uC1 cDNA may be done by first measuring cell
associated GluCl activity using the electrophysiological measurmerit of
avermectin and glutamate-sensitive chloride channels or a glutamate or
avernectin ligand binding assay.
Preparation of cDNA libraries can be performed by standard
techniques well known in the art. Well known cDNA library construction
techniques can be found for example, in Sambrook, J., Fritsch, E.F.,
Maniatis, T. in Molecular Cloning: A Laboratory Manual, Second
Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.
1989.
It is also readily apparent to those skilled in the art that DNA
encoding G1uC1 may also be isolated from a suitable genomic DNA
library. Construction of genomic DNA libraries can be performed by
standard techniques well known in the art. Well known genomic DNA
library construction techiques can be found in Sambrook, J., Fritschõ E.F.,
Maniatis, T. in Molecular Cloning: A Laboratory Manual, Second
Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.
1989..
In order to clone the GluCl gene by the above methods, the
amino acid sequence of G1uC1 may be necessary. To accomplish this,
GluCl protein may be purified and partial amino acid sequence
determined by automated sequenators. It is not necessary to determine
the entire amino acid sequence, but the linear sequence of two regions of
6 to 8 amino acids from the protein is determined for the production of
primers for PCR amplification of a partial GluCl DNA fragment.
Once suitable amino acid sequences have been identified, the
DNA sequences capable of encoding them are synthesized. Because. the
genetic code is degenerate, more than one codon may be used to encode a
particular amino acid, and therefore, the amino acid sequence can be
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-6-
encoded by any of a set of similar DNA oligonucleotides. Only one
member of the set will be identical to the GluCl sequence but will be
capable of hybridizing to GluCl DNA even in the presence of DNA
oligonucleotides with mismatches. The mismatched DNA oligo-
nucleotides may still sufficiently hybridize to the GluCl DNA to permit
identification and isolation of GluCl encoding DNA. DNA isolated by
these methods can be used to screen DNA libraries from a variety of cell
types, from invertebrate and vertebrate sources, and to isolate
homologous genes.
Purified biologically active GIuCI may have several different
physical forms. G1uC1 may exist as a full-length nascent or unprocessed
polypeptide, or as partially processed polypeptides or combinations of
processed polypeptides. The full-length nascent GluCl polypeptide may
be postranslationally modified by specific proteolytic cleavage events
which result in the formation of fragments of the full length nascent
polypeptide. A fragment, or physical association of fragments may have
the full biological activity associated with GluCl (glutamate-, avermectin-
or Compound-1 sensitive channel). However, the degree of GIuCI
activity may vary between individual GluCl fragments and physically
associated G1uC1 polypeptide fragments.
The cloned GluCI DNA obtained through the methods
described herein may be recombinantly expressed by molecular cloning
into an expression vector containing a suitable promoter and other
appropriate transcription regulatory elements, and transferred into
prokaryotic or eukaryotic host cells to produce recombinant G1uC1.
Techniques for such manipulations are fully described in Sambrook, J.,
et al., supra, and are well known in the art.
Expression vectors are defined herein as DNA sequences
that are required for the transcription of cloned copies of genes and the
translation of their mRNAs in an appropriate host. Such vectors can be
used to express eukaryotic genes in a variety of hosts such as bacteria
including E. coli, bluegreen algae, plant cells, insect cells, fungal cells
including yeast cells, and animal cells.
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-7-
Specifically designed vectors allow the shuttling of DNA
between hosts such as bacteria-yeast or bacteria-animal cells or bacteria-
fungal cells or bacteria-invertebrate cells. An appropriately constructed
expression vector should contain: an origin of replication for autonomous
replication in host cells, selectable markers, a limited number of useful
restriction enzyme sites, a potential for high copy number, and active
promoters. A promoter is defined as a DNA sequence that directs RNA
polymerase to bind to DNA and initiate RNA synthesis. A strong
promoter is one which causes mRNAs to be initiated at high frequency.
Expression vectors may include, but are not limited to, cloning vectors,
modified cloning vectors, specifically designed plasmids or viruses.
A variety of mammalian expression vectors may be used to
express recombinant G1uC1 in mammalian cells. Commercially available
mammalian expression vectors which may be suitable for recombinant
GluC'. expression, include but are not limited to, pMAMneo (Clontech),
pcDNA3 (Invitrogen), pMClneo (Stratagene), pXT1 (Stratagene), pSG5
(Stratagene), EBO-pSV2-neo (ATCC 37593) pBPV-1(8-2) (ATCC
37110), pdBPV-MMTneo(342-12) (ATCC 37224), pRSVgpt (ATCC
37199), pRSVneo (ATCC 37198), pSV2-dhfr (ATCC 37146), pUCTag
(ATCC 37460), and IZD35 (ATCC 37565).
A variety of bacterial expression vectors may be used to
express recombinant G1uC1 in bacterial cells. Commercially available
bacterial expression vectors which may be suitable for recombinant
GluCl expression include, but are not limited to pET vectors (Novagen)
and pQE vectors (Qiagen).
A variety of fungal cell expression vectors may be used to
express recombinant GluCl in fungal cells such as yeast. Commerically
available fungal cell expression vectors which may be suitable for
recombinant GluCl expression include but are not limited to pYES2
(Invitrogen) and Pichia expression vectors (Invitrogen).
A variety of insect cell expression vectors may be used to
express recombinant GluCl in insect cells. Commercially available insect
cell expression vectors which may be suitable for recombinant expression
of GluCl include but are not limited to pBlueBacll (Invitrogen).
CA 02220116 1997-11-03
WO 96/34940 PCTIUS96/06035
-$-
DNA encoding GluCl may also be cloned into an expression
vector for expression in a recombinant host cell. Recombinant host cells
may be prokaryotic or eukaryotic, including but not limited to bacteria
such as E. coli, fungal cells such as yeast, mammalian cells including but
not limited to cell lines of human, bovine, porcine, monkey and rodent
origin, and insect cells including but not limited to Drosophila and
silkworm derived cell lines. Cell lines derived from mammalian species
which may be suitable and which are commercially available, include but
are not limited to, CV-1 (ATCC CCL 70), COS-1 (ATCC CRL 1650),
COS-7 (ATCC CRL 1651), CHO-K 1 (ATCC CCL 61), 3T3 (ATCC CCL
92), NM/3T3 (ATCC CRL 1658), HeLa (ATCC CCL 2), C1271 (ATCC
CRL 1616), BS-C-1 (ATCC CCL 26), MRC-5 (ATCC CCL 171), L-
cells, and HEK-293 (ATCC CRL1573).
The expression vector may be introduced into host cells via
any one of a number of techniques including but not limited to
transformation, transfection, protoplast fusion, lipofection, and
electroporation. The expression vector-containing cells are clonally
propagated and individually analyzed to determine whether they produce
GluCl protein. Identification of G1uC1 expressing host cell clones may be
done by several means, including but not limited to immunological
reactivity with anti-GluCl antibodies, and the presence of host cell-
associated GluCl activity.
Expression of GluCl DNA may also be performed using
in vitro produced synthetic mRNA. Synthetic mRNA or mRNA isolated
from GluCl producing cells can be efficiently translated in various cell-
free systems, including but not limited to wheat germ extracts and
reticulocyte extracts, as well as efficiently translated in cell based
systems, including but not limited to microinjection into frog oocytes,
with microinjection into frog oocytes being preferred.
To determine the GluCl DNA sequence(s) that yields
optimal levels of GluCl activity and/or GluCl protein, GluCl DNA
molecules including, but not limited to, the following can be constructed:
the full-length open reading frame of the GluCl cDNA encoding the
GluCl protein (corresponding to the first nucleotide of the first
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-9-
methionine and the last nucleotide before the first stop codon) and
constructs containing portions of the cDNA encoding GIuC1 protein. All
constructs can be designed to contain none, all or portions of the 5' or the
3' untranslated region of G1uC1 cDNA. G1uC1 activity and levels of
protein expression can be determined following the introduction, both
singly and in combination, of these constructs into appropriate host cells.
Following determination of the GluCl DNA cassette yielding optimal
expression in transient assays, this G1uC1 DNA construct is transferred to
a variety of expression vectors, for expression in host cells including, but
not limited to, mammalian cells, baculovirus-infected insect cells, E. soli,
and the yeast S. cerevisiae.
Host cell transfectants and microinjected oocytes may be
assayed for both the levels of GluCl channel activity and levels of G1uCI
protein by the following methods. In the case of recombinant host cells,
this involves the co-transfection of one or possibly two or more plasmids,
containing the GluCl DNA. In the case of oocytes, this involves the
injection of synthetic RNAs or DNAs for one or more G1uC1 proteins.
Following an appropriate period of time to allow for expression, cellular
protein is metabolically labelled with for example 35S-methionine for 24
hours, after which cell lysates and cell culture supernatants are harvested
and subjected to immunprecipitation with polyclonal antibodies directed
against the GluCl protein.
Other methods for detecting GIuC1 activity involve the direct
measurement of G1uC1 activity in whole cells transfected with GluCl
cDNA or oocytes injected with GluC1 mRNA. GluCl activity is
measured by specific ligand binding and electrophysiological
characteristics of the host cells expressing G1uCI DNA. In the case of
recombinant host cells expressing GluCl patch voltage clamp techniques
can be used to measure chloride channel activity and quantitate GluCl
protein. In the case of oocytes patch clamp as well as two electrode
voltage clamp techniques can be used to measure chloride channel
activity and quantitate GluCl protein.
Levels of GluCl protein in host cells are quantitated by
immunoaffinity and/or ligand affinity techniques. Cells expressing G1uC1
CA 02220116 1997-11-03
WO 96/34940 PCTIUS96/06035
-10-
can be assayed for the number of GluCl molecules expressed by
measuring the amount of radioactive glutamate or ivermectin binding to
cell membranes. GluC1-specific affinity beads or GluCl-specific antibodies are
used to isolate for example 35S-methionine labelled or
unlabelled GluCl protein. Labelled GluCl protein is analyzed by SDS-
PAGE. Unlabelled GluCl protein is detected by Western blotting, ELISA
or RIA assays employing GluCl specific antibodies.
Because the genetic code is degenerate, more than one codon
may be used to encode a particular amino acid, and therefore, the amino
acid sequence can be encoded by any of a set of similar DNA
oligonucleotides. Only one member of the set will be identical to the
GluCl sequence but will be capable of hybridizing to GluCl DNA even in
the presence of DNA oligonucleotides with mismatches under appropriate
conditions. Under alternate conditions, the mismatched DNA
oligonucleotides may still hybridize to the GluCl DNA to permit
identification and isolation of GluCi encoding DNA.
DNA encoding GluCl from a particular organism may be
used to isolate and purify homologues of GluCl from other organisms.
To accomplish this, the first GluCl DNA may be mixed with a sample
containing DNA encoding homologues of GluCl under appropriate
hybridization conditions. The hybridized DNA complex may be isolated
and the DNA encoding the homologous DNA may be purified therefrom.
It is known that there is a substantial amount of redundancy
in the various codons which code for specific amino acids. Therefore,
this invention is also directed to those DNA sequences which contain
alternative codons which code for the eventual translation of the identical
amino acid. For purposes of this specification, a sequence bearing one or
more replaced codons will be defined as a degenerate variation. Also
included within the scope of this invention are mutations either in the
DNA sequence or the translated protein which do not substantially alter
the ultimate physical properties of the expressed protein. For example,
substitution of valine for leucine, arginine for lysine, or asparagine for
glutamine may not cause a change in functionality of the polypeptide.
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-11-
It is known that DNA sequences coding for a peptide may be
altered so as to code for a peptide having properties that are different than
those of the naturally-occurring peptide. Methods of altering the DNA
sequences include, but are not limited to site directed mutagenesis.
Examples of altered properties include but are not limited to changes in
the affinity of an enzyme for a substrate or a receptor for a ligand.
As used herein, a "functional derivative" of GluCl is a
compound that possesses a biological activity (either functional or
structural) that is substantially similar to the biological activity of GluCl.
The term "functional derivatives" is intended to include the "fragments,"
"variants," "degenerate variants," "analogs" and "homologues" or to
"chemical derivatives" of G1uCl. The term "fragment" is meant to refer
to any polypeptide subset of GluCl. The term "variant" is meant to refer
to a molecule substantially similar in structure and function to either the
entire GluCl molecule or to a fragment thereof. A molecule is
"substantially similar" to GluCl if both molecules have substantially
similar structures or if both molecules possess similar biological activity.
Therefore, if the two molecules possess substantially similar activity, they
are considered to be variants even if the structure of one of the molecules
is not found in the other or even if the two amino acid sequences are not
identical. The term "analog" refers to a molecule substantially similar in
function to either the entire GluCl molecule or to a fragment thereof.
Following expression of GluCl in a recombinant host cell,
GluCl protein may be recovered to provide GluCl in active form. Several
GluC1 purification procedures are available and suitable for use. As
described above for purification of GluCl from natural sources,
recombinant GluCl may be purified from cell lysates and extracts, or
from conditioned culture medium, by various combinations of, or
individual application of salt fractionation, ion exchange
chromatography, size exclusion chromatography, hydroxylapatite
adsorption chromatography and hydrophobic interaction chromatography.
In addition, recombinant GluCl can be separated from other
cellular proteins by use of an immunoaffinity column made with
CA 02220116 1997-11-03
WO 96/34940 PCTIUS96/06035
-12-
monoclonal or polyclonal antibodies specific for full length nascent
GluCl, polypeptide fragments of G1uC1 or GIuC1 proteins.
Monospecific antibodies to GIuCI are purified from
mammalian antisera containing antibodies reactive against GluCl or are
prepared as monoclonal antibodies reactive with GluCl using the
technique of Kohler and Milstein, Nature 256: 495-497 (1975).
Monospecific antibody as used herein is defined as a single antibody
species or multiple antibody species with homogenous binding
characteristics for GIuC1. Homogenous binding as used herein refers to
the ability of the antibody species to bind to a specific antigen or epitope,
such as those associated with the GIuCI, as described above. GIuCl
specific antibodies are raised by immunizing animals such as mice, rats,
guinea pigs, rabbits, goats, horses and the like, with rabbits being
preferred, with an appropriate concentration of G1uCI either with or
without an immune adjuvant.
Preimmune serum is collected prior to the first
immunization. Each animal receives between about 0.1 mg and about
1000 mg of GIuC1 associated with an acceptable immune adjuvant. Such
acceptable adjuvants include, but are not limited to, Freund's complete,
Freund's incomplete, alum-precipitate, water in oil emulsion containing
Corynehacterium parvum and tRNA. The initial immunization consists
of GluCl in, preferably, Freund's complete adjuvant at multiple sites
either subcutaneously (SC), intraperitoneally (IP) or both. Each animal is
bled at regular intervals, preferably weekly, to determine antibody titer.
The animals may or may not receive booster injections following the
initial immunizaiton. Those animals receiving booster injections are
generally given an equal amount of the antigen in Freund's incomplete
adjuvant by the same route. Booster injections are given at about three
week intervals until maximal titers are obtained. At about 7 days after
each booster immunization or about weekly after a single immunization,
the animals are bled, the serum collected, and aliquots are stored at about
-20 C.
Monoclonal antibodies (mAb) reactive with GluCl are
prepared by immunizing inbred mice, preferably Balb/c, with GluC1. The
CA 02220116 1997-11-03
WO 96134940 PCT/U596/06035
-13-
mice are immunized by the IP or SC route with about 0.1 mg to about 10
mg, preferably about 1 mg, of GluCl in about 0.5 ml buffer or saline
incorporated in an equal volume of an acceptable adjuvant, as discussed
above. Freund's complete adjuvant is preferred. The mice receive an
initial immunization on day 0 and are rested for about 3 to about 30
weeks. Immunized mice are given one or more booster immunizations of
about 0.1 to about 10 mg of GluCl in a buffer solution such as phosphate
buffered saline by the intravenous (IV) route. Lymphocytes, from
antibody positive mice, preferably splenic lymphocytes, are obtained by
removing spleens from immunized mice by standard procedures known
in the art. Hybridoma cells are produced by mixing the splenic
lymphocytes with an appropriate fusion partner, preferably myeloma
cells, under conditions which will allow the formation of stable
hybridomas. Fusion partners may include, but are not limited to: mouse
myelomas P3/NS 1/Ag 4-1; MPC-11; S-194 and Sp 2/0, with Sp 2/0 being
preferred. The antibody producing cells and myeloma cells are fused in
polyethylene glycol, about 1000 mol. wt., at concentrations from about
30% to about 50%. Fused hybridoma cells are selected by growth in
hypoxanthine, thymidine and aminopterin supplemented Dulbecco's
Modified Eagles Medium (DMEM) by procedures known in the art.
Supernatant fluids are collected from growth positive wells on about days
14, 18, and 21 and are screened for antibody production by an
immunoassay such as solid phase immunoradioassay (SPIRA) using
GluCl as the antigen. The culture fluids are also tested in the
Ouchterlony precipitation assay to determine the isotype of the mAb.
Hybridoma cells from antibody positive wells are cloned by a technique
such as the soft agar technique of MacPherson, Soft Agar Techniques, in
Tissue Culture Methods and Applications, Kruse and Paterson, Eds.,
Academic Press, 1973.
Monoclonal antibodies are produced in vivo by injection of
pristane primed Balb/c mice, approximately 0.5 ml per mouse, with about
2 x 10(5 to about 6 x 106 hybridoma cells about 4 days after priming.
Ascites fluid is collected at approximately 8-12 days after cell transfer
CA 02220116 1997-11-03
WO 96/34940 PCTIUS96/06035
-14-
and the monoclonal antibodies are purified by techniques known in the
art.
In vitro production of anti-GluCl mAb is carried out by
growing the hydridoma in DMEM containing about 2% fetal calf serum
to obtain sufficient quantities of the specific mAb. The mAb are purified
by techniques known in the art.
Antibody titers of ascites or hybridoma culture fluids are
determined by various serological or immunological assays which
include, but are not limited to, precipitation, passive agglutination,
enzyme-linked immunosorbent antibody (ELISA) technique and
radioimmunoassay (RIA) techniques. Similar assays are used to detect
the presence of GluCl in body fluids or tissue and cell extracts.
It is readily apparent to those skilled in the art that the above
described methods for producing monospecific antibodies may be utilized
to produce antibodies specific for GluCl polypeptide fragments, or full -
length nascent G1uC1 polypeptide. Specifically, it is readily apparent to
those skilled in the art that monospecific antibodies may be generated
which are specific for only one GluCl protein or the fully functional
glutamate-, Compound-1 and avermectin-sensitive chloride channel.
GluCl antibody affinity columns are made by adding the
antibodies to Affigel-10 (Biorad), a gel support which is activated with
N-hydroxysuccinimide esters such that the antibodies form covalent
linkages with the agarose gel bead support. The antibodies are then
coupled to the gel via amide bonds with the spacer arm. The remaining
activated esters are then quenched with 1 M ethanolamine HC I (pH 8).
The column is washed with water followed by 0.23 M glycine HC I (pH
2.6) to remove any non-conjugated antibody or extraneous protein. The
column is then equilibrated in phosphate buffered saline (pH 7.3) and the
cell culture supernatants or cell extracts containing G1uC1 or GluCl
protein fragments are slowly passed through the column. The column is
then washed with phosphate buffered saline until the optical density
(A 280) falls to background, then the protein is eluted with 0.23 M
glycine-HC1 (pH 2.6). The purified GluCl protein is then dialyzed
against phosphate buffered saline.
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-15-
DNA clones, termed pGluCl, are identified which encode
proteins that, when expressed in Xenopus oocytes as homomeric
channels, or as heteromeric channels with other members of the G1uC1
family, are directly activated with glutamate, or avermectin. Glutarnate-
gated chloride channels have only been reported in invertebrates and are
found on insect muscle and neuronal somata, crustacean muscle, and
express in oocytes from insect muscle poly (A)+ RNA [Lingle, C. &
Marder, E. Brain Res. 212, 481-488 (1981)], [Horseman, B.G., Seymour,
C., Bermudez, I. & Beadle, D.J. Neurosci. Lett. 85, 65-70 (1988)],
[Wafford, K.A., & Sattelle, D.B. J. Exp. Biol. 144, 449-462 (1989)], [Lea,
T.J. & Usherwood, P.N.R. Comp. Gen. Pharmacol. 4, 333-350 (1973)],
[Cull--Candy, S.G. J. Physiol. 255, 449-464 (1976)]. [Fraser, S.P., et al.,
Mol. Brain Res. 8, 331-341 (1990)] and have been cloned from the soil
nematode C. elegans [Cully, D.F., Vassilatis, D.K., Liu, K.K., Paress,
P.S., 'Van der Ploeg, L.H.T., Schaeffer, J.M. & Arena, J.P.]. The
terminology H (hyperpolarization) receptor is used to distinguish
glutarnate-gated chloride channels from the excitatory D (depolarization)
glutarnate receptors of locust muscle [Lea, T.J. & Usherwood, P.N.R..
Comp. Gen. Pharmacol. 4, 333-350 (1973)], [Cull-Candy, S.G. J.
Physiol. 255, 449-464 (1976)]. Similar to oocytes injected with Dros
GluC1. RNA, arthropod H-receptors are characteristically activated with
ibotenate, blocked with low affinity by picrotoxin, and are not activated
with GABA [Lingle, C. & Marder, E. Brain Res. 212, 481-488 (1981)],
[Wafford, K.A. & Sattelle, D.B. J. Exp. Biol. 144, 449-462 (1989)],
[Cull-Candy, S.G. J. Physiol. 255, 449-464 (1976)], [Lea, T.J. &
Usherwood, P.N.R. Comp. Gen. Pharmacol. 4, 351-363 (1973)]. Locust
muscle H-receptors are directly activated with avermectins as are the
glutamate-gated chloride channels expressed from C. elegans poly (A)+
RNA [Scott, R.H. & Duce, I.R. Pestic, Sci. 16, 599-604 (1985); Arena,
J.P., Liu, K.K., Paress, P.S. Schaeffer, J.M. & Cully, D.F. Mol. Brain Res.
15, 339-348 (1992)]. In addition, glutamate-gated chloride channels on
locust neuronal soma are potentiated, and directly activated by
avermectin [Aydar, E., Harding, L., Beadle, D.J. & Bermudez, I.
Proceedings of the British Pharmacological Society p24 (1993)].
CA 02220116 1997-11-03
WO 96/34940 PCTIUS96/06035
-16-
Therefore, Dros GluC1 appears to be related to arthropod H-receptors.
This channel represents the target for avermectins and Compound- I in
Drosophila.
Phylogenetic analyses suggests that Dros GluCl is also
related to the C. elegans GluCla and G1uC11 channels which represent a
unique subclass of ligand-gated chloride channels that may be related to
the glycine a and P, Lym C and Dros rdl proteins. Although these
proteins are phylogenetically related, they respond to different ligands
and are pharmacologically distinct [Schmieden, V., Grenningloh, G.,
1.0 Schofield, P.R. & Betz, H. EMBO Journal 8, 695-700 (1989)], [ffrench-
Constant, R.H., Rocheleau, T.A., Steichen, J.C. & Chalmers, A.E. Nature
363, 449-451 (1993)], [Grenningloh, G., et at., Neuron 4, 963-970
(1990)], [Hutton, M.L, Harvey, R.J. Earley, F.G.P., Barnard, E.A. &
Darlison, M.G. FEBS Letters 326, 112-116 (1993)]. Avermectins have
been reported to interact with other members of the ligand-gated chloride
channel family. In nematodes and insects avermectins block GABA-
sensitive current while in crayfish avermectins directly activate a
multitransmitter-gated chloride channel (glutamate, acetylcholine,
GABA) [Martin, R.J. & Pennington, A.J. Br. J. Pharmacol. 98, 747-756
(1989)], [Zufall, F., Franke, C. & Hatt, H. J. Exp. Biol. 142, 191-205
(1989)], [Holden-Dye, L. & Walker, R.J. Parasitology 101, 265-271
(1990)], [Bermudez, I., Hawkins, C.A., Taylor, A.M. & Beadle, D.J.
Journal of Receptor Research 11, 221-232 (1991). In oocytes expressing
chick brain GABA a receptors avermectins potentiate the GABA response
[Sigel, E. & Baur, R. Mol. Pharmacol. 32, 749-752 (1987)]. In addition,
avermectins inhibit strychnine binding to mammalian glycine receptors
[Graham, D., Pfeiffer, F. & Betz, H. Neurosci. Letters 29, 173-176
(1982)]. However, GIuC1 proteins are the only members of the ligand-
gated chloride channel family that show unique pharmacological
characteristics with respect to glutamate and ibotenate, and therefore
represent a new subclass of the ligand-gated ion channel family.
The present invention is also directed to methods for
screening for compounds which modulate the expression of DNA or
RNA encoding GluCi as well as the function of GluCl protein in vivo.
CA 02220116 1997-11-03
WO 96/34940 PCTIUS96/06035
-17-
Compounds which modulate these activities may be DNA, RNA,
peptides, proteins, or non-proteinaceous organic molecules. Compounds
may modulate by increasing or attenuating the expression of DNA or
RNA encoding G1uC1, or the function of GluCl protein. Compounds that
modulate the expression of DNA or RNA encoding GluCl or the function
of GluCl protein may be detected by a variety of assays. The assay may
be a simple "yes/no" assay to determine whether there is a change in
expression or function. The assay may be made quantitative by
comparing the expression or function of a test sample with the levels of
expression or function in a standard sample. Modulators identified in this
process are useful as therapeutic agents, insecticides and anthelminthics.
Kits containing GluCl DNA, antibodies to G1uCl, or GluCi
protein may be prepared. Such kits are used to detect DNA which
hybridizes to GluCl DNA or to detect the presence of GluCl protein or
peptide fragments in a sample. Such characterization is useful for a
variety of purposes including but not limited to forensic analyses and
epidemiological studies.
The DNA molecules, RNA molecules, recombinant protein
and antibodies of the present invention may be used to screen and
measure levels of GluCl DNA, GluCl RNA or GluCl protein. The
recombinant proteins, DNA molecules, RNA molecules and antibodies
lend themselves to the formulation of kits suitable for the detection and
typing of GluCl. Such a kit would comprise a compartmentalized carrier
suitable to hold in close confinement at least one container. The carrier
would further comprise reagents such as recombinant GluCl protein or
anti-GluCl antibodies suitable for detecting GluCl. The carrier may also
contain a means for detection such as labeled antigen or enzyme
substrates or the like.
Nucleotide sequences that are complementary to the GluCl
encoding DNA sequence can be synthesized for antisense therapy. These
antisense molecules may be DNA, stable derivatives of DNA such as
phosphorothioates or methylphosphonates, RNA, stable derivatives of
RNA such as 2'-O-alkylRNA, or other GluCl antisense oligonucleotide
mimel:ics. GluCl antisense molecules may be introduced into cells by
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-18-
microinjection, liposome encapsulation or by expression from vectors
harboring the antisense sequence. GluCl antisense therapy may be
particularly useful for the treatment of diseases where it is beneficial to
reduce GIuCI activity.
GluCl DNA may be used to introduce GluCl into the cells of
target organisms. The GluCI gene can be ligated into viral vectors which
mediate transfer of the GIuCI DNA by infection of recipient host cells.
Suitable viral vectors include retrovirus, adenovirus, adeno-associated
virus, herpes virus, vaccinia virus, polio virus and the like. Alternatively,
GluCl DNA can be transferred into cells by non-viral techniques
including receptor-mediated targeted DNA transfer using ligand-DNA
conjugates or adenovirus-ligand-DNA conjugates, lipofection membrane
fusion or direct microinjection. These procedures and variations thereof
are suitable for ex vivo as well as in vivo GIuC1 gene therapy. GluCl gene
therapy may be particularly useful where it is beneficial to elevate GluC1
activity.
Pharmaceutically useful compositions comprising GluCl
DNA, GluCI RNA, or GluCl protein, or modulators of GluCl receptor
activity, may be formulated according to known methods such as by the
admixture of a pharmaceutically acceptable carrier. Examples of such
carriers and methods of formulation may be found in Remington's
Pharmaceutical Sciences. To forma pharmaceutically acceptable
composition suitable for effective administration, such compositions will
contain an effective amount of the protein, DNA, RNA, or modulator.
Therapeutic or diagnostic compositions of the invention are
administered to an individual in amounts sufficient to treat or diagnose
disorders in which modulation of GluCl-related activity is indicated. The
effective amount may vary according to a variety of factors such as the
individual's condition, weight, sex and age. Other factors include the
mode of administration. The pharmaceutical compositions may be
provided to the individual by a variety of routes such as subcutaneous,
topical, oral and intramuscular.
The term "chemical derivative" describes a molecule that
contains additional chemical moieties which are not normally a part of
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-19-
the base molecule. Such moieties may improve the solubility, half-life,
absorption, etc. of the base molecule. Alternatively the moieties may
= attenuate undesirable side effects of the base molecule or decrease the
toxicity of the base molecule. Examples of such moieties are described in
a variety of texts, such as Remington's Pharmaceutical Sciences.
Compounds identified according to the methods disclosed
herein may be used alone at appropriate dosages defined by routine
testing in order to obtain optimal inhibition of the G1uC1 receptor or its
activity while minimizing any potential toxicity. In addition, co-
administration or sequential administration of other agents may be
desirable.
The method of the present invention also has the objective of
providing suitable topical, oral, systemic and parenteral pharmaceutical
formulations for use in the novel methods of treatment of the present
invention. The compositions containing compounds identified according
to this, invention as the active ingredient for use in the modulation of
G1uCl receptors can be administered in a wide variety of therapeutic
dosage forms in conventional vehicles for administration. For example,
the compounds can be administered in such oral dosage forms as tablets,
capsules (each including timed release and sustained release
formulations), pills, powders, granules, elixirs, tinctures, solutions,
suspensions, syrups and emulsions, or by injection. Likewise, they may
also be administered in intravenous (both bolus and infusion),
intraperitoneal, subcutaneous, topical with or without occlusion, or
intramuscular form, all using forms well known to those of ordinary skill
in the pharmaceutical arts. An effective but non-toxic amount of the
compound desired can be employed as a G1uC1 modulating agent.
The daily dosage of the products may be varied over a wide
range from 0.001 to 1,000 mg per patient, per day. For oral
administration, the compositions are preferably provided in the form of
scored or unscored tablets containing 0.01, 0.05, 0.1, 0.5, 1.0, 2.5, 5.0,
10.0, 1 5.0, 25.0, and 50.0 milligrams of the active ingredient for the
symptomatic adjustment of the dosage to the patient to be treated. An
effective amount of the drug is ordinarily supplied at a dosage level of
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-20-
from about 0.0001 mg/kg to about 100 mg/kg of body weight per day.
The dosages of the G1uC1 receptor modulators are adjusted when
combined to achieve desired effects. On the other hand, dosages of these
various agents may be independently optimized and combined to achieve
a synergistic result wherein the pathology is reduced more than it would
be if either agent were used alone.
Advantageously, compounds active in the method of the
present invention may be administered in a single daily dose, or the total
daily dosage may be administered in divided doses of two, three or four
times daily. Furthermore, compounds active in the method of the present
invention can be administered in intranasal form via topical use of
suitable intranasal vehicles, or via transdermal routes, using those forms
of transdermal skin patches well known to those of ordinary skill in that
art. To be administered in the form of a transdermal delivery system, the
dosage administration will, of course, be continuous rather than
intermittent throughout the dosage regimen.
For combination treatment with more than one active agent,
where the active agents are in separate dosage formulations, the active
agents can be administered concurrently, or they each can be
administered at separately staggered times.
The dosage regimen utilizing the compounds active in the
method of the present invention is selected in accordance with a variety
of factors including type, species, age, weight, sex and medical condition
of the patient; the severity of the condition to be treated; the route of
administration; the renal and hepatic function of the patient; and the
particular compound thereof employed. A physician or veterinarian of
ordinary skill can readily determine and prescribe the effective amount of
the drug required to prevent, counter or arrest the progress of the
condition. Optimal precision in achieving concentrations of drug within
the range that yields efficacy without toxicity requires a regimen based on
the kinetics of the drug's availability to target sites. This involves a
consideration of the distribution, equilibrium, and elimination of a drug.
In the methods of the present invention, the compounds
active therein can form the active ingredient, and are typically
CA 02220116 1997-11-03
WO 96/34940 PCT/U3'96/06035
-21-
administered in admixture with suitable pharmaceutical diluents,
excipients or carriers (collectively referred to herein as "carrier"
materials) suitably selected with respect to the intended form of
administration, that is, oral tablets, capsules, elixirs, syrups and the like,
and consistent with conventional pharmaceutical practices.
For instance, for oral administration in the form of a tablet or
capsule, the active drug component can be combined with an oral, non-
toxic pharmaceutically acceptable inert carrier such as ethanol, glycerol,
water and the like. Moreover, when desired or necessary, suitable
binders, lubricants, disintegrating agents and coloring agents can also be
incorporated into the mixture. Suitable binders include, without
limitation, starch, gelatin, natural sugars such as glucose or beta-lactose,
corn sweeteners, natural and synthetic gums such as acacia, tragacarith or
sodium alginate, carboxymethylcellulose, polyethylene glycol, waxes and
the like. Lubricants used in these dosage forms include, without
limitation, sodium oleate, sodium stearate, magnesium stearate, sodium
benzoate, sodium acetate, sodium chloride and the like. Disintegrators
include, without limitation, starch, methyl cellulose, agar, bentonite,
xanth.an gum and the like.
For liquid forms the active drug component can be combined
in suitably flavored suspending or dispersing agents such as the synthetic
and natural gums, for example, tragacanth, acacia, methyl-cellulose and
the like. Other dispersing agents which may be employed include
glycerin and the like. For parenteral administration, sterile suspensions
and solutions are desired. Isotonic preparations which generally contain
suitable preservatives are employed when intravenous administration is
desired.
Topical preparations containing the active drug component
can be admixed with a variety of carrier materials well known in the art,
such as, e.g., alcohols, aloe vera gel, allantoin, glycerine, vitamin A and E
oils, mineral oil, PPG2 myristyl propionate, and the like, to form, e.g.,
alcoholic solutions, topical cleansers, cleansing creams, skin gels, skin
lotions, and shampoos in cream or gel formulations.
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-22-
The compounds active in the method of the present invention
can also be administered in the form of liposome delivery systems, such
as small unilamellar vesicles, large unilamellar vesicles and multilamellar
vesicles. Liposomes can be formed from a variety of phospholipids, such
as cholesterol, stearylamine or phosphatidylcholines.
Compounds active in the method of the present invention
may also be delivered by the use of monoclonal antibodies as individual
carriers to which the compound molecules are coupled. The compounds
active in the method of the present invention may also be coupled with
soluble polymers as targetable drug carriers. Such polymers can include
polyvinyl -pyrrolidone, pyran copolymer, polyhydroxy-propylmethacryl -
amidephenol, polyhydroxy-ethylaspartamidephenol, or polyethyl-
eneoxidepolylysine substituted with palmitoyl residues. Furthermore, the
compounds active in the method of the present invention may be coupled
to a class of biodegradable polymers useful in achieving controlled
release of a drug, for example, polylactic acid, polyepsilon caprolactone,
polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydro-
pyrans, polycyanoacrylates and cross-linked or amphipathic block
copolymers of hydrogels.
The compounds that are active in the methods of the present
invention are useful as antiparastic agents against endo and ecto parasites,
particularly helminths and arthropods, which cause numerous parasitic
diseases in humans, animals, and plants.
Parasitic diseases may be caused by either endoparasites or
ectoparasites. Endoparasites are those parasites which live inside the
body of the host, either within an organ (such as the stomach, lungs,
heart, intestines, etc.) or simply under the skin. Ectoparasites are those
parasites which live on the outer surface of the host but still draw
nutrients from the host.
The endoparasitic diseases generally referred to as
helminthiasis are due to infection of the host with parasitic worms known
as helminths. Helminthiasis is a prevalent and serious worldwide
economic problem due to infection of domesticated animals such as
swine, sheep, horses, cattle, goats, dogs, cats, and poultry. Many of these
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-23-
infect-ions are caused by the group of worms described as nematodes
which cause diseases in various species of animals throughout the world.
These diseases are frequently serious and can result in the death of the
infected animal. The most common genera of nematodes infecting the
animals referred to above are Haemonchus, Trichostrongylus, Ostertagia,
Nematodirus, Cooperia, Ascaris, Bunostomum, Oesophagostomum,
Chabertia, Trichuris, Strongylus, Trichonema, Dictyocaulus, Capillaria,
Heterakis, Toxocara, Ascaridia, Oxyuris, Ancylostoma, Uncinaria,
Toxascaris, and Parascaris. Many parasites are species specific (infect
only one host) and most also have a preferred site of infection within the
animal. Thus Haemonchus and Ostertagia primarily infect the stomach
while Nematodirus and Cooperia mostly attack the intestines. Other
parasites prefer to reside in the heart, eyes, lungs, blood vessels, and the
like while still others are subcutaneous parasites. Helminthiasis can lead
to weakness, weight loss, anemia, intestinal damage, malnutrition, and
damage to other organs. If left untreated these diseases can result in the
death of the animal.
Diseases caused by ectoparasitic arthropods such as ticks,
mites, lice, stable flies, hornflies, blowflies, fleas, and other biting
insects
such as Tenophalides, Ixodes, Psoroptes, Lucilia, and Hemotobia, are also
a serious problem. Infection and infestation by these parasites results in
loss of blood, skin lesions, and can interfere with normal eating habits
thus causing weight loss. These infections can also result in transmission
of serious diseases such as encephalitis, anaplasmosis, swine pox, and the
like which can be fatal. The compounds that are active in the method
disclosed herein are useful for the prevention and treatment of these
infections and infestations.
Animals may be infected by several species of parasite at the
same time since infection by one parasite may weaken the animal and
make it more susceptible to infection by a second species of parasite.
Thus a compound with a broad spectrum of activity is particularly
= advantageous in the treatment of these diseases. The compounds of this
invention have activity against these parasites, and in addition are also
active against Dirojilaria in dogs, Nematospiroides and Syphacia in
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-24-
rodents, biting insects, and migrating diperous larvae such as Hypoderma
sp. in cattle, and Gastrophilus in horses.
The compounds active in the method disclosed herein are
also useful against endo and ecto parasites which cause parasitic diseases
in humans. Examples of such endoparasites which infect man include
gastro-intestinal parasites of the genera Ancylostoma, Necator, Ascaris,
Strongyloides, Trichinella, Capillaria, Trichuris, Enterobius, and the like.
Other endoparasites which infect man are found in the blood or in other
organs. Examples of such parasites are the filarial worms Wucheria,
Brugia, Onchocerca, and the like as well as extra-intestinal stages of the
intestinal worms Strongylides and Trichinella. Ectoparasites which
parasitize man include arthropods such as ticks, fleas, mites, lice, and the
like and, as with domestic animals, infections by these parasites can result
in transmission of serious and even fatal diseases. The active compounds
are active against these endo and ecto parasites and in addition are also
active against biting insects and other dipterous pests which annoy
humans.
The compounds active in the method disclosed herein are
also useful against common household pests such as Blatella sp.
(cockroach), Tineola sp. (clothes moth), Attagenus sp. (carpet beetle),
Musca domestica (housefly) and against Solenopsis Invicta (imported fire
ant).
The compounds active in the method disclosed herein are
furthermore useful against agricultural pests such as aphids
(Acyrthiosiphon sp.), locusts, spider mites, and boll weevils as well as
against insect pests which attack stored grains such as Tribolium sp. and
Tenebrio sp., and against immature stages of insects living on plant
tissue. The compounds are also useful as a nematodicide for the control
of soil nematodes and plant parasites such as Meloidogyne sp., which
may be agriculturally important.
For use as an antiparasitic agent in animals the compounds
may be administered internally either orally, or by injection, or topically
as a liquid drench or as a shampoo.
CA 02220116 1997-11-03
WO 96/34940 PCT/US96106035
-25-
For oral administration, the compounds active in the method
disclosed herein may be administered in capsule, tablet, or bolus form or
alternatively they can be mixed in the animals feed. The capsules,
tablets, and boluses are comprised of the active ingredient in combination
with an appropriate carrier vehicle such as starch, talc, magnesium
stearate, or di-calcium phosphate. These unit dosage forms are prepared
by intimately mixing the active ingredient with suitable finely-powdered
inert ingredients including diluents, fillers, disintegrating agents, and/or
binders such that a uniform mixture is obtained. An inert ingredient is
one that will not react with the compounds and which is non-toxic to the
animal being treated. Suitable inert ingredients include starch, lactose,
talc, magnesium stearate, vegetable gums and oils, and the like. These
formulations may contain a widely variable amount of the active and
inactive ingredients depending on numerous factors such as the size and
type of the animal species to be treated and the type and severity of the
infection. The active ingredient may also be administered as an additive
to the feed by simply mixing the compound with the feedstuff or by
applying the compound to the surface of the feed. Alternatively the
active ingredient may be mixed with an inert carrier and the resulting,
composition may then either be mixed with the feed or fed directly to the
animal. Suitable inert carriers include corn meal, citrus meal,
fermentation residues, soya grits, dried grains and the like. The active
ingredients are intimately mixed with these inert carriers by grinding..
stirring, milling, or tumbling such that the final composition contains
from 0.001 to 5% by weight of the active ingredient.
The compounds active in the method disclosed herein may
alternatively be administered parenterally via injection of a formulation
consisting of the active ingredient dissolved in an inert liquid carrier.
Injection may be either intramuscular, intraruminal, intratracheal, or
subcutaneous. The injectable formulation consists of the active
ingredient mixed with an appropriate inert liquid carrier. Acceptable
liquid carriers include the vegetable oils such as peanut oil, cotton seed
oil, sesame oil and the like as well as organic solvents such as solketal,
glycerol formal and the like. As an alternative, aqueous parenteral
CA 02220116 1997-11-03
WO 96/34940 PCTJUS96/06035
-26-
formulations may also be used. The vegetable oils are the preferred
liquid carriers. The formulations are prepared by dissolving or
suspending the active ingredient in the liquid carrier such that the final
formulation contains from 0.005 to 10% by weight of the active
ingredient.
Topical application of the compounds active in the method
disclosed herein is possible through the use of a liquid drench or a
shampoo containing the instant compounds as an aqueous solution,
dispersion or suspension. These formulations generally contain a
suspending agent such as bentonite, a wetting agent or the like excipient,
and normally will also contain an antifoaming agent. Formulations
containing from 0.00 1 to I% by weight of the active ingredient are
acceptable. Preferred formulations are those containing from 0.01 to I%
by weight of the active compounds.
The compounds active in the method disclosed herein are
primarily useful as antiparasitic agents for the treatment and/or
prevention of helminthiasis in domestic animals such as cattle, sheep,
horses, dogs, cats, goats, swine, and poultry. They are also useful in the
prevention and treatment of parasitic infections of these animals by
ectoparasites such as ticks, mites, lice, fleas and the like. They are also
effective in the treatment of parasitic infections of humans. In treating
such infections the compounds may be used individually or in
combination with each other or with other unrelated antiparasitic agents.
The dosage of the compounds required for best results depends on several
factors such as the species and size of the animal, the type and severity of
the infection, the method of administration and the compound used. Oral
administration of the compounds at a dose level of from 0.0005 to 10 mg
per kg of animal body weight, either in a single dose or in several doses
spaced a few days apart, generally gives good results. A single dose of
one of the compounds normally gives excellent control however repeat
doses may be given to combat re-infection or for parasite species which
are unusually persistent. The techniques for administering these
compounds to animals are known to those skilled in the veterinary field.
CA 02220116 1997-11-03
WO 96/34940 PCT/US,96/06035
-27-
The compounds active in the method disclosed herein may
also be used to combat agricultural pests which attack crops either in the
= field or in storage. The compounds are applied for such uses as sprays,
dusts,, emulsions and the like either to the growing plants or the harvested
crops. The techniques for applying these compounds in this manner are
known to those skilled in the agricultural arts.
The following examples illustrate the present invention
without, however, limiting the same thereto.
EXAMPLE 1
Drosophila RNA isolation
Poly(A)+ RNA was prepared from heads of the Oregon R
strain of Drosophila melanogaster. The heads were rapidly frozen in
liquid N2 and ground with a mortar and pestle while submerged in liquid
N2. The frozen, powdered Drosophila tissue was added to a solution
containing 4M guanidinium thiocyanate, 5mM sodium citrate pH 7.0, and
0.1 M (3-mercaptoethanol (1 gm tissue/10 ml solution), and was mixed
with a. polytron homogenizer. After 1 minute of homogenization, 0.5%
sodium sarkosyl was added and mixed well and the solution was
centrifuged at 10,000 rpm for 10 minutes. The supernatant was layered
over a. 5.7 M CsCI cushion and centrifuged for 18 hours at 33,000 rpm.-n.
The RNA pellet was washed with 70% ethanol, resuspended in H2O and
extracted with chloroform:isobutanol, 4:1 and precipitated with ethanol.
Poly (A)+ RNA was isolated by two rounds of purification on oligo (dT)-
cellulose columns.
EXAMPLE 2
= 30
Cloning and characterization of the Drosophila GluCl PCR product
DNA oligonucleotide primers
5'TGGGT(AGCT) (TA) (CG)(AGCT)TT(CT)TGGTT-3'
[SEQ. ID. No.: 1] (Primer 1) and
5'GC(TGCA)CC(TGA)ATCCA(TGCA)AC(GA)TC(TGA)AT-3'
CA 02220116 2006-05-29
WO 96/34940 PCT/US96/06035
-28-
[SEQ. ID., No.: 2] (Primer 2) were used in a low stringency PCR reaction
to amplify a Drosophila G1uC1 gene sequence. These oligonucleotides
encode the amino acid sequences which are present in the M 1 and M3
domains of the C. elegans GluCla gene (Cully et al., supra). Drosophila
poly (A)+ RNA (1 ug in 17 l H2O) was heated at 65 C 3 min. and placed
on ice. The following reagents were added on ice: 3 l of RNasin
(40 u/ 1), 8 l of 5x RT buffer (250 mM Tris-HC1 pH 8.3, 375 mM KC1,
MM MgC12, BRL), 4 l of 0.1 M DTT, 4 l of 20 mM dNTPs, 2 l of
M Primer 2 oligonucleotide and 0.5 l of 200 units/ l of Moloney
10 Murine Leukemia virus reverse transcriptase. The reaction was incubated
for 90 minutes at 42 C, and the reaction was stopped by heating at 65 C
for 10 min. The first strand cDNA that resulted was used in a polymerase
chain reaction as follows: 3 .tl of cDNA was incubated in a 50 l
reaction with 2.5 units of AmpliTaq DNA polymerase (Perkin Elmer
15 Cetus) in Taq reaction buffer (1.5 MM MgC12, 50 mM KCI, lOmM
TrisHCl pH 8.3, 400 M dNTPs) with 1.2 M of each primer (DNA
sequences 1 and 2) and 20 pCi of 32P-dCTP. The reaction was incubated
in a Perkin Elmer Cetus thermocycler programmed for 25 cycles at 94
(1') 37 (2') 72 (3'). The reaction was mixed with 1 g of tRNA, 1/10
20 volume 3M sodium acetate, and 2 volumes of 100% ethanol, incubated at
-20 C 16 hrs, centrifuged 30 min at 11,000 x g, and washed with 70%
ethanol. The pellet was dried and resuspended in 3 l H2O and 3 l of
stop solution (95% formamide, 20 mM EDTA, 0.05% Bromophenol
Blue, 0.05% Xylele Cyanol FF), heated at 70 C 2', and electrophoresed
on a 6% acrylamide-urea sequencing gel (Maniatis) until the Xylene
Cyanol marker was at the bottom of the gel (40 cm). A control DNA was
sequenced (USB SequenaseTM Version 2.0 DNA sequencing kit) and ran
on the gel as size markers. The gel was removed and soaked for 15 min.
in 10% methanol; 7% acetic acid, transferred to Whatman 3mm filter
paper, dried, and exposed to X-ray film. The gel corresponding to the
region of 152 bases was cut out and soaked in 400 l H2O for 2 hrs at
22 C. The eluted DNA (30 l) was used as a template in a 100 l PCR
reaction mix containing Taq reaction buffer, 1.0 M of each primer (DNA
sequence 1 and 2) and 5 units of Taq polymerase. The thermocycler
program was as above. A 30 l aliquot of this PCR reaction was used as
CA 02220116 2006-05-29
WO 96/34940 PCT/US96/06035
-29-
a template for a second identical PCR reaction.
The, 152 bp PCR-amplified DNA fragment was precipitated
from the reaction mixture with 1/10 volume 3M sodium acetate and 2
volumes 100% ethanol at -20 C for 16 hrs., centrifuged 30 min at 11,000
x g, and washed with 70% ethanol. The pellet was dried and resuspended
in 10 l TE (Tris-HC1 pH 8.0; 1mMEDTA) and electrophoresed on a 4%
NuSieve TAE (40mMTris-HCI pH 8.0; 20mM sodium acetate;
2mMEDTA) agarose gel (FMC BioProducts). The DNA fragment was
excised from the gel and purified using a QIAEX gel extraction kit
(Qiagen, Inc.). The purified DNA fragment was ligated into the pCR
vector using the TA Cloning System (Invitogen Corp.). The ligated DNA
was precipitated with 1/10 volume of 3M sodium acetate and 2 volumes
of 100% ethanol and incubated at -20 C, centrifuged, washed and
resuspended in 2 l water as described above. A 1 gl aliquot of DNA
was transformed into 40 gl INVaF' electro-competent cells (Invitrogen
Corp) by electroporation using a Gene-Pulser (BioRad) at 2.5KV, 25 F
capacitance, and 200ohms resistance, after which 1 ml of SOC medium
(Sambrook, J., Fritsch, E.F., Maniatis, T. in Molecular Cloning: A
Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory
Press, Cold Spring Harbor, NY. 1989) was added and the cells were
incubated for 1 hr at 37 C. The transformed cells were plated on LB agar
plates containing 50 g/ml ampicillin and 40 g/ml X-gal (5-bromo-4-
chloro-3-indolyl-(3-D-galactoside) and incubated 18 hrs. at 37 C. White
colonies were picked and ten of these, each containing a vector with an
insert of approximately 152 base pairs, were sequenced using a USB
Sequenase Version 2.0 DNA sequencing kit. Clone pPCR-2 was chosen
as a probe to identify a full length cDNA clone. The DNA sequence of
pPCR-2 is SEQ. ID. No.: 4, which codes for a peptide of predicted amino
acid sequence:
WVTFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPP
VSYTKAIDVWIG. [SEQ. ID. No.: 3]
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-30-
EXAMPLE 3
Isolation and identification of the Dros G1uCl cDNA
A cDNA library was made from heads of the Oregon R
strain of Drosophila in the phagemid cloning vector (Stratagene). This
library was transfected into E. soli BB4 cells, plated on NZY medium
(Sambrook, J., Fritsch, E.F., Maniatis, T. in Molecular Cloning: A
Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory
Press, Cold Spring Harbor, NY. 1989.), and incubated 18 hrs. at 37 C.
The resultant plaques were transferred to Durulose membranes
(Stratagene). The membranes were prehybridized in prehybridization
solution (50% formamide; 2x Denhardts reagent; 5x SSPE; 0.1 % SDS;
100 g/ml single stranded herring sperm DNA) for 16 hrs. at 42 C, and
hybridized for 65 hrs. at 42 C in 50 ml hybridization solution
(prehybridization solution containing 10% dextran sulfate) containing
2x 107 cpm of the EcoRI insert fragment of Clone pPCR-2 which was
labeled with 32P-dCTP by random priming using a Random Primed DNA
Labeling Kit (Boehringer Mannheim). The membranes were exposed to
X-ray film. Thirty-six positive phage clones were identified and were
converted into plasmids by in vivo excision as per the Stratagene
protocol. One clone, pDros G1uCl was found to contain an insert of 3958
bases. The sequence of Dros GluCl cDNA is shown in Figure 1.
EXAMPLE 4
Primary Structure of the Dros GluCl Channel
The nucleotide sequence of pDros G1uC1 revealed a single
large open reading frame of about 1518 base pairs. The cDNA has a 5'
untranslated extension of about 254 nucleotides and a 3' untranslated
region of about 2186 nucleotides. The first in-frame methionine (base
405) was designated as the initiation codon for the open reading frame
that ends at the stop codon TAA (base 1773). The predicted GluCl
protein (Figure 2) has an estimated molecular mass (Mr) of about 52,344
daltons. The protein contains hydrophobic amino-terminal residues with
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-31-
sequences highly predictive of signal cleavage sites that would result in a
mature protein initiating at about amino acid 23.
The predicted Dros GluCl protein was aligned with
nucleotide and protein databases and found to be related to the C. elegans
GluCla, GluCl(3, and to the glycine and GABAA receptors. The
conserved motifs found in this family of channels, such as a large N142-
terminal extracellular domain and the four hydrophobic transmembrane
domains M1 through M4, were also found in the Dros G1uC1 sequences.
The Dros GluCl protein contained the conserved cysteine residues found
in the extracellular domain of all ligand-gated chloride channels. Two
additional cysteine residues (amino acids 356 and 367) were present that
are also found in glycine-gated chloride channels and the G1uCla and
GluCl(3 of C. elegans. The Dros GluCl protein contained two strong
consensus sequences for protein kinase C phosphorylation sites located
between the putative membrane spanning domains M3 and M4. In
GABAA receptor proteins, similar phosphorylation sites are located in
the intracellular domain between M3 and M4 and are believed to play a
role in channel regulation [Leidenheimer, N.J., McQuilkin, S.J., Hahner,
L.D., Whiting, P. & Harris, R.A. Mol. Pharm. 41, 1116-1123 (1992),
[Kellenberger, S., Malherbe, P. & Sigel, E. J. Biol. Chem. 267, 24660-
25663 (1992)]. As found in GABAA and glycine receptor sequences, the
G1uC1 protein contained putative N-linked glycosylation sites in the
proposed extracellular domain.
A phylogenetic analysis was performed with the entire Dros
G1uC1 protein sequence, the C. elegans GluCla and GluCl(3 proteins the
GABA A and glycine receptor proteins, and related invertebrate protein
sequences (Figure 5). A discrete evolutionary division in this family of
proteins was shown by a divergence into two major branches resulting in
the division of the GABAA a and yproteins from the remaining proteins.
Within these major branches are subbranches that group the proteins into
the respective subclasses, such as the GABAA a, (3, y, 8, p, and glycine a
and P.
Although the Dros GluCl protein is phylogenetically related
to the C. elegans GluCla and GluClf3, glycine a and P, Lym ~ and Dros
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-32-
rdl proteins, they are pharmacologically distinct and group with the
G1uC1 proteins. Expression studies in Xenopus oocytes show that
functional homomeric chloride channels are formed by the glycine a
proteins that are sensitive to glycine [Schmieden, V., Grenningloh, G.,
Schofield, P.R. & Betz, H. EMBO Journal 8, 695-700 (1989)] and the
Dros rdl protein that is sensitive to GABA [ffrench-Constant, R.H.,
Rocheleau, T.A., Steichen, J.C. & Chalmers, A.E. Nature 363, 449-451
(1993)]. Homomeric glycine 03 channels are formed at very low
efficiency [Grenningloh, G., et al., Neuron 4, 963-970 (1990)], and the
Lym ~ protein does not form functional homomeric channels [Hutton,
M.L., Harvey, R.J., Earley, F.G.P., Barnard, E.A. & Darlison, M.G. FEBS
letters 326, 112-116 (1993)].
EXAMPLE 5
Expression of the Dros GluCl protein in Xenopus ooc es
Clone pDros GluCl was linearized by digestion with the
restriction endonuclease Sall. In vitro RNA was synthesized from 0.5 g
of this plasmid in a reaction containing 40 mM Tris-HCI, pH 7.5; 6 mM
MgCl 2; 2 mM Spermidine; 10 mM NaCl; 10 mM DTT; 0.05 mg/ml
Bovine Serum Albumin; 2 units/ul RNasin; 800 tM each ATP, CTP, and
UTP; 200 MGTP; 800 p.M m7G(5')ppp(5')G; 5 pCi 32P-CTP; and 50
units T3 RNA polymerase in a final volume of 50 l. The reaction was
incubated for 3 hours at 37 C followed by an additional 15 minutes
incubation with 20 units RNase free DNase and extraction with phenol,
phenol:chloroform, and chloroform. The RNA was precipitated with
1/10 volume 3M sodium acetate and 2.5 volumes 100% ethanol, stored at
-20 C for 16 hours, washed with 70% ethanol and resuspended in water
at a concentration of I mg/ml for injection into Xenopus laevis oocytes.
Xenopus laevis oocytes were prepared and injected using
standard methods previously described and known in the art [Arena, J.P.,
Liu, K.K., Paress, P.S. & Cully, D.F. Mol. Pharmacol. 40, 368-374
(1991); Arena, J.P., Liu, K.K., Paress, P.S., Schaeffer, J.M. & Cully, D.F.
Mol. Brain Res. 15, 339-348 (1992)]. Adult female Xenopus laevis were
CA 02220116 1997-11-03
WO 961.54940 PCT/Ua96/06035
-33-
anesthetized with 0.17% tricaine methanesulfonate and the ovaries were
surgically removed and placed in a dish consisting of (mM): NaCl 82.5,
KCl 2, MgCl2 1, CaC12 1.8, HEPES 5 adjusted to pH 7.5 with NaOH
(OR-2). Ovarian lobes were broken open, rinsed several times, and
gently shaken in OR-2 containing 0.2% collagenase (Sigma, Type 1 A) for
2-5 hours. When approximately 50% of the follicular layers were
removed, Stage V and VI oocytes were selected and placed in media.
consisting of (mM): NaCl 86, KCI 2, MgCl2 1, CaC12 1.8, HEPES 5, Na
pyruv ate 2.5, theophylline 0.5, gentamicin 0.1 adjusted to pH 7.5 with
NaOH (ND-96) for 24-48 hours before injection. Oocytes were injected
with 50 nl of Dros G1uC1 RNA (0.01-1 mg/ml). Control oocytes were
injected with 50 nl of water. Oocytes were incubated for 2-10 days in
ND-96 before recording. Incubations and collagenase digestion were
carried out at 18 C.
Recordings were made at room temperature in standard frog
saline consisting of (mM): NaCl 115, KCl 2, MgCl2 1, CaC12 1.8,
HEPES 10, adjusted to pH 7.5 with NaOH. Oocytes were voltage-
clamped using a standard two microelectrode amplifier (Dagan 8500 or
TEV-200, Minneapolis, MN). Pipettes were filled with 3 M KCI and had
resistances between 0.5-3.0 megaohms. A plexiglass recording chamber
(volume 200 l) was constantly perfused at a rate of 10 ml/min. The
recording chamber was connected to ground with a Ag/AgCI electrode.
Data were acquired and analyzed using PCLAMP with a TL-1 interface
(Axon. Instruments, Foster City, CA). Membrane current at a holding
potential of -80 mV was recorded. The amplitude of drug-sensitive
current was determined by subtracting the holding current at -80 mV
from from the peak current obtained in the presence of drug. Data were
filtered at 30 Hz and sampled at 16.6 Hz. Current/voltage relationships
(I/V) and reversal potentials (Erev) were determined using a 1-3 sec
voltage ramp over the voltage range of -110 to +80 mV. For the ramps,
data were filtered at 0.3-3 kHz and sampled at 160 Hz. Current in drug
free solution was subtracted from current in the presence of drug to obtain
drug-sensitive current/voltage relationships.
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-34 -
Oocytes expressing Dros G1uC1 protein exhibited a rapidly
activating and rapidly desensitizing glutamate-sensitive current (Figure
4). The EC50 for glutamate was 30 g M with a Hill coefficient of 1.3.
The rate of densensitization was dependent on the concentration of
glutamate becoming faster at higher glutamate concentrations.
IVMPO4 also directly activated current in oocytes
expressing Dros G1uC1 (Figure 3). Activation of current with NMPO4
was irreversible for up to 10 minutes after washing IVMPO4 from the
bath. Current was maximally activated with 1 tM IVMPO4, and 10 nM
activated 20-40% of maximal current.
The insecticide Compound-1 (Figure 4) as fully described in
U.S. Patent 5,399,582 also directly activated membrane current (Figure
3). Current elicited with Compound-1 was slowly reversible, taking up to
10 minutes to fully return to baseline.
Dros GIuCI was also reversibly activated with the glutamate
analog ibotenate (maximal activation with 100 M), and with the related
amino acid aspartate (8% of maximal activation with 1 mM). Oocytes
injected with Dros GluCl RNA were insensitive to GABA, glycine,
kainate, histamine, and N-methyl-D-aspartic acid tested at concentrations
of I mM or higher. The current elicited with IVMPO4 was blocked
weakly with the ligand-gated chloride channel blocker picrotoxin (13%
block at 500 M).
EXAMPLE 6
Cloning of the Dros G1uC1 cDNA into E. soli Expression Vectors
Recombinant Dros GluCl protein is produced in E. soli
following the transfer of the GIuCI expression cassette into E. soli
expression vectors, including but not limited to, the pET series
(Novagen). The pET vectors place Dros GIuCI expression under control
of the tightly regulated bacteriophage T7 promoter. Following transfer of
this construct into an E. soli host which contains a chromosomal copy of
the T7 RNA polymerase gene driven by the inducible lac promoter,
expression of Dros GluCl is induced when an appropriate lac substrate
CA 02220116 1997-11-03
WO 96134940 PCT/Ua96/06035
- 35 -
(IPTG) is added to the culture. The levels of expressed Dros GluCl are
determined by the assays described above.
The cDNA encoding the entire open reading frame for Dros
G1uC1 is inserted into the NdeI site of pET [16 ) 1 1 a. Constructs in the
positive orientation are identified by sequence analysis and used to
transform the expression host strain BL21. Transformants are then used
to inoculate cultures for the production of Dros G1uCl protein. Cultures
may be grown in M9 or ZB media, whose formulation is known to those
skilled in the art. After growth to an OD600= 1.5, expression of Dros
G1uC1 is induced with 1 mM IPTG for 3 hours at 37 C.
EXAMPLE 7
Expression of Dros GluCl in Mammalian Cell Lines
The Dros G1uC1 cDNA was subcloned into the mammalian
expression vectors pMAMneo and pcDNA3. pMAMneo was digested
with the restriction endonuclease Nhel and treated with Klenow enzyme
to fill in the 5' overhang. The DNA was then digested with Sall to create
a linear vector with one blunt end and one Sall site, and was treated with
calf intestine alkaline phosphatase to prevent self ligation. The vector
was gel purified on a 0.7% agarose gel. pDros G1uC1 was digested with
Smal and Sall to remove the insert from the vector, and then run on a
0.7% agarose gel to purify the insert. The insert containing the cDNA
was ligated to the purified pMAMneo vector and recombinants were
selected and used to transfect mammalian L-cell by CaPO4 precipitation.
pcDNA3 was digested with Notl and treated with Klenow
enzyme to fill in the 5' overhang. The DNA was then digested with
BamHI to create a linear vector with one blunt end and one BamHI site,
and was treated with calf intestine alkaline phosphatase to prevent self
ligation. pDros G1uCl was digested with Sall and treated with Klenow
enzyme to fill in the 5' overhang. The DNA was then digested with
BamHI to create a cDNA fragment with one blunt end and one BamHI
site, compatable with the pcDNA3 vector. Both the vector and the insert
were gel purified on a 0.7% agarose gel and were then ligated together.
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-36-
Recombinants were selected and used to transfect mammalian L-cell by
CaPO4 precipitation.
Stable cell clones were selected by growth in the presence of
G41 8. Single G418 resistant clones were isolated and shown to contain
the intact Dros GluCl gene. Clones containing the Dros GluCl cDNAs
are analyzed for expression using immunological techniques, such as
immuneprecipitation, Western blot, and immunofluorescence using
antibodies specific to the GluCl proteins. Antibody is obtained from
rabbits innoculated with peptides that are synthesized from the amino
acid sequence predicted from the Dros GIuCI sequences. Expression is
also analyzed using patch clamp electrophysiological techniques, an
anion flux assay, and 3H-ivermectin and 3H-glutamate binding assays.
Cells that are expressing Dros G1uC1 stably or transiently,
are used to test for expression of avermectin, glutamate, Compound-1
sensitive chloride channels and for ligand binding activity. These cells
are used to identify and examine other compounds for their ability to
modulate, inhibit or activate the avermectin, glutamate Compound-1
sensitive chloride channel and to compete for binding with radioactive
avermectin, glutamate, Compound-1 derivatives. These cells are used to
identify and examine other compounds which modulate GIuCI activity
with an anion flux assay.
Cassettes containing the Dros GluCl cDNA in the positive
orientation with respect to the promoter are ligated into appropriate
restriction sites 3' of the promoter and identified by restriction site
mapping and/or sequencing. These cDNA expression vectors are
introduced into fibroblastic host cells for example COS-7 (ATCC#
CRL1651), and CV-1 tat [Sackevitz et al., Science 238: 1575 (1987)],
293, L (ATCC# CRL6362)] by standard methods including but not
limited to electroporation, or chemical procedures (cationic liposomes,
DEAE dextran, calcium phosphate). Transfected cells and cell culture
supernatants can be harvested and analyzed for Dros GluCl expression as
described herein.
All of the vectors used for mammalian transient expression
can be used to establish stable cell lines expressing Dros GluC1.
CA 02220116 1997-11-03
WO 96/214940 PCT/US 96/06035
-37-
Unaltered Dros G1uC1 cDNA constructs cloned into expression vectors
are expected to program host cells to make Dros GluCl protein. In
addition, Dros G1uC1 is expressed extracellularly as a secreted protein by
ligating Dros GluCl cDNA constructs to DNA encoding the signal
sequence of a secreted protein. The transfection host cells include, but
are not limited to, CV-1-P [Sackevitz et al., Science 238: 1575 (1987)],
tk-L [Wigler, et al., Cell 11: 223 (1977)], NS/0, and dHFr- CHO
[Kaufman and Sharp, J. Mol. Biol. 159: 601, (1982)].
Co-transfection of any vector containing Dros GluCl cDNA
with a drug selection plasmid including, but not limited to G418,
aminoglycoside phosphotransferase; hygromycin, hygromycin-B
phosphotransferase; APRT, xanthine-guanine phosphoribosyl-transf--rase,
will allow for the selection of stably transfected clones. Levels of Dros
GluCI are quantitated by the assays described herein.
GluCl cDNA constructs are also ligated into vectors
containing amplifiable drug-resistance markers for the production of
mammalian cell clones synthesizing the highest possible levels of Dros
G1uCl. Following introduction of these constructs into cells, clones
containing the plasmid are selected with the appropriate agent, and
isolation of an over-expressing clone with a high copy number of
plasmids is accomplished by selection with increasing doses of the agent.
The expression of recombinant Dros GluCl is achieved by
transfection of full-length Dros G1uC1 cDNA into a mammalian host cell.
EXAMPLE 8
Cloning of Dros GluCl cDNA into a Baculovirus Expression Vector for
Expression in Insect Cells
Baculovirus vectors, which are derived from the genome of
the AcNPV virus, are designed to provide high level expression of cDNA
in the Sf9 line of insect cells (ATCC CRL# 1711). Recombinant
baculoviruses expressing Dros GluCl cDNA is produced by the following
standard methods (InVitrogen Maxbac Manual): the Dros GluCl cDNA
constructs are ligated into the polyhedrin gene in a variety of baculovirus
CA 02220116 1997-11-03
WO 96/34940 PCTIUS96/06035
-38-
transfer vectors, including the pAC360 and the BlueBac vector
(InVitrogen). Recombinant baculoviruses are generated by homologous
recombination following co-transfection of the baculovirus transfer
vector and linearized AcNPV genomic DNA [Kitts, P.A., Nuc. Acid. Res.
18: 5667 (1990)] into Sf9 cells. Recombinant pAC360 viruses are
identified by the absence of inclusion bodies in infected cells and
recombinant pBlueBac viruses are identified on the basis of (3-
galactosidase expression (Summers, M. D. and Smith, G. E., Texas
Agriculture Exp. Station Bulletin No. 1555). Following plaque
purification, Dros GluC1 expression is measured by the assays described
herein.
The cDNA encoding the entire open reading frame for Dros
GluCl is inserted into the BamHI site of pBlueBacIl. Constructs in the
positive orientation are identified by sequence analysis and used to
transfect Sf9 cells in the presence of linear AcNPV mild type DNA.
Authentic, active Dros GluCl is found in the cytoplasm of
infected cells. Active Dros GluCl is extracted from infected cells by
hypotonic or detergent lysis.
EXAMPLE 9
Cloning of Dros GluCl cDNA into a yeast expression vector
Recombinant Dros GluCl is produced in the yeast
S. cerevisiae following the insertion of the optimal Dros GluCl cDNA
cistron into expression vectors designed to direct the intracellular or
extracellular expression of heterologous proteins. In the case of
intracellular expression, vectors such as EmBLyex4 or the like are ligated
to the Dros G1uCl cistron [Rings, U. et al., Biotechnology 8: 543-545
(1990); Horowitz B. et al., J. Biol. Chem. 265: 4189-4192 (1989)]. For
extracellular expression, the Dros GluCl cistron is ligated into yeast
expression vectors which fuse a secretion signal (a yeast or mammalian
peptide) to the NH2 terminus of the Dros GluCl protein [Jacobson, M. A.,
Gene 85: 511-516 (1989); Riett L. and Bellon N. Biochem. 28: 2941-2949
(1989)].
CA 02220116 1997-11-03
WO 961314940 PCTIUS;96/06035
-39-
These vectors include, but are not limited to pAVE1>6,
which fuses the human serum albumin signal to the expressed cDNA
[Steep 0. Biotechnology 8: 42-46 (1990)], and the vector pL8PL which
fuses the human lysozyme signal to the expressed cDNA [Yamamoto, Y.,
Biochem. 28: 2728-2732)]. In addition, Dros G1uC1 is expressed in yeast
as a fusion protein conjugated to ubiquitin utilizing the vector pVEP
[Esker, D. J., J. Biol. Chem. 264: 7715-7719 (1989), Sabin, E. A.,
Biotechnology 7: 705-709 (1989), McDonnell D. P., Mol. Cell Biol. 9:
5517-5523 (1989)]. The levels of expressed Dros GluCl are determined
by the assays described herein.
EXAMPLE 10
Purification of Recombinant Dros G1uCl
Recombinantly produced Dros GluCl may be purified by
antibody affinity chromatography.
Dros GluCl antibody affinity columns are made by adding
the anti-Dros GluCl antibodies to Affigel-10 (Biorad), a gel support
which is pre-activated with N-hydroxysuccinimide esters such that the
antibodies form covalent linkages with the agarose gel bead support. The
antibodies are then coupled to the gel via amide bonds with the spacer
arm. The remaining activated esters are then quenched with 1 M
ethanolamine HCl (pH 8). The column is washed with water followed by
0.23 M[ glycine HCl (pH 2.6) to remove any non-conjugated antibody or
extraneous protein. The column is then equilibrated in phosphate
buffered saline (pH 7.3) together with appropriate membrane solubilizing
agents such as detergents and the cell culture supernatants or cell extracts
containing solubilized Dros GluCl are slowly passed through the column.
The column is then washed with phosphate- buffered saline together with
detergents until the optical density (A280) falls to background, then the
protein is eluted with 0.23 M glycine-HCI (pH 2.6) together with
detergents. The purified Dros G1uCl protein is then dialyzed against
phosphate buffered saline.
CA 02220116 1997-11-03
WO 96/34940 PCTIUS96/06035
-40-
SEQUENCE LISTING
(1) GENERAL INFORMATION:
(i) APPLICANT: Cully, Doris F.
Arena, Joseph P.
Paress, Philip S.
Liu, Ken K.
(ii) TITLE OF INVENTION: DNA ENCODING GLUTAMATE GATED CHLORIDE
CHANNELS
(iii) NUMBER OF SEQUENCES: 6
(iv) CORRESPONDENCE ADDRESS:
(A) ADDRESSEE: Jody M. Giesser
(B) STREET: 126 East Lincoln Avenue - P.O. BOX 2000-0907
(C) CITY: Rahway
(D) STATE: New Jersey
(E) COUNTRY: US
(F) ZIP: 07065-0907
(v) COMPUTER READABLE FORM:
(A) MEDIUM TYPE: Floppy disk
(B) COMPUTER: IBM PC compatible
(C) OPERATING SYSTEM: PC-DOS/MS-DOS
(D) SOFTWARE: Patentln Release #1.0, Version #1.30
(vi) CURRENT APPLICATION DATA:
(A) APPLICATION NUMBER:
(B) FILING DATE:
(C) CLASSIFICATION:
(viii) ATTORNEY/AGENT INFORMATION:
(A) NAME: Giesser, Jody M.
(B) REGISTRATION NUMBER: 32,838
(C) REFERENCE/DOCKET NUMBER: 19264 PCT
(ix) TELECOMMUNICATION INFORMATION:
(A) TELEPHONE: (908) 594-3046
(B) TELEFAX: (908) 594-4720
(2) INFORMATION FOR SEQ ID NO:1:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 17 base pairs
(B) TYPE: nucleic acid
(C) STRANDEDNESS: single
(D) TOPOLOGY: linear
(ii) MOLECULE TYPE: cDNA
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:1:
CA 02220116 1997-11-03
WO 96/34940 PCT/U3'96/06035
-41 -
TGGGTNWSNT TYTGGTT 17
(2) INFORMATION FOR SEQ ID NO:2:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 20 base pairs
(B) TYPE: nucleic acid
(C) STRANDEDNESS: single
(D) TOPOLOGY: linear
(ii) MOLECULE TYPE: cDNA
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:2:
GCNCCDATCC ANACRTCDAT 20
(2) INFORMATION FOR SEQ ID NO:3:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 50 amino acids
(B) TYPE: amino acid
(C) STRANDEDNESS: single
(D) TOPOLOGY: linear
(ii) MOLECULE TYPE: peptide
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:3:
Trp Val Thr Phe Trp Leu Asp Gin Gly Ala Val Pro Ala Arg Val Ser
1 5 10 15
Leu Gly Val Thr Thr Leu Leu Thr Met Ala Thr Gln Thr Ser Gly Ile
20 25 30
Asn Ala Ser Leu Pro Pro Val Ser Tyr Thr Lys Ala Ile Asp Val Trp
35 40 45
Ile Gly
(2) INFORMATION FOR SEQ ID NO:4:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 152 base pairs
(B) TYPE: nucleic acid
(C) STRANDEDNESS: single
(D) TOPOLOGY: linear
(ii) MOLECULE TYPE: cDNA
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-42-
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:4:
TGGGTTACTT TTTGGTTGGA TCAAGGAGCA GTACCGGCGC GAGTGTCACT GGGTGTCACC 60
ACCCTGCTGA CCATGGCCAC CCAGACGTCG GGCATAAACG CCTCCCTGCC GCCCGTTTCC 120
TATACGAAGG CCATAGACGT TTGGATCGGT GC 152
(2) INFORMATION FOR SEQ ID NO:5:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 3958 base pairs
(B) TYPE: nucleic acid
(C) STRANDEDNESS: single
(D) TOPOLOGY: linear
(ii) MOLECULE TYPE: cDNA
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:5:
CTGGCAAATA GCAAATAGAG CAAGACAAAC AGCAGCAGCA ACAGCAACAA CAAGCGCCTG 60
TGTGTCCGTG TCCCCGTGTG TGTGTGTGTG AGAGAGAGCG AGAGCGCGCG CGTGTGTGTG 120
TGTGAGTGTT TTGTACATGT GCCAGTGTGA GTGCGTGTCA CATATCAGCA GAAGAAAAAC 180
CAGCAGCAGC AGCACTAGAA GCAGAAGCAG CAGCAGCAGT GGAAAAGCGC GCAGCCAAGC 240
AGGAAAATTT GTAAACCAAG TCGGCAGAGC AGAGACATCG CAGGAGCAGC GCAGCAGCAG 300
CGACGCCAGC AGAAGGTCGC ATCGCCCACC ACAGGAGGCT GCCACGCCCC ACGCCCCCTC 360
TCCAGGAAGC AGGACGCACG GCACACCACA CCCCCATTCC CAACATGGGC AGCGGACACT 420
ATTTCTGGGC GATCTTATAC TTTGCCAGCC TGTGCAGTGC TTCACTAGCA AATAATGCCA 480
AGGTAAATTT CCGAGAACAG GAGGAAAAAG TCTTAGATCA AATTTTAGGT GCAGGCAAAT 540.
ACGACGCCCG AATACGACCA TCTGGAATAA ATGGCACAGA TGGTCCCGCC ATAGTCAGAA 600
TCAATCTATT CGTTCGCAGT ATTATGACGA TTAGTGATAT TAAAATGGAG TACAGTGTGC 660
AGTTAACCTT CCGTGAACAG TGGACGGATG AACGCCTCAA GTTCGACGAT ATCCAGGGTC 720
GCCTAAAGTA TCTGACCCTG ACGGAGGCGA ACCGCGTGTG GATGCCCGAT CTTTTCTTCT 780
CGAACGAGAA GGAGGGACAC TTCCACAACA TCATCATGCC CAATGTGTAT ATTCGCATCT 840
TCCCCAACGG ATCTGTGCTA TATAGTATAC GTATCTCGCT GACATTGGCC TGCCCAATGA 900
ACCTAAAGCT GTATCCGCTG GATAGACAGA TCTGCTCACT ACGGATGGCC AGCTATGGCT 960
GGACCACCAA CGACTTGGTC TTCCTGTGGA AGGAGGGCGA TCCCGTACAG GTGGTAAAGA 1020
CA 02220116 1997-11-03
WO 96/34940 PCT/U396/06035
-43 -
ACTTACACCT ACCTCGCTTC ACACTGGAGA AGTTTCTGAC TGATTACTGT AACAGTAAAA 1080
CCAACACCGG TGAATACAGT TGCCTCAAAG TCGATCTACT ATTCAGGCGA GAATTCTCAT 1140
ATTACTTAAT ACAAATTTAT ATACCATGCT GTATGTTGGT CATTGTATCA TGGGTATCAT 1200
TCTGGCTGGA TCAAGGAGCA GTACCGGCGC GAGTGTCACT GGGTGTCACC ACCCTGCTGA 1260
CCATGGCCAC CCAGACGTCG GGCATAAACG CCTCCCTGCC GCCCGTTTCC TATACGAAGG 7.320
CCATCGATGT GTGGACAGGC GTGTGTCTGA CGTTCGTGTT CGGGGCCCTG CTCGAGTTCG 1.380
CCCTGGTGAA CTATGCATCC CGATCAGGTT CGAATAAAGC TAACATGCAT AAGGAGAATA 1440
TGAAAAAGAA GCGCCGCGAT CTGGAGCAGG CCAGTTTAGA TGCCGCTTCA GATCTGCTAG 1500
ATACAGATAG CAATGCAACG TTCGCAATGA AACCGTTAGT ACGCCATCCG GGCGATCCGC 1560
TGGCCCTGGA AAAGCGGCTC CAATGCGAGG TGCACATGCA GGCCCCGAAG CGACCAAACT 1620
GCTGCAAGAC CTGGCTGTCC AAGTTCCCCA CAAGACAATG TTCTAGATCC AAGAGAATCG 1680
ATGTTATATC GCGGATCACC TTCCCGCTGG TCTTCGCCCT GTTCAACCTG GTCTACTGGA 1740
GCACATATCT CTTCAGGGAG GAGGAGGATG AGTAAATGCC GTTACCTATT GCCAAACACC 1800
AATTACTTTA TAGAAGGGTT GGCGCTATTG GCCAACACGA ATGTACTAAC CTATTTCTTT 1860
CATTCTTTTC CATTTCGGTT GTCTTCATTT CATGCTTTGT GTTGCTTATG GCTTTGTTGG 1920
CTTCATTTCC GATTTGTTTG ATTTCTTGAT TGACACCTTG ATTGAATGGT TCAAACCACT 1980
AAAGGACCTT C:TAAGGCGCG TCTCTGAAAT GCGGTGGCTA TGTAGAATCT AATACGAAAT 2040
TAACTAATTA TACCGAGGGA TACGTTGCGA TATCGCTGTA TGCTACCGGC TATGTGCCGC 2100
ATGCTACATT TATGGTTATG TCTCGGAACA GTGCAGATAA GTTAAGAACG GTATCCGGCA 2160
AGGCTCCATG GCACTTCCAC TAACCAATTA AAGAATAATG TTTTATGAAT GACGAAATTC 2220.
TAGTTAATTG TAAGTTAAAT TGATCAAGAG TGACTGCATA GTAGATAATG TTATGAATAA 2280
TTATACTAAA CTATACACAA ACTGACACAC ACCGCAACAC TTGTTTGACT TGATTTGTTT 2340
AGAGGATGCT CCAAATTGTT ACAAATTGAT TAATTATTTT AGCTGGTTAT CGACGATAAC 2400
CGAGTTTTGT TCCGGACTCT ATATTAGTTC TAAACGAAAT TGCAATTGAT TTGTACTTAA 2460
ATGCGTTAAG TTAGATAAGC CGCAAACAGC GAGAGGAGGT CGTAGAGAAT TCGACTTTTG 2520
TAAATATGTC =ACAATAAG TTTTAAGCGA ACTAGTTTAT ATGAATTCTA ATTGTAAAAA 2580
TCGTGTAGAT A.kATTTAAGT TTAGTCGATA AACAAACCAC TAACCGAAGC GAGATACCTA 2640
GGTAAAATCA ATTTAATTAT GTTCACCATC GAAGCAAAAT AAAAATCGAA TCGAAAATAT 2700
CA 02220116 1997-11-03
WO 96/34940 PCTIUS96/06035
-44-
CAAAGAATCC TTCAAAACAC ACAGAATCAA ATACAGAACT TTCTTTTTGC ATTTTTTGCC 2760
CAAACTACTC TTAAATGATA AGTTCAACTG AAACTGGTGG GTATCTGCAA GGTATTTTTA 2820
CCCAAACTTT ATTAGAAACT TTCTTCATTA TTTATATACA TACGGCTTGC TTTTCGTTTT 2880
AGAGTTGAAT TTTTATAGTA GTTGAATTGT TCTGGTACTC ACGGGAAGTA AAACCCTCGA 2940
ATTCCGATTA CTTTTTCATT TGAATTCTTA GAATATTATA ATAAATTTAC ATTTACCTAA 3000
TTATGTATTG GGCCCAAGTG CCGCTTAGCT AGTTAATTTC CTTAATTAGA GTTACAATAT 3060
AAAAATATAC AACATGCAAA CCATAAACCA ATTAACAGAC AATACAAAAT ATTTTATCAT 3120
GTAGTCAAAG TCCCTAAACA ACTTAATGGA TACTACACAT AAATTGATTA AAATCAGTAT 3180
TATAAGACAA AAATAAGATC AAGATATATA CGGTTCTTTT TATATCCAAA AATATCTTTG 3240
GTTATTTAAG TGCCTTTTGT ATGCCAAGGA GATTTCTCCC CACTTTCTTC CCTTCTCTAA 3300
CTCTCTCTCT CTCTCTCTCT CTTCCTAACT TTTGAATGAC TCCGATCCTT TCACGCTAAT 3360
ATCCTTTCCT AAACTCAATT AGAGAAATGC ACTAACCGAC ACCATAAACT ATGCAGCTCT 3420
AATTTTAGAA TTATAACTAA AGTGAATTCT ACATAGCAAC AACAGAAACA GAATCAGTTC 3480
CAGAACCACA ATAACCAACT AACAGATAAA TCGAATAAAA TATTTCCGTA GTTTTTTAAT 3540
ATTTTTATTA ACTTTAGCCT GTTTTATTCA CATGTTTTCT TAAACTTTTT CTTTGATTTT 3600
GGAAATGCCT TTCGTTTGCT ATCATTTATA ATCTAAAGGT AAGAAACTAA ACGTAAAAGG 3660
AAATCAAAAA TCAATTGAAA CTTATTCTAA TATATAGACA CTACACAAGG CACCCTGCAT 3720
AATAATTGTT GTCATTAAAC AAGCGTCATA AGTACGATCA GAACATATAG AAAAACCGAA 3780
AATGGAAATA TTTATAGATA CTTTCATGTT GTAAAAGTTG TGCCAAGCAA AGACGAAACC 3840
AAAAACTAGT CAAAGAAAGA AAATCGAATG AAATCGCGAA TTATAACTAT AACTCTAGCT 3900.
ATAGTTGTAT TGTATATGAA GCTATTGAAC ATACAGGGTT TTTAAATGTG AGCATATA 3958
(2) INFORMATION FOR SEQ ID NO:6:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 456 amino acids
(B) TYPE: amino acid
(C) STRANDEDNESS: single
(D) TOPOLOGY: linear
(ii) MOLECULE TYPE: protein
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-45-
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:6:
Met Gly Ser Gly His Tyr Phe Trp Ala Ile Leu Tyr Phe Ala Ser Leu
1 5 10 15
Cys Sear Ala Ser Leu Ala Asn Asn Ala Lys Val Asn Phe Arg Glu Lys
20 25 30
Glu Lys Lys Val Leu Asp Gln Ile Leu Gly Ala Gly Lys Tyr Asp Ala
35 40 45
Arg Ile Arg Pro Ser Gly Ile Asn Gly Thr Asp Gly Pro Ala Ile Val
50 55 60
Arg Ile Asn Leu Phe Val Arg Ser Ile Met Thr Ile Ser Asp Ile Lys
65 70 75 80
Met Glu Tyr Ser Val Gin Leu Thr Phe Arg Glu Gin Trp Thr Asp Glu
85 90 95
Arg Leu. Lys Phe Asp Asp Ile Gin Gly Arg Leu Lys Tyr Leu Thr Leu
100 105 110
Thr Glu Ala Asn Arg Val Trp Met Pro Asp Leu Phe Phe Ser Asn Glu
115 120 125
Lys Glu Gly His Phe His Asn Ile Ile Met Pro Asn Val Tyr Ile Arg
130 135 140
Ile Phe Pro Asn Gly Ser Val Leu Tyr Ser Ile Arg Ile Ser Leu Thr
145 150 155 160
Leu Ala Cys Pro Met Asn Leu Lys Leu Tyr Pro Leu Asp Arg Gin Ile
165 170 175
Cys Ser Leu Arg Met Ala Ser Tyr Gly Trp Thr Thr Asn Asp Leu Val
180 185 190
Phe Leu Trp Lys Glu Gly Asp Pro Val Gin Val Val Lys Asn Leu His
195 200 205
Leu Pro Arg Phe Thr Leu Glu Lys Phe Leu Thr Asp Tyr Cys Asn Ser
210 215 220
Lys Thr Asn Thr Gly Glu Tyr Ser Cys Leu Lys Val Asp Leu Leu Phe
225 230 235 240
Arg Arg Glu Phe Ser Tyr Tyr Leu Ile Gin Ile Tyr Ile Pro Cys Cys
245 250 255
Met Leu Val Ile Val Ser Trp Val Ser Phe Trp Leu Asp Gin Gly Ala
260 265 270
Val Pro Ala Arg Val Ser Leu Gly Val Thr Thr Leu Leu Thr Met Ala
275 280 285
CA 02220116 1997-11-03
WO 96/34940 PCT/US96/06035
-46 -
Thr Gln Thr Ser Gly Ile Asn Ala Ser Leu Pro Pro Val Ser Tyr Thr
290 295 300
Lys Ala Ile Asp Val Trp Thr Gly Val Cys Leu Thr Phe Val Phe Gly
305 310 315 320
Ala Leu Leu Glu Phe Ala Leu Val Asn Tyr Ala Ser Arg Ser Gly Ser
325 330 335
Asn Lys Ala Asn Met His Lys Glu Asn Met Lys Lys Lys Arg Arg Asp
340 345 350
Leu Glu Gln Ala Ser Leu Asp Ala Ala Ser Asp Leu Leu Asp Thr Asp
355 360 365
Ser Asn Ala Thr Phe Ala Met Lys Pro Leu Val Arg His Pro Gly Asp
370 375 380
Pro Leu Ala Leu Glu Lys Arg Leu Gln Cys Glu Val His Met Gln Ala
385 390 395 400
Pro Lys Arg Pro Asn Cys Cys Lys Thr Trp Leu Ser Lys Phe Pro Thr
405 410 415
Arg Gln Cys Ser Arg Ser Lys Arg Ile Asp Val Ile Ser Arg Ile Thr
420 425 430
Phe Pro Leu Val Phe Ala Leu Phe Asn Leu Val Tyr Trp Ser Thr Tyr
435 440 445
Leu Phe Arg Glu Glu Glu Asp Glu
450 455
