Note: Descriptions are shown in the official language in which they were submitted.
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
MOLECULES THAT ARE ABLE TO INHIBIT THE BINDING BETWEEN NGF
AND THE TrkA RECEPTOR AS ANALGESICS WITH PROLONGED EFFECT
BACKGROUND TO THE INVENTION
The present invention relates to the use of molecules that are capable of
inhibiting the
binding between NGF and its receptor, TrkA. In particular, it relates to
antibodies for
one of the two molecules that, by blocking the biological activity of NGF,
have a
prolonged analgesic effect. Owing to the enduring analgesic effect thereof,
they are an
advantageous therapy for pathologies with persistent forms of pain, known also
as
chronic pain, such as but not limited to neuropathic or oncological pain.
STATE OF THE ART
The nociceptive signals afferent to the spinal cord are carried by the fibres
AS and C, the
cell bodies of which (primary sensitive neurons) are located in the spinal
dorsal ganglia
(DRG). The primary sensitive neurons release glutamate together with ATP as an
excitatory neurotransmitter, and various other substances such as substance P
and CGRP
(calcitonin-gene-related-peptide), (Hunt and Mantyh, 2001). The release of
these
excitatory neurotransmitters is controlled by various classes of receptors
present on the
afferent terminals, including those that are sensitive to capsaicin (vanilloid
receptors,
VRl), those activated by GABA, those activated by ATP itself and those
activated by
cannabinoids (CB1) (Sivilotti and Nistri, 1991; Hunt and Mantyh, 2001; Khakh,
2001;
Morisset et al., 2001). One of the physiopathological mechanisms whereby
chronic pain
occurs is allodynia, i.e. the transformation of stimuli that are not normally
painful into
painful sensations. This phenomenon involves various ionic currents and thus
various
channels of the "ligand-gated" type, including the receptor for the capsaicin,
VR1, and
the ionotropic receptors for ATP (Khakh, 2001). The simultaneous activation of
the
receptors for VR1 and of those for ATP on spinal nociceptive interneurons
generates a
considerable accumulation of the excitatory synaptic signals with
reinforcement of the
transmission of the painful stimulus (Nakatsuka et al., 2002). On this basis,
it is
therefore clear that the ATP receptors (especially those belonging to the
class P2X3)
play a fundamental role in the pain paths (Burnstock, 2001). These receptors
are present
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
2
on the peripheral nerve terminals activated by algogenic stimuli, on the cell
bodies of
the neurons in the DRGs and on the presynaptic terminals thereof, as well as
naturally
on postsynaptic terminals in the spinal cord (Khakh, 2001). There is
considerable
evidence that shows that the system constituted by the nerve growth factor
(NGF) and
by the high-affmity receptor thereof TrkA (Levi-Montalcini, 1987; Levi-
Montalcini et
al., 1996; Frade and Barde, 1998; Kaplan, 1998) plays a fundamental role in
the
molecular processes underlying the main forms of "persistent" pain. This
indicates a
main therapeutical area (the one of pain, with particular reference to the
"tonic" forms),
for the antibodies that block the NGF/TrkA system (Levine, 1998). The
development of
sensitive nociceptive neurons depends greatly on NGF, and the responses of the
adult
nociceptors are modulated by the same factor (Julius and Basbaum, 2001). In
particular,
NGF exerts acute sensitisation of the capsaicin algogenic stimulus (Shu and
Mendell,
1999). From a functional point of view, the nociceptive neurons, following
chronic
inflammation, develop alterations in the frequency and duration of their
action potential.
These phenomena regress by blocking endogenous NGF leading to a significant
attenuation of the hyperexcitability that is typical of chronic painful states
(Djouhri et
al., 2001). NGF action in defining the pain threshold in adult nociceptors is
mediated by
the TrkA receptor, also through modulation of the response mediated by the VR1
receptor present on the nociceptive terminals. The TrkA-dependent potentiation
of the
VR1 response is thought to occur through the intracellular transduction
pathway of the
gamma version of phospholipase C (PLCgamma, Chuang et al., 2001). The levels
of
peripheral NGF are increased in inflammatory processes, while the
administration of
exogenous NGF has a hyperalgesic effect on rats and produces muscular pain in
humans. Furthermore, NGF produces hypersensitisation to heat stimulation in
humans
and mammals in general. NGF is released by mastocytes, fibroblasts and other
cell types
in the peripheral sites where inflammatory processes occur. In particular the
mastocytes
appear to play a fundamental role (Woolf et al., 1996). As these cells produce
NGF and
at the same time express functional TrkA receptors on their surface (Nilsson
et al.,
1997), they are able to respond to NGF itself, in the presence of
lysophosphatidylserine
(Horigome et al., 1993; Kawamoto et al., 2002). As a result, the system
NGF/TrkA.
appears to mediate mastocyte activation through a positive feedback autocrine
mechanism allowing the local amplification of the algogenic inflammatory
signal.
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
3
High levels of NGF are also found in neurons, where this neurotrophin is
apparently
responsible for the modifications of nerve fibres, associated with pain (Harpf
et al.,
2002). In certain forms of cancer, the excess of NGF facilitates the growth
and
infiltration of nerve fibres with induction of oncological pain (Zhu et al.,
1999). Recent
experimental studies show that, by blocking NGF, it could be possible to
significantly
reduce the formation of neuromas, responsible for neuropathic pain, without
damaging
the cell bodies of the lesioned neurons (Kryger et al., 2001). These results
elicited
significant interest in therapeutic approaches based on the reduction of the
effects of
NGF for the treatment of chronic pain (Saragovi and Gehring, 2000). In recent
years, the
involvement of the NGF/TrkA system in the molecular processes of pain
transduction
has also been demonstrated on a genetic base. In particular, mutations of the
TrkA gene
(localised on the chromosome 1q21-q22) are responsible for a hereditary
recessive
autosomic syndrome known as CIPA ("congenital insensitivity to pain with
anhydrosis"), characterised by recurrent episodic fever, anhydrosis, absence
of reaction
to stimuli that cause pain, mental retardation and a tendency to self-
mutilation (Indo et
al., 1996; Saragovi and Gehring, 2000; Indo, 2001; Indo et al., 2001). Further
confirmation of the involvement of NGF in the nociceptive response was
recently
obtained by the work on phenotype characterisation of anti-NGF transgenic mice
(AD11). In these animals, the ectopic expression of the anti-NGF antibody aDll
produces a functional block of NGF in adult. This block translates in a
consistent
manner into an increase in the latency time of the response to harmful heat
stimuli
(Capsoni et al., 2000; Ruberti et al., 2000). Antibodies that are able to
neutralise the
biological activity of the NGF/Tr1cA system by blocking the ligand or the
receptor may
represent an important resource in pain therapy, in particular for persistent
forms of
pain. In this context, a very recent publication demonstrates that treatment
with a
neutralising anti-NGF antibody produces significant pain reduction in a murine
oncological pain model (Sevcik et al., 2005). Nevertheless, in the
administration
protocol used by Sevcik et al., the maximum time lapse between the last
injection of
anti-NGF and observation of the behaviour does not exceed 4 days, so it is not
a long-
term effect.
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
4
A long-term effect can be defmed as an effect which is still evident for at
least 1-2
week(s), after the last administration of the antibody, implying that there is
no necessary
correlation between the effect and the bloodstream concentration of the
antibody itself.
A long-term effect may require new gene expression and may represent a
permanent or
prolonged modification of the original physiopathological state. In many
cases, the
drug that is capable of producing a long-term effect, may be defined as
a"disease-
modifying" active principle, i.e. capable of modifying in depth the course of
the disease,
unlike products displaying a simple pharmacological effect on the symptoms.
The authors of the present invention dispose of a panel of antibodies
(directed against
the NGF ligand) that are able to block the biological effects of NGF that are
mediated
by the TrkA ligand. Two reagents: aDl1 (anti-NGF) and MNAC13 (anti-TrkA) are
of
particular interest. The comparison between the two antibodies, the one
directed against
the ligand and the other directed against the receptor, is of significant
interest as the
inhibition of the NGF ligand is not functionally equivalent to the inhibition
of the TrkA
receptor. Three points must in fact be considered:
i) stoichiometric reasons, in the context of the same system, the availability
of
ligand and of receptor may vary greatly and vary in a different fashion, over
time;
ii) the presence of a second receptor for NGF (p75) that is shared by all the
neurotrophins and mediates distinct biological functions with respect to TrkA
(Hempstead, 2002);
iii) the presence, in nature, of "immature" forms of NGF (pre-pro-NGF),
characterised by distinct properties, in terms of bioactivity, and binding
preferably to the p75 receptor (Lee et al., 2001).
aD 11 is a rat monoclonal antibody directed against mouse NGF (but also able
to
recognise rat and human NGF). Its interaction with NGF inhibits the binding
thereof
with TrkA, blocking the physiological action thereof (Cattaneo et al., 1988).
aD11 also
inhibits the binding of NGF to the p75 receptor. This anti-NGF antibody is
absolutely
unique in terms of its specificity of binding to its antigen (as compared to
all the other
neurotrophins), through the affmity of binding with the antigen (picomolar)
and through
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
neutralising features, showed both in vitro and in vivo (Cattaneo et al.,
1988; Berardi et
al., 1994; Molnar et al., 1997; Molnar et al., 1998). The alphaDll epitope is
located at
the level of NGF loop I and/or NGF loop II that are exposed to the outer part
of the
molecule and spatially very close to each other. Moreover, the conserved
reactivity of
5 alphaDl1 in different species is consistent with the epitope assignment,
since amino
acid residues of these two loops are highly conserved. The potent neutralising
activity
of alphaDll shows that the recognised epitope is very close to the NGF
receptor
binding site. Moreover, the lack of cross reactivity of alphaDl1 with other
members of
the neurotrophin family suggests that: i) the epitope is located in NGF
regions that are
not shared with other neurotrophins, ii) the epitope itself may be involved in
the
"specificity path" mediating NGF-TrkA recognition. The epitope recognized by
the
alphaDl 1 antibody on the NGF molecule was identified by testing the binding
activity
of the antibody towards an extensive panel of NGF mutants. On the basis of
this
systematic screening, a region (aa. 41-49, loop I) of the NGF molecule was
identified
that is highly expressed on top of NGF molecule and that is responsible
(though not
exclusively) for the binding of the antibody to its antigen (Gonfloni, 1995).
As a matter
of fact also the NGF aa. region 23-35 (loop II) may contribute to the binding.
The antibody MNAC13 is a mouse monoclonal antibody directed against the human
TrkA receptor (Cattaneo et al., 1999; Pesavento et al., 2000), that is
particularly
effective in the inhibition of the process of TrkA activation by NGF and of
downstream
biological functions, both in vitro and in vivo (Cattaneo et al., 1999;
Pesavento et al.,
2000). The antibodies were characterized in detail from the point of view of
the
structure (Covaceuszach et al., 2001) and from the molecular interaction with
the TrkA
receptor (Covaceuszach et al., 2005).
On the basis of such in-depth knowledge around structure, by means of an
innovative
method, humanised versions of both aDl1 and MNAC13 were generated (Hu-aD11 and
Hu-MNAC13), displaying the same antigen binding features of the parental
versions
(patent application WO 05/061540).
The therapies that are currently available for treating pain of neuropathic
origin (caused
by a primary lesion or by a dysfunction of the nervous system, for example the
pain
associated by a lesioii of the spinal cord), for treating oncological pain,
and for
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
6
numerous other forms of persistent pain (also of inflammatory nature) have
been found
to be of limited effectiveness. There is therefore an obvious need to identify
and develop
new molecules that have an analgesic activity and which work through a
different action
mechanism as compared to currently used analgesic drugs, in order to solve
side effect
related probleins. The international patent application WO 02/20479 discloses
small
synthesis molecules that inhibit the TrkA receptor, having a potential
analgesic activity.
Nevertheless, the effect of these molecules on certain pain models has not
been
demonstrated. Furthermore, as compared to antibodies, the small molecules have
the
drawback of being more likely to penetrate the haematoencephalic barrier, with
the
possibility of serious side effects. In fact, the cholinergic neurons of the
basal forebrain,
a neuronal population that is affected by various forms of progressive
neurodegeneration, including Alzheimer's disease (Saper et al., 1985), express
the TrkA
receptor and depend on NGF for correct functioning (Holtzman et al., 1992).
The
international patent application WO 01/78698 proposes the use of an NGF
antagonist
for preventing or treating chronic visceral pain, but not for neuropathic or
oncological
pain. Even if the application states that the antagonist can bind both NGF and
the TrkA
receptor, it is not demonstrated that, upon binding of the antagonist to the
TrkA
receptor, the receptor is functionally blocked. On the basis of the capacity
of the two
antibodies MNAC13 and aDl l to block the biological activity of NGF/TrkA, the
two
antibodies MNAC13 and aDl1 and their respective humanised versions were tested
in
various (rodent) animal models of persistent pain, in particular in the model
CCI
("Chronic Constriction Injury", chronic constriction injury of the sciatic
nerve), one of
the models available for assessment of chronic pain of a neuropathic nature
(Bennett and
Xie, 1988).
SUMMARY OF THE INVENTION
The object of the present invention is the use of an anti-NGF that is able to
inhibit the
binding between NGF and TrkA, for the preparation of a medicament for the
treatment
of chronic pain.
An anti-NGF molecule that blocks the biological activity of TrkA is defined as
a
molecule that acts as an antagonist in terms of the NGF binding with the TrkA
receptor
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
7
and comprises: synthetic molecule or monoclonal antibody or a
biological/synthetic
derivative thereof that:
i) binds to TrkA;
ii) inhibits the binding of NGF to the "native" TrkA receptor expressed on the
surface of living cells ("native" meaning "in the natural in vivo
conformation"); and
iii) blocks the biological activity that derives from the NGF binding with the
same TrkA receptor.
The term "blocking the biological activity" does not simply mean blocking
activation of
the receptor, defined as blocking the conversion process of the receptor
itself into an
"active" state but also functional neutralisation of the biological
consequences that are
downstream of this activation process: second messengers, new gene expression,
phenotypical and functional modifications. The molecule is not only able to
block TrkA
in a classic in vitro test (test of neuritic growth in PC12 cells), but also
in vivo
(functional block of the cholinergic neurons of the basal forebrain and block
of the
nociception in a classic "hot plate" test).
It is an object of the invention the use of an anti-NGF antibody capable of
inhibiting the
binding between NGF and TrkA for the preparation of a medicament for treating
and/or
preventing chronic pain. Preferably the antibody is able to recognise and bind
to a NGF
molecule domain containing the aa. 41-49 region of human or rat NGF: EVNINNSVF
(SEQ ID No. 9), more preferably the domain contains also the aa 23-35 region:
GDKTTATDIKGKE (SEQ ID No. 10). More preferably the antibody is capable of
blocking the biological activity of TrkA.
There is also provided as an aspect of the invention a method of treatment
and/or
prevention of chronic pain in a subject comprising administering to the
subject an
effective amount of an anti-NGF antibody thereby to treat and/or prevent
chronic pain
in said subject. There is also provided a kit comprising a composition
containing an
anti-NGF antibody together with instructions directing administration of said
composition to a subject in need of treatment and/or prevention of chronic
pain thereby
to treat and/or prevent chronic pain in said subject.
In a preferred aspect the variable region of the antibody light chain
comprises at least
one, more preferably two, most preferably three of the complementarity
determining
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
8
regions (CDRs) having the sequence selected from aa. 24 to aa. 34 of A
ID No.1;
from aa. 50 to aa. 56 of SEQ ID No. 1; from aa. 89 to aa. 97 of SEQ ID No. 1.
In a further preferred aspect the variable region of the antibody light chain
comprises
essentially the sequence of SEQ ID No. 1.
(VL, SEQ ID No. 1):
L CDR1 L CDR2
DIQMTQSPASLSASLGETVTIECRASEDIYNALAWYQQKPGKSPQLLIYNTDTLHTGVP
L CDR3
SRFSGSGSGTQYSLKINSLQSEDVASYFCQHYFHYPRTFGGGTKLELK
In a preferred aspect the variable region of the antibody heavy chain
comprises at least
one, more preferably two, most preferably three of the complementarity
determining
regions (CDRs) having the sequence selected from aa. 26 to aa. 35 of SEQ ID
No. 2;
from aa. 50 to aa. 65 of SEQ ID No. 2; from aa. 98 to aa. 111 of SEQ ID No. 2.
In a further preferred aspect the variable region of the antibody heavy chain
comprises
essentially the sequence of SEQ ID No. 2.
(VH, SEQ ID NO 2):
H CDR1 H CDR2
QVQLKESGPGLVQPSQTLSLTCTVSGFSLTNNIWNWVRQATGRGLEWMGGVWAGGATDY
H CDR3
NSALKSRL TI TRDT SKSQVFLKMHSLQSEDTAT YYCARDGGYS S STL YANIDA f tTGQGTT V
TVSA
The antibody may be in single chain form and comprises a light chain variable
region
and a heavy chain variable region joined by a linker.
Alternatively the antibody may comprise two light chains and two heavy chains.
In a preferred aspect of the invention the anti-NGF antibody is a human or
humanised
antibody. The skilled in the art shall select the proper humanisation method
to design
the antibody, a preferred method is the method as disclosed in WO 2005/061540.
RECTIFIED SHEET (RULE 91) ISA/EP
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
9
Briefly, a "humanized" variant of the antibody variable region was obtained by
grafting
the Complementarity Determining Regions (CDRs) of the rat antibody on to a
human
immunoglobulin framework. The complete structural information obtained from X-
ray
diffraction studies concerning the Fab fragment of the aDl1 antibody was
exploited to
select an acceptor framework of human origin. Two different criteria were
adopted to
minimize structural differences between the rat aDl 1 and the acceptor human
antibody:
i) level of primary structure homology, ii) level of tridimensional structure
similarity.
After choosing the framework, the replacement of human residues by rat
counterparts
was minimized to reduce the potential immunogenicity of the resulting
humanized
antibody.
Exemplary humanised antibodies comprise a light chain variable region which is
a
humanised derivative of SEQ ID No 1 (a rat origin sequence). Exemplary
humanised
antibodies comprise a heavy chain variable region which is a humanised
derivative of
SEQ ID No 2 (a rat origin sequence).
In a preferred aspect of the invention the variable region of the humanised
antibody
light chain coinprises essentially the sequence of SEQ ID No. 3.
SEQ ID NO 3 (VL, variable region of the light chain of Hu- aD11):
L CDR1 L CDR2
DIQMTQSPSSLSASVGDRVTITCRASEDIYNALAWYQQKPGKAPKLLIYNTDTLHTGVP
L CDR3
SRFSGSGSGTDYTLTISSLQPEDFATYFCQHYFHYPRTFGQGTKVEIK
In a preferred aspect of the invention the variable region of the humanised
antibody
heavy chain comprises essentially the sequence of SEQ ID No. 4.
SEQ ID No. 4(VH, variable region of the heavy chain of Hu- aDl l):
H CDR1 H CDR2
EVQLVESGGGLVQPGGSLRLSCAASGFSLTNNNVNWVRQAPGKGLEWVGGVWAGGATDY
H CDR3
NSALKSRFTISRDNSKNTAYLQMNSLRAEDTAVYYCARDGGYSSSTLYAMDAWGQGTLV
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
TVSS
The above described humanized variable regions were cloned into appropriate
expression vectors into a huinan IgGl or IgG4 isotype format and transfected
into
5 mammalian cell lines to allow for expression, purification and
pharmacological
characterization.
Different variants of Hu-aD11 (complete IgG: heavy chain + light chain) were
finally
produced (differing because of different constant parts).
In a preferred aspect of the invention the humanised antibody light chain has
essentially
10 the sequence of SEQ ID No. 8.
SEQ ID NO 8, Hu-aD 11 Vk human Ck
DIQMTQSPSSLSASVGDRVTITCRASEDIYNALAWYQQKPGKAPKLLIYNTDTLHTGVP
SRFSGSGSGTDYTLTISSLQPEDFATYFCQHYFHYPRTFGQGTKVEIKRTVAA.PSVFIF
PPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS
TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(Italics= variable regions; Bold=mutations in the rat sequence in the
humanization
process; Underlined=CDRs)
In a preferred embodiment, the humanised anti-NGF heavy chain has essentially
one of
the following 3 sequences:
SEQ ID NO 5, Hu-antiNGF (VH) human IgGl
EVQLVESGGGLVQPGGSLRLSCAASGFSLTNNNVNWVRQAPGKGLEWVGGVWAGGATDY
NSALKSRFTISRDNSKNTAYLQMNSLRAEDTAVYYCARDGGYSSSTLYAMDAWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA
VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPA
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY
TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS
KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
11
SEQ ID NO 6, Hu-aDl l(VH) human IgGl* (IgGl with N297A mutation, as described
by Bolt et al., 1993)
EVQLVESGGGLVQPGGSLRLSCAASGFSLTNNNVNWVRQAPGKGLEWVGGVWAGGATDY
NSALKSRFTI SRDNSKNTAYLQMNSLRAEDTAVYYCARDGGYSSSTLYAMDAWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA
VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPA
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY
TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS
KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
SEQ ID NO 7, Hu-aDl1 (VH) human IgG4
EVQLVESGGGLVQPGGSLRLSCAASGFSLTNNNVNW fTRQAPGKGLEWVGGVWAGGATDY
NSALKSRFTI SRDNSKNTAYLQMIITSLRAEDTAVYYCARDGGYSSSTLYAMDAWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA
VLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEF
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPRE
EQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLP
PSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT
VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
(Italics= variable regions; Bold=mutations in the rat sequence in the
humanization
process; Underlined=CDRs; N297A mutation to abolish glycosilation site).
In a preferred aspect the molecules of the invention are used for the
preparation of a
medicament for the pain of the chronic inflammatory type, preferably caused by
pancreatitis, kidney stones, headaches, dysmenorrhoea, musculoskeletal pain,
sprains,
visceral pain, ovarian cysts, prostatitis, cystitis, interstitial cystitis,
post-operative pain,
migraine, trigeminal neuralgia, pain from bums and/or wounds, pain associated
with
trauma, neuropathic pain, pain associated with musculoslceletal diseases,
rheumatoid
arthritis, osteoarthritis, ankylosing spondilitis, periarticular pathologies,
oncological
pain, pain from bone metastases, pain from HIV.
Alternatively the pain is a neuropathic pain or an oncological pain.
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
12
According to International Association for the Study of Pain (IASP, www.iasp-
Ua in.org
<http://www.iasp-pain.org/> ), pain is generally defined as "An unpleasant
sensory and
emotional experience associated with actual or potential tissue damage, or
described in
terms of such damage or both". The essential element in all forms of pain is
the
activation of specialized high-threshold receptors and nerve fibers to warn
the organism
of potential tissue damage. The involvement of inflammatory cells and
processes is a
common element in many pain states. The term "acute pain" means immediate,
generally high threshold, pain brought about by injury such as a cut, crush,
burn, or by
chemical stimulation. The term "chronic pain," as used herein, means pain
other than
acute pain. It is understood that chronic pain often is of relatively long
duration, for
example, months or years and can be continuous or intermittent.
The anti-NGF antibody is suitably administered systemically. Systemic
administration
of the anti-NGF antibody can be performed by injection, e.g. continuous
intravenous
infusion, bolus intravenous infusion, subcutaneous or intramuscular injection.
Alternatively other forms of administration (e.g. oral, mucosal, via
inhalation,
sublingually, etc.) may also be used. Local delivery of the antibody can be
performed by
local administration eg intra-articular injection or subcutaneous,
intramuscular injection
in the vicinity of affected tissues.
The anti-NGF antibody will suitably be formulated in a pharmaceutical
composition
appropriate for the intended route of administration. Solutions for injection
will
suitably contain the antibody dissolved or dispersed in an aqueous medium (eg
water for
injection) containing appropriate buffers and molarity modifiers eg phosphate,
salt
and/or dextrose.
Treatment regimen i.e. dose, timing and repetition, can be represented by
single or
repeated administrations (eg injections) of the product by the chosen
administration
route. The interval of dose administration can be subject to modifications
depending on
the extent and duration of the clinical response, as well as the particular
individual and
the individual clinical history. Suitably the anti-NGF antibody has a long
duration of
action. In particular the clinical effect of the antibody extends following
administration
as long as 21 days as determined from animal studies. Furthermore, preliminary
data
imply that anti-NGF antibodies may manifest clinical benefit for a longer
period than
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
13
that in which its presence can be detected in a relevant biological matrix
such as serum
or plasma following its administration.
In light of the intended long duration of action (i.e. an effect suitably
lasting at least one
week, or preferably at least two weeks eg at least three weeks or at least
four weeks),
suitably the antibody may be administered to subjects at a frequency of not
more than
once per week eg not more than once per two weeks or once per three weeks or
once per
four weeks.
A suitable dose of the anti-NGF antibody will typically range from 0.lmg/kg to
10mg/kg body weight
Novel antibodies and compositions containing them disclosed herein are claimed
as an
aspect of the invention.
Non-limitative embodiments of the present invention will now be disclosed,
with
particular reference to the following figures:
FIGURE 1: BIAcore analysis of the binding of the aD 11 anti-NGF antibody to
mouse
NGF (m-NGF) and recombinant mouse proNGF (rm-proNGF). The aDll anti-NGF
antibody was immobilized on flow cell 2, while flow cell 1 was left as a
blank. Each
curve is obtained subtracting the background signal (measured in cell 1) to
the signal
measured in cell 2. The Surface Plasmon Resonance signal gives the amount of
surface-
bound component at each stage and is expressed in resonance units (RU).
For m-NGF binding, the immobilization of the antibody was of 3000 resonance
units
(RU) in the experiment of panel A and of 6000 RU in the experiment of panel B.
The
injected concentrations of the m-NGF are indicated on top of each curve. From
a
complete analysis of the data, the affinity parameters were evaluated, and
resulted to be
the following: KA = 3,55 -1011 1/M; KD = 2,81= 10"12 M (chi2 value of 0.123).
For rm-proNGF binding (panel C), the immobilization of the antibody was of
3000 RU.
The injected concentrations of the rm-proNGF are indicated on top of each
curve. A
lcinetic analysis of the data allowed to evaluate the following parameters: KA
= 1,2 -109
1/M; KD =1,9-10"9 M(chia value of 0.09).
FIGURE 2: Effect of Fab aDl 1(alphaDl1) and Fab Hu-aD11 (Hu-alphaDl1) anti-NGF
antibodies on the fonnalin-evolced pain (phase 2 of the formalin test: 15-40
min. Phase
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
14
2 corresponds to inflammation-related pain). Mice were subcutaneously injected
with
5% formalin in the dorsal portion of the right hindpaw.
Treatment consisted in antibody injection (Fab alphaDl1 or Fab Hu-alphaDl1 vs
either
mock Fab or saline) performed (in the same paw as for formalin) 45 min, before
formalin injection and testing (single dose of each antibody: 12.5 g). Each
experimental group included at least 8 animals. Statistical analysis of data
showed a
significant analgesic effect of anti-NGF treatment (both for the parental and
the
humanized version of the antibody) that was clearly specific for the second
phase
(inflammatory) of pain response (time spent in licking): The effect of anti-
NGF
antibodies (both parental and humanized versions) is statistically different
(ANOVA)
with respect to either saline (** p< 0.01) or mock Fab treatment (# p< 0.05).
FIGURE 3: Effect of the anti-TrkA monoclonal antibody MNAC13 (1.4 mg/kg) and
anti-NGF monoclonal antibody aDll (1.4 mg/kg) on neuropathic pain: mechanical
allodynia measured by means of a plantar dynamic aesthesiometer; CD1 mice
subjected
to chronic constriction of the sciatic nerve; the antibodies are injected I.P.
at days 3, 4,
5, 6 after lesion of the sciatic nerve. Observation period: from day 3 to day
14. As a
negative control, both saline (sal) and mouse immunoglobulins (IgG, 1.4 mg/kg)
were
used. Results were expressed in terms of absolute value (grams) of the
threshold force
for the hindpaw ipsilateral to lesion. The values were subjected to
statistical analysis by
means of an analysis of the variance (ANOVA) for repeated measurements, in
which
both the "treatment" factor and the repeated measurement (days) were
significant with
p< 0.01. The animals treated with anti-TrkA. or anti-NGF are significantly
different
from the controls from day 4 to day 14.
FIGURE 4: Effect of the anti-TrkA monoclonal antibody MNAC13 (1.4 mg/kg) and
anti-NGF aDl1 antibody (1.4 mg/kg) on neuropathic pain: mechanical allodynia
measured by means of a plantar dynamic aesthesiometer; CDl mice subjected to
chronic constriction of the sciatic nerve; the antibodies were injected I.P.
at days 3, 4, 5,
6 after lesion of the sciatic nerve. Observation period: from day 3 to day 14.
As a
control, both saline (sal) and mouse immunoglobulins (IgG, 1.4 mg/kg) were
used.
Results were expressed as a percentage, % (ratio between the threshold force
of the
hindpaw ipsilateral to lesion and that corresponding to the contralateral
hindpaw). The
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
corresponding absolute values were subjected to statistical analysis by means
of an
analysis of the variance (ANOVA) for repeated measurements, in wliich both the
"treatment" factor and the repeated measurement (days) were significant with
p< 0.01
(at least). The animals treated with anti-TrkA o anti-NGF were significantly
different
5 from the controls from day 4 to day 14.
FIGURE 5: Comparison between the effects of the anti-TrkA monoclonal antibody
MNAC13 (2 doses: 0.9 and 2 mg/kg) and those of the anti-NGF monoclonal
antibody
aDl 1 (2 mg/lcg dose), on neuropathic pain: mechanical allodynia measured by
means of
a plantar dynamic aesthesiometer; CD1 mice subjected to chronic constriction
of the
10 sciatic nerve; the antibodies were injected I.P. at days 3, 4, 5, 6, 7, 8,
9, 10 after lesion
of the sciatic nerve. Observation period: from day 3 to day 31. As a negative
control,
mouse immunoglobulins were used (IgG, 2 mg/kg). Results were expressed as a
percentage % (ratio between the threshold force of the hindpaw ipsilateral to
lesion and
that corresponding to the contralateral hindpaw). The corresponding absolute
values
15 were subjected to statistical analysis by means of an analysis of the
variance (ANOVA)
for repeated measurements, in which both the "treatment" factor and the
repeated
measurement (days) were significant with p< 0.01 (at least). The animals
treated with
MNAC13 were significantly different from the controls up to the last day of
observation
(31), from day 5 (greater dose of MNAC13) or from day 7 (lesser dose of
MNAC13).
The animals treated with aD 11 were significantly different from the controls
up to the
last day of observation (31), from day 4 to day 14, and from day 21 to day 31.
FIGURE 6: Comparison between the effects of the parental (aDll) and humanized
(Hu-aDl1, human IgG4 format) version of the anti-NGF neutralizing antibody (1
dose
tested: 2 mg/Kg) on neuropathic pain: mechano-allodynia measured by means of
dynamic plantar aestesiometer; CDl mice subject to CCI (chronic constriction
injury) of
the sciatic nerve; antibodies I.P. injected at days 3, 4, 5, 6, 7, 8, 9, 10,
following lesion
of the sciatic nerve. Observation period: from day 3 to day 31. Rat
Immunoglobulins
were employed for negative control (IgG, 2 mg/lcg). Results expressed as %
(ratio
between the threshold force for the hindpaw ipsilateral to lesion and the
contralateral
hindpaw). Analysis of variance (ANOVA) for repeated measures on corresponding
absolute values in which both the factor "treatment" and the repeated measure
(days)
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
16
were significant with (at least) p< 0.01. Animals treated with either aD 11 or
Hu-aD11
were significantly different from controls up to the last observation day
(31), from day
4 to day 14, as well as from day 21 up to day 31.
METHODS
Production of monoclonal antibodies
The monoclonal antibodies MNAC13 and aDll are produced from a hybridoma
supernatant, according to standard methods, disclosed above (Galfre and
Milstein, 1981;
Cattaneo et al., 1988; Cattaneo et al., 1999). The supematant containing each
antibody
was subjected to precipitation (29% anunonium sulphate), followed by dialysis
against
PBS 1X (Spectra-Por 12/14K membrane, Spectrum) and affinity chromatography on
sepharose protein G colunm (4-Fast Flow, Amersham Biosciences). Elution
occurred by
means of a low pH (HCl 5 mM) solution that was neutralised upon collection.
The final
eluate was concentrated (Amicon Ultra-15, 50K, Millipore) to obtain
preparations of
purified antibody in concentrations between 1 and 5mg/ml.
The Fab (Fragments Antigen binding) version of the aDl1 antibody was produced
as
previously described (patent application WO 05/061540, Covaceuszach et al.,
2004).
Briefly, Fab fragments were obtained from the correspondent whole monoclonal
antibodies (IgG fonnat) by papain proteolysis, followed by a ion exchange
chromatography purification step and concentration of the Fab fragments
collected in
the flow-through. In order to separate the Fab fragments from the quite low
amount of
uncleaved IgG that was still present, size exclusion cliromatography on a
Superdex G75
column (Phatmacia) was performed using an FPLC system (Pharmacia), followed by
a
final concentration step.
As far as the humanised versions (IgGl/IgGl*/IgG4) of the 2 antibodies (Hu-
aD11 and
Hu-MNAC13) are concerned, they were also purified as disclosed above, starting
from
the supernatants of stably transfected cell lines, which were stable
cotransfectants for the
heavy chain (pVH/CMVexpress) and the light chain (pVL/CMVexpress) of each
antibody. The vectors used have been disclosed previously (patent application
WO
05/061540). The stable co-transfected clones were obtained through double
selection
with G418 and mycophenolic acid. In order to produce the IgG4 variant of Hu-
aD11,
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
17
since the pVH/CMVexpress vector comprises the constant part of human IgGl,
this was
replaced by the corresponding Fc region of IgG4 (cloned by RT-PCR from human
lymphocyte RNA). The IgGl* variant (=IgGl with the N297A mutation described by
Bolt et al., 1993) was generated by site directed mutagenesis.
Surface plasmon resonance studies
Experiments were performed on CM5 chips with amine coupling, using a BlAcore
2000
machine. Coupling was performed with a specific kit purchased at BlAcore and
the
coupling reaction was carried out according to manufacturer's instructions.
Anti-NGF antibodies were immobilized on chip, while mouse NGF (m-NGF, Alomone)
or recombinant mouse proNGF (rm-proNGF) were injected at decreasing
concentrations
to obtain binding curves.
The flow used in the experiments was of 30 l/min, unless otherwise indicated.
The
regeneration of the chip was carried out in all cases with a pulse (10 L) of
10 mM
Glycine pH 1.5. Data collected were analyzed using the Package BIAevaluation
3Ø
The apparent equilibrium constant KD is defined as the ka/kd ratio.
Experiments in murine pain models
The animals were treated and handled in accordance with the guidelines of the
IASP
Ethical Committee and the Italian national law (DL1 16/92, application of
European
Direction 86/609/EEC) on the use of animals in research. Every necessary
effort was
made to minimise the suffering of the animals and to use the minimum amount of
animals required to produce reliable scientific data.
Formalin test
For the preliminary formalin tests (Porro and Cavazzuti, 1993), CD1 male mice
(Charles River Labs, Como, Italy) were used, weighing 35-40g at the beginning
of the
experiments. Upon their arrival in the laboratory (at least 2 weeks before the
experiments), mice were housed in standard transparent plastic cage (4 for
cage) at
constant temperati.ire (22+1 C) and relative humidity (60%), under a regular
light/darlc
schedule (light 7.00-19.00). Food and water were unlimited. The experiments
were
carried out between 09.00 and 14.00 hours. For the formalin test, one animal
at a time
was placed in a transparent plexiglass cage (30 x 12 x 13 cm), and allowed to
move
freely for 30 min before the beginning of the test. After this adaptation
period, 20 l of
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
18
formalin solution (5% in saline) were subcutaneously (sc) injected into the
dorsal
surface of the right hind paw of mice using a microsyringe equipped with a 26-
gauge
needle and the observation period started. A mirror was placed behind the cage
and a
videocamera in front of the cage to allow an unimpeded view of the animal's
hind-
paws. The licking activity, i.e. the total amount of time the animal spent
licking and/or
biting the injected paw, was taken as index of pain. The licking activity was
recorded
continuously for 40 min and calculated in blocks of consecutive 5-min periods
(phase 2
corresponds to the block 15-40 min and can be identified with inflammation-
related
pain). In addition, to assess the effects of formalin injection on the
spontaneous
behaviours, general activity (time spent exploring the environment during
walldng,
rearing and leaning), and self-grooming (time spent for face and body
cleaning) during
the formalin test were also continuously recorded for 40 min. No significant
differences
following treatment with anti-NGF antibodies were observed for these
parameters. In
this set of experiments, antibodies were administered as Fabs (fragments
antigen
binding; single dose of each antibody: 12.5 g per animal).
Each mouse was subcutaneously (sc) injected 45 min before the test with anti-
NGF
antibody (either parental or hiunanized) or irrelevant Fab into the dorsal
surface of the
right hind paw using a Hamilton micro-syringe with a 26-gauge needle (volume
injected
= 20 1). Each animal underwent only one treatment. Testing was performed blind
as for
treatment group to which each subject belonged. The two phases characterizing
the
formalin test were separately analysed by one-way ANOVAs.
Sciatic nerve surzery
Male CDl mice, weighing approximately 35 g, were anaesthetised
(intraperitoneal
injection with 500 mg/lcg chloral hydrate), the sciatic nerve of the right
hind leg was
exposed to undergo loose ligature by means of stitching thread according to
the chronic
constriction lesion model (CCI) of the sciatic nerve, disclosed by Bennett and
Xie
(1988). The loose ligature of the sciatic nerve, at level of the upper thigh,
induced
peripheral mononeuropathy characterised by thermal/mechanical allodynia and
hyperalgesia. By ligation of the nerve at 3 different but near points, the
neuropathy was
fully developed 3 days following the lesion and lasted for 2-3 months.
Pharmacological treatment
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
19
Starting from the third day following the lesion, anti-NGF (aDll) blocking
antibodies
or anti-TrkA (MNAC13) antibodies were administered in an entire form (Mab)
that
were diluted in saline solution (vehicle), as indicated in Table I. As
controls, mouse or
rat irrelevant immunoglobulins used (IgG), in the same dose as the blocking
antibodies
(at the greater dose if 2 doses were used), or saline solution. Each
experimental group
included N=1 0 animals (unless explicitly stated otherwise).
Table I: Administration protocols and measurement of inechanical allodynia.
Antibody Dose Administration i.p. Allodynia
measurement
MNAC 13 50 g/mouse
4, at days 3,4,5,6 after lesion Days 3 to 14
aD 11 = 1.4 mg/kg
MNAC 13 70 g/mouse
aDl l = 2 mg/kg Days 3 to 31
8, at days 3,4,5,6,7,8,9,10 after lesion
MNAC 13 30 g/mouse
= 0.9 mg/kg
Mechanical allodynia was measured by means of a plantar dynamic aesthesiometer
(Ugo Basile), as indicated in Table I. Day 3 was considered the baseline.
The same protocols were used to assess the analgesic action of the humanised
versions
of the two antibodies MNAC 13 and aD 11.
Statistical analysis of results (CCI experitnents)
The results were expressed in 2 different ways, both as an absolute value of
the
threshold force value (in grams) that was sufficient for the animal to retract
the hind leg
that is ipsilateral to the lesion, or in percentage value, as the ratio
between the absolute
values of the hind legs (ipsilateraUcontralateral). The values were subjected
to statistical
analysis by means of an analysis of the variance (ANOVA) for repeated
measurements,
in which both the "treatment" factor and the repeated measurement (days) were
significant with p< 0.01.
RESULTS
Bindira~
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
A BIACORE study was performed, aimed at further characterising the binding
properties of the aDl 1 anti-NGF antibody (and its humanized variant) by
evaluating the
binding affinity of this antibody for mouse NGF and recombinant mouse pro-NGF.
Fig.
1 shows the results of these experiments: the aDll antibody binds with
different
5 kinetics on NGF and proNGF. Similar results were also obtained with Hu-aD
11.
The very small dissociation constant from NGF is representative of a very
tight binding
of the antibody to its antigen, and is quite a unique example among antibodies
binding
kinetics. By comparing the anti-NGF antibody binding to NGF and to proNGF, it
is
possible to assess that, in the latter case, the affinity is almost three
orders of magnitude
10 lower (nanomolar instead of picomolar). Considering that proNGF differs
from NGF
only by a short stretch of additional amino acids, this difference in binding
affinities is
absolutely unexpected and surprising.
As proNGF preferably binds to p75 (Lee, 2001), whereas mature NGF has a higher
affinity for the TrkA receptor, aDl1 and HuaDl1 can be considered as novel
selective
15 inhibitors of the Tr1cA-mediated pathway, a remarkable property that has a
particular
relevance in view of the clinical use of anti-NGF neutralizing antibodies.
In ammatory pain
A first set of in vivo experiments, performed in mice and concerning formalin-
evoked
pain (inflammatory pain), demonstrated that:
20 (i) the aDl1 anti-NGF antibody (in Fab format) was able to significantly
reduce the
pain response (fonnalin test: phase 2), as compared to an irrelevant Fab;
(ii) the same result could be obtained by replacing aD11 with its humanized
variant
(Hu-aDl l, Fig.2).
This means that Hu-aD 11 displays as powerful analgesic properties as aD 11 in
a
relevant model of inflammatory pain.
Neuropathic pain
The results on the CCI model showed that the two blocking antibodies MNAC13
and
aDl 1 (Fig. 3 and Fig. 4) had a significant analgesic effect. In particular, a
similar result
was observed for the two antibodies at the 1.4 mg/lcg dose. As shown in Fig. 3
and Fig.
4, they started to have an analgesic effect from the second day of
administration (day 4),
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
21
reaching the maximum effect around day 6, keeping substantially the same
analgesic
efficacy for the entire duration of the observation until day 14. Expressing
the result in
percentage terms (ratio between the threshold force of the hindpaw ipsilateral
to lesion
and that corresponding to the contralateral hindpaw), as in Fig. 4, it can be
stated that
for each of the two blocking antibodies, the maximum percentage value was
around
60%, being around 40% for the control groups (IgG and saline).
When the animals were observed for 4 weelcs, up to day 31, administration of
the
antibodies blocking the NGF-TrkA system (Fig. 5 and Fig. 6) revealed a two-
phase
effect. The first phase of analgesic efficacy (from day 3 to day 17, i.e.
until a week after
the last injection) was characterised by a maximum effect around days 11-12.
After a
reduction of the effect (up to day 17), a second analgesic phase was observed
with an
increase in the effect up to day 31. Two phases in the analgesic action of
NGF/TrkA
blocking antibodies can therefore be distinguished: the first
("pharmacological" effect),
that comprises the treatment period and the first week after the last
injection of antibody
(the week during which the effect diminishes, parallel to the haematic
concentration of
the antibody); the second, which identifies a long-term effect, probably
requiring new
genic expression, which is an effect that gives these antibodies the unique
feature (in the
field of neuropathic pain) of being a "disease-modifying" active principle,
i.e. capable
of modifyiuig in depth the course of the disease, unlike the products
currently used in
this therapeutical context, which demonstrate a simple pharmacological effect
on the
symptoms. In Fig.5, the analgesic effect of the 2 doses of MNAC13 anti-TrkA (2
and
0.9 mg/Kg) was compared with that of aDll (2 mg/kg). The results are expressed
in
percentage terms. The temporal profile of aDl l efficacy is similar to that of
MNAC13,
although, , at day 17, the animals treated with aDl1 were indistinguishable
from the
controls (IgG), whilst all those treated with MNAC13 still differed
significantly
(p<0.01). From day 21 aD 11 recovered analgesic effect, which reached a final
level
(day 31) that was similar to that of MNAC13 (greater than 60%, as compared to
40% of
controls).
Substantially identical results to those illustrated above were obtained when
instead of
the aDll antibody, the variants of its humanised version (Hu-aDll) were
employed
(dose used: 2 mg/lcg for each antibody), confirming that the latter have the
same
analgesic properties as the parental version. The antibody was humanised with
the
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
22
method of W02005/061540, both at the light (SEQ ID No. 3) and the heavy chain
(SEQ
ID No. 4) variable regions. To construct whole humanised antibodies, different
constant
regions were utilised, as above described (SEQ ID No. 5-8).
As typical example of the equivalence in terms of analgesic activity (CCI) of
parental
and humanized antibodies, Fig. 6 shows the comparison between aD11 and Hu-aDl1
(IgG4 format).
On this basis, it is possible to state that Hu-aD11 has the same long-term
effect as its
parental version.
BIBLIOGRAPHY
Bennett GJ, Xie YK (1988). Pain 33:87-107.
Berardi N, Cellerino A, Domenici L, Fagiolini M, Pizzorusso T, Cattaneo A,
Maffei L
(1994) Proc Natl Acad Sci U S A 91:684-688.
Bolt S, Routledge E, Lloyd I, Chatenoud L, Pope H, Gorman SD, Clark M,
Waldmann
H (1993) Eur J Immu.no123: 403-411.
Burnstock G (2001) Trends Pharmacol Sci 22:182-188.
Capsoni S, Ugolini G, Comparini A, Ruberti F, Berardi N, Cattaneo A (2000)
Proc Natl
Acad Sci U S A 97:6826-6831.
Cattaneo A, Rapposelli B, Calissano P (1988) J Neurochem 50:1003-1010.
Cattaneo A, Capsoni S, Margotti E, Righi M, Kontsekova E, Pavlik P, Filipcik
P, Novak
M (1999) J Neurosci 19:9687-9697.
Chuang HH, Prescott ED, Kong H, Shields S, Jordt SE, Basbaum AI, Chao MV,
Julius
D (2001) Nature 411:957-962.
Covaceuszach S, Cattaneo A, Lamba D (2001) Acta Crystallogr D Biol Crystallogr
57:1307-1309.
Covaceuszach S, Cassetta, A., Cattaneo A, Lamba D (2004) Acta Crystallogr D
Biol
Crystallogr 60:1323-1327.
Covaceuszacli S, Cattaneo A, Lamba D (2005) Proteins 58:717-727.
Djouhri L, Dawbalzi D, Robertson A, Newton R, Lawson SN (2001) J Neurosci
21:8722-8733.
Frade JM, Barde YA (1998) Bioessays 20:137-145.
1
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
23
Galfre G, Milstein C (1981) Methods Enzymol 73:3-46.
Gonfloni S (1995) Recombinant antibodies as structural probes for
neurotrophins.
SISSA PhD Thesis.
Harpf C, Dabemig J, Humpel C (2002) Muscle Nerve 25:612-615.
Hempstead BL (2002) Curr Opin Neurobiol 12:260-267.
Holtzman DM, Li Y, Parada LF, Kinsman S, Chen CK, Valletta JS, Zhou J, Long
JB,
Mobley WC (1992) Neuron 9:465-478.
Horigome K, Pryor JC, Bullock ED, Johnson EM, Jr. (1993) J Biol Chem 268:14881-
14887.
Hunt SP, Mantyh PW (2001) Nat Rev Neurosci 2:83-91.
Indo Y (2001) Huin Mutat 18:462-471.
Indo Y, Tsurata M, Hayashida Y, Karim MA, Ohta K, Kawano T, Mitsubuchi H,
Tonoki H, Awaya Y, Matsuda I(1996) Nat Genet 13:485-488.
Indo Y, Mardy S, Miura Y, Moosa A, Ismail EA, Toscano E, Andria G, Pavone V,
Brown DL, Brooks A, Endo F, Matsuda I(2001) Hum Mutat 18:308-318.
Julius D, Basbaum Al (2001) Nature 413:203-210.
Kaplan DR (1998) Prog Brain Res 117:35-46.
Kawamoto K, Aoki J, Tanaka A, Itakura A, Hosono H, Arai H, Kiso Y, Matsuda H
(2002) J Iinmunol 168:6412-6419.
Khakh BS (2001) Nat Rev Neurosci 2:165-174.
Kryger GS, Kryger Z, Zhang F, Shelton DL, Lineaweaver WC, Buncke HJ (2001) J
Hand Surg [Am] 26:635-644.
Lee R, Kennani P, Teng KK, Hempstead BL (2001) Science 294:1945-1948.
Levi-Montalcini R (1987) Science 237:1154-1162.
Levi-Montalcini R, Skaper SD, Dal Toso R, Petrelli L, Leon A (1996) Trends
Neurosci
19:514-520.
Levine JD (1998) Neuron 20:649-654.
Molnar M, Ruberti F, Cozzari C, Domenici L, Cattaneo A (1997) Neuroreport
8:575-
579.
Molnar M, Tongiorgi E, Avignone E, Gonfloni S, Ruberti F, Domenici L, Cattaneo
A
(1998) Eur J Neurosci 10:3127-3140.
Morisset V, Ahluwalia J, Nagy I, Urban L(2001) Eur J Pharmaco1429:93-100.
CA 02610596 2007-12-03
WO 2006/131951 PCT/IT2006/000426
24
Nakatsuka T, Furue H, Yoshimura M, Gu JG (2002) J Neurosci 22:1228-1237.
Nilsson G, Forsberg-Nilsson K, Xiang Z, Hallbook F, Nilsson K, Metcalfe DD
(1997)
Eur J Imxuunol 27:2295-2301.
Porro CA, Cavazzuti M (1993) Spatial and temporal aspects of spinal cord and
brainstem activation in the formalin pain model. Prog Neurobio141: 565-607.
Pesavento E, Margotti E, Righi M, Cattaneo A, Domenici L (2000) Neuron 25:165-
175.
Ruberti F, Capsoni S, Comparini A, Di Daniel E, Franzot J, Gonfloni S, Rossi
G,
Berardi N, Cattaneo A (2000) J Neurosci 20:2589-2601.
Saper CB, German DC, White CL, 3rd (1985) Neurology 35:1089-1095.
Saragovi HU, Gelu-ing K (2000) Trends Pharmacol Sci 21:93-98.
Sevcik MA, Ghilardi JR, Peters CM, Lindsay TH, Halvorson KG, Jonas BM, Kubota
K,
Kuskowski MA, Boustany L, Shelton DL, Mantyh PW (2005) Pain 115:128-141.
Shu X, Mendell LM (1999) Neurosci Lett 274:159-162.
Sivilotti L, Nistri A(1991) Prog Neurobiol 36:35-92.
Woolf CJ, Ma QP, Allchorile A, Poole S (1996) J Neurosci 16:2716-2723.
Zhu Z, Friess H, diMola FF, Zimmermann A, Graber HU, Korc M, Buchler MW (1999)
J Clin Oncol 17:2419-2428.
