Note: Descriptions are shown in the official language in which they were submitted.
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
The intestine and muscle recovery
The present invention generally relates to the field of
nutrition and health. In particular, the present invention
provides a composition that allows it to treat, limit or
prevent muscle atrophy. Embodiments of the present invention
are directed at GLP-2 containing compositions and to
compositions that stimulate the secretion of GLP-2 in a body
to treat or prevent muscle atrophy.
Muscle wasting in catabolic states is an indirect cause of
morbidity and mortality because the ability of the organism to
recover from such catabolic events is strongly impaired.
Therefore, a major challenge in clinical nutrition is to
improve whole-body protein balance, and hence protein balance
in skeletal muscle, which is the major reservoir of body
proteins. However, anabolic molecules such as insulin,
branched-chain amino acids, or glutamine have minor if any
positive effects on muscles in cachectic patients.
It was recently shown in young starved/refed rats that
skeletal muscle ubiquitin-proteasome-dependent proteolysis is
poorly responsive to increases in both plasma insulin and
amino acid levels. This conclusion is based on in vitro
measurements of muscle proteolysis proteolytic inhibitors
(including the proteasome inhibitor MG132), on gene expression
of several components of the ubiquitin-proteasome pathway, and
on rates of ubiquitination in skeletal muscle (Kee, A.J., et
al., 2003, Journal of Physiology 546:765-776).
If a decrease in the mass of a muscle occurs, then this
condition is commonly named "muscle atrophy". Muscle atrophy
is characterized by a partial loss of muscle mass. This muscle
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
atrophy is related either to decrease protein synthesis or to
increase protein degradation or to both of them. The
consequence of muscle atrophy is usually an impaired quality
of life. Daily tasks are becoming more and more difficult to
perform and sudden weaknesses may cause accidents. Subjects
suffering from muscle atrophy are often elderly subjects
and/or subjects suffering from disorders that have shrinking
muscle mass as a consequence.
Functional electrical stimulation or simply exercise is
typical measures to work against muscle atrophy. However,
depending on the general condition of the subject to be
treated, these methods may not always be applicable.
It would hence be desirable to have available a composition
which allows it to treat or prevent muscle atrophy and which
also can be used in subjects that are unable to increase their
physical activity.
Consequently, it was the object of the present invention to
improve the state of the art and to provide an ingestible
composition for treating or preventing muscle atrophy.
The present inventors achieved this object by providing the
subject matter of the independent claims. The dependent claims
further develop the present invention.
The inventors have performed an in vivo experiment to study
the effect of GLP-2 administration on protein metabolism in
young rats in a starvation/refeeding model.
It was found that starvation-induced small intestine atrophy
in young rats is associated with increased cathepsin and
proteasome activities. A GLP-2-induced increase in small
2
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
intestine mass was associated with reduced cathepsin
activities both in the jejunum and the ileum, whereas
peptidase activities of the proteasome were not modified. The
GLP-2 treatment of starved rats (i) reduced small intestine
atrophy, (ii) prevented the increased activity of some
cathepsins, and (iii) limited the decrease in villus height
and crypt depth of the jejunum.
Finally, GLP-2 administration did accelerate the recovery of
both small intestine and skeletal muscle masses when fasted
rats were refed for 6h or 24h.
In this present work the atrophy of the small intestine
induced by starvation was reduced by 16% when rats received
GLP-2. The small intestine totally recovered after 24h of
refeeding in GLP-2 treated rats, whereas 26% of atrophy still
prevailed in untreated animals.
Importantly, the skeletal muscle mass recovery paralleled the
small intestinal recovery, and was accelerated in GLP-2-
treated rats. Skeletal muscles are likely not to carry GLP-2
receptors. Thus, altogether these observations show that the
manipulation of the small intestinal mass has a beneficial
impact on skeletal muscle mass.
In addition, manipulating the mass of viscera has an impact on
muscle mass. The inventors presently believe that both,
intestinal and liver protein masses, are highly labile and
rapidly degraded by the lysosomal pathway, so that
manipulating liver mass as manipulating small intestinal mass
will have an impact on muscle mass.
To the inventors best knowledge was this the first study
demonstrating that manipulating the small intestine mass has a
3
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
beneficial impact on skeletal muscle masses, for example
during recovery periods following catabolic conditions such as
fasting.
These findings may be applied in all conditions where it is
desired to accelerate small intestine and/or skeletal muscle
recovery, for example in clinical situations.
The present work also shows that there is a prioritization in
the anabolic effect of nutrition: the recovery of the
intestine always precedes the recovery of muscle mass.
Consequently, the present invention relates to a composition
that supports the recovery of the intestine for treating or
preventing muscle atrophy.
It also relates to the use of a composition that supports the
recovery of the intestine for the preparation of a composition
to treat or prevent muscle atrophy.
Compositions that support the recovery of the intestine are
known to the skilled artesian.
For example, a composition that supports the recovery of the
intestinal mass may be a composition comprising intestinal
trophic factors. Intestinal trophic factors are known to those
skilled in the art and comprise growth hormones (GH), and/or
vasoactive intestinal peptide (VIP), for example.
Further, a composition that supports the recovery of the
intestinal mass may be a composition comprising glucagon-like
peptide 2 (GLP-2) and/or a composition that stimulates the
secretion of GLP-2 in a body.
4
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
Consequently, the present invention relates to a composition
comprising glucagon-like peptide 2 (GLP-2) for treating or
preventing muscle atrophy.
The present invention also relates to the use of glucagon-like
peptide 2 (GLP-2) for the preparation of a composition to
treat or prevent muscle atrophy.
Glucagon-like peptide 2 (GLP-2) is a 33-amino acid peptide
derived from the tissue-specific, post-translational
processing of the proglucagon gene expressed in the intestinal
enteroendocrine L-cells.
Drucker et al, Gut, 2002, 50, 428-435 and Burrin et al.
Journal of Nutrition, 2001, pages 709-712, report that there
is relatively high homology (87-97%) in the GLP-2 peptide
sequence among the species, including humans, pigs, cows and
rats. Hence, the GLP-2 of the present invention includes human
GLP-2 and proteins with at least 87% sequence homology to
human GLP-2, preferably at least 90 % sequence homology to
human GLP-2, for example at least 95 % sequence homology to
human GLP-2.
Human GLP-2 has the following sequence:
HADGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ-ID No. 1)
For example the A at position 2 may be replaced by a G to
prevent degradation of GLP-2 by dipeptidyl peptidase IV (DP IV)
and thus to increase its half-life. The resulting GLP-2 has
the following sequence:
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ-ID No. 2)
Further GLP-2 proteins that may be used for example in
accordance with the present invention are the following:
5
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
HADGSFSDEMNTILDNLATRDFINWLIQTKITD (SEQ-ID No. 3), or
HGDGSFSDEMNTILDNLATRDFINWLIQTKITD (SEQ-ID No. 4).
An embodiment of the present invention relates also to a
composition comprising glucagon-like peptide 2 (GLP-2) and/or
a formulation stimulating the secretion of GLP-2 in a body
having a caloric density in the range of 0.8-2.0 kcal/ml with
at least 10% of the calories resulting from fat and/or at
least 25% of the calories resulting from carbohydrates for use
in the treatment, limitation and/or prevention of muscle
atrophy.
While GLP-2 may be ingested to achieve the object of the
present invention, the present invention also relates to
compositions that when ingested stimulate GLP-secretion for
treating or preventing muscle atrophy.
One embodiment of the present invention is hence a composition
that stimulates the secretion of GLP-2 in a body for treating
or preventing muscle atrophy.
The primary stimulus for GLP-2 secretion is nutrient intake.
Xiao, Q., et al. report in Gastroenterology 117: 99-105 (1999)
that N-IR-GLP-2 levels were found to increase after mixed
meals and in - in particular - in response to carbohydrate and
fat.
A composition that stimulates the secretion of GLP-2 in a body
may hence be a composition rich in carbohydrates and/or fat.
Such a composition may have a caloric density in the range of
0.8-2.Okcal/ml with at least 10% of the calories resulting
from fat and/or at least 25% of the calories resulting from
carbohydrates. The composition may or may not comprise a
6
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
protein source. The protein source - if present - will provide
at most 10% of the calories of the composition.
The composition of the present invention may contain at least
one protein source, at least one carbohydrate source and/or at
least one lipid source.
If the composition contains a carbohydrate source, the kind of
carbohydrate to be used is not particularly limited. Any
suitable carbohydrate may be used, for example sucrose,
lactose, glucose, fructose, corn syrup solids, maltodextrins,
starch and mixtures thereof. Combinations of different
carbohydrate sources may be used. The carbohydrate source may
be present in the composition in an amount of 7.0-19.0
g/100kcal of the composition.
If the composition contains a lipid source, the kind of lipid
to be used is not particularly limited. Long chain n-3 and/or
n-6 polyunsaturated fatty acids, such as DHA, ARA and/or EPA
may be added. A suitable fat profile may be obtained using a
blend of canola oil, corn oil, high-oleic acid sunflower oil
and medium chain triglyceride oil. The lipid source may be
present in the composition in an amount of 1.5-5.0 g/100kcal
of the composition.
If present, the protein source may contain any dietary protein,
for example animal proteins (such as milk proteins, meat
proteins and egg proteins); vegetable proteins (such as soy
proteins, wheat proteins, rice proteins, and pea proteins);
peptides; mixtures of free amino acids; or combinations
thereof.
Milk proteins such as casein and whey, and soy proteins may be
preferred. As far as whey proteins are concerned, the protein
7
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
source may be based on acid whey or sweet whey or mixtures
thereof and may include alpha- lactalbumin and beta-
lactoglobulin in whatever proportions are desired. The protein
source may also include bovine serum albumin, acid casein,
caseinates, a-casein, R-casein, y-casein. The protein source
may be present in the composition in an amount of 2.0 -8.5
g/100kcal of the composition.
The proteins may be intact or hydrolysed or free amino acids.
A mixture of intact and/or hydrolysed proteins and/or free
amino acids may be used. It may be desirable to supply
partially hydrolysed proteins (degree of hydrolysis (DH)
between 2 and 20%) to facilitate absorption.
If hydrolysed proteins are required, the hydrolysis process
may be carried out as desired and as is known in the art. For
example, a whey protein hydrolysate may be prepared by
enzymatically hydrolysing the whey fraction in one or more
steps.
Dietary fibre may be added as well. They may be soluble or
insoluble and in general a blend of the two types is preferred.
Suitable sources of dietary fibre include soy, pea, oat,
pectin, guar gum, arabic gum, fructooligosaccharides, galacto-
oligosaccharides, sialyl-lactose and oligosaccharides derived
from animal milks. A preferred fibre blend is a mixture of
inulin with shorter chain fructo-oligosaccharides.
A composition of the present invention may be prepared by any
manner known in the art. For example, if the composition is a
nutritional formula, such as clinical nutrition formula or an
infant feeding formula it may be prepared by blending together
a protein source, a carbohydrate source, and a fat source in
appropriate proportions. If used, emulsifiers may be included
8
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
in the blend. Vitamins and minerals may be added at this point
but are usually added later to avoid thermal degradation. Any
lipophilic vitamins, emulsifiers and the like may be dissolved
into the fat source prior to blending. Water, preferably water
which has been subjected to reverse osmosis, may then be mixed
in to form a liquid mixture.
The liquid mixture may then be thermally treated to reduce
bacterial loads. For example, the liquid mixture may be
rapidly heated to a temperature in the range of about 120 C to
about 140 C for about 5 seconds to about 30 seconds. This may
be carried out by steam injection or by heat exchanger; for
example a plate heat exchanger.
The liquid mixture may then be cooled to about 60 C to about
85 C; for example by flash cooling. The liquid mixture may
then be homogenised; for example in two stages at about 7 MPa
to about 40 MPa in the first stage and about 2 MPa to about 14
MPa in the second stage. The homogenised mixture may then be
further cooled to add any heat sensitive components; such as
vitamins and minerals.
The pH and solids content of the homogenised mixture is
conveniently standardised at this point. The homogenised
mixture is transferred to a suitable drying apparatus such as
a spray drier or freeze drier and converted to powder. The
powder should have a moisture content of less than about 5% by
weight.
GLP-2 may also be co-administered with a composition that
stimulates the secretion of GLP-2 in a body.
The composition of the present invention may be to be
administered to humans or animals, in particular pet animals.
9
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
It may further be to be administered to patients with an
intact colon.
The composition of the present invention may be any kind of
composition. The composition may be to be administered orally,
enterally, parenterally (intravenously or subcutaneously or
intramuscularly), for example.
For example it may be a pharmaceutical composition, a
nutraceutical, a food additive, a pet food, a food product, or
a drink.
Food products according to the present invention include dairy
products, such as fermented milk products, e.g., yoghurts,
buttermilk, etc; ice creams; concentrated milk; milk; dairy
creams; flavoured milk drinks; whey based drinks; toppings;
coffee creamers; chocolate; cheese based products; soups;
sauces; purees; dressings; puddings; custards; baby foods;
nutritional formulas, such as those for complete nutrition,
for example for infants, children, teenagers, adults, the
elderly or the critically ill; cereals and cereal bars, for
example.
Drinks include for example milk- or yoghurt based drinks,
fermented milk, protein drinks, coffee, tea, energy drinks,
soy drinks, fruit and/or vegetable drinks, fruit and/or
vegetable juices.
A food additive or a medicament may be in the form of tablets;
capsules; pastilles; sachets; gels; or liquids, e.g.,
nutritional solutions; for example.
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
The compositions may further contain protective hydrocolloids
(such as gums, proteins, modified starches), binders, film
forming agents, encapsulating agents/materials, wall/shell
materials, matrix compounds, coatings, emulsifiers, surface
active agents, solubilizing agents (oils, fats, waxes,
lecithins etc.), adsorbents, carriers, fillers, co-compounds,
dispersing agents, wetting agents, processing aids (solvents),
flowing agents, taste masking agents, weighting agents,
jellifying agents, gel forming agents, antioxidants and
antimicrobials. They may also contain conventional
pharmaceutical additives and adjuvants, excipients and
diluents, including, but not limited to, water, gelatine of
any origin, vegetable gums, ligninsulfonate, talc, sugars,
starch, gum arabic, vegetable oils, polyalkylene glycols,
flavouring agents, preservatives, stabilizers, emulsifying
agents, buffers, lubricants, colorants, wetting agents,
fillers, and the like.
Further, the compositions may contain an organic or inorganic
carrier material suitable for oral or enteral administration
as well as vitamins, minerals trace elements and other
micronutrients in accordance with the recommendations of
Government bodies such as the USDA.
A stabilizing agent may be added to stabilize the composition
and its constituents.
A flavouring agent and/or a colouring agent may be added to
adjust flavours and to give the composition a colour that is
easy to identify and/or that is perceived as pleasant.
The compositions of the present invention may be used to
improve skeletal muscle recovery. This may be needed in
particular in the field of clinical nutrition.
11
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
The compositions of the present invention may also be used to
improve small intestine and muscle mass recovery.
Importantly, the recovery of the small intestine and of muscle
mass, e.g., skeletal muscle mass may be improved
simultaneously by using the compositions described in the
present invention.
The compositions of the present invention may also be for use
in increasing liver protein mass regain.
Consequently, this combined effect may be achieved by
administering only one composition namely a composition
comprising glucagon-like peptide 2 (GLP-2),a composition that
stimulates the secretion of GLP-2 in a body, or a combination
of both.
The compositions of the present invention may be to be
administered during or after a period of malnutrition.
A period of malnutrition may - for example - be caused by
several clinical conditions such as various acute or chronic
disorders, e.g., infection, cancer, AIDS, burn injury, trauma,
and other. Malnutrition may of course also follow from
insufficient food intake or from the consumption of a diet
that does not supply all nutrients in sufficient amounts.
Those of skill in the art will understand that all features
described with respect to present invention may be combined
without departing from the scope of the invention as disclosed.
In particular, features described with respect to the
compositions of the present invention may be applied to the
used described herein and vice versa.
12
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
Further features and advantages of the present invention are
apparent from the following examples, tables and figures.
Figure 1. Morphometric analysis and measurements of villus
height (A) and crypt depth (B) in the Jejunum. Values are
means SEM (vertical bars) for n=5 animals and are expressed
as % of fed controls. Fed rats (closed bars); starved rats
(open bars) Bars with different letters are significantly
different (P < 0.05).
Figure 2. Morphometric analysis and measurements of villus
height (A) and crypt depth (B) in the ileum. Values are means
SEM (vertical bars) for n=5 animals and are expressed as %
of fed controls. Fed rats (closed bars), starved rats (open
bars). Bars with different letters are significantly different
(P < 0.05).
Figure 3. Chymotrypsin- and trypsin-like activities of the
proteasome in the jejunum (A) and the ileum (B) from saline-
or GLP-2- injected fed and starved rats. Data represent the
slopes of best fit of arbitrary fluorescence units released
from the fluorescent substrates (see Examples section) vs.
time. Values are expressed in % of saline-injected fed rats
and are means SEM (vertical bars) for 5 animals per group.
Saline injected-fed rats (open bars), GLP-2 injected-fed rats
(hatched bars), saline injected-starved rats (closed bars) and
GLP-2 injected-starved rats (dot bars) . Bars with different
letters are significantly different (P < 0.05).
Figure 4. Cathepsin (B, B+S, B+L+S and D) activities in the
jejunum (A) and the ileum (B) from saline- or GLP-2- injected
fed and starved rats. Data represent the slopes of best fit of
arbitrary fluorescence units released from the fluorescent
13
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
substrates (see Material and methods section) vs. time. Values
are expressed in % of saline-injected fed rats and are means
SEM (vertical bars) for 5 animals per group. Saline injected-
fed rats (open bars), GLP-2 injected-fed rats (hatched bars),
saline injected-starved rats (closed bars) and GLP-2 injected-
starved rats (dot bars). Bars with different letters are
significantly different (P < 0.05).
Figure 5. Small intestinal mass in saline- or GLP-2-injected
rats following 48h of starvation and 6 or 24h of refeeding.
Data are means SEM for 5 animals per group. Fed rats (open
bars), starved rats (closed bars), 6h refed-starved rats
(hatched bars) and 24h refed-starved rats (grey bars) . Bars
with different letters are significantly different (P < 0.05).
Figure 6. Tibialis anterior, gastrocnemius and EDL muscle
masses in saline- or GLP-2-injected rats following 48h of
starvation and 6 or 24h of refeeding. Data are means SEM for
5 animals per group. Fed rats (open bars), starved rats
(closed bars), 6h refed-starved rats (hatched bars) and 24h
refed-starved rats (grey bars). Bars with different letters
are significantly different (P < 0.05).
Table 1: Body weight, small intestinal and skeletal muscle
mass of fasted rats. Data are means SEM, n=8 rats per group.
Values within a row with different superscripts are
significantly different (P < 0.05).
Table 2: Enzyme activities in rat small intestine after
starvation. Data are expressed in % of Fed controls and are
means SEM, n=8 rats per group. Values within a row with
different superscripts are significantly different (P < 0.05).
14
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
Table 3: Role of GLP-2 on starvation-induced body weight loss
and intestine atrophy. Data are means SEM, n=13-15 rats per
group. Statistical differences were assessed by two-way ANOVA,
followed by the "a posteriori" test of PLSD Fisher's. N,
starvation effect; G, GLP-2 effect. Values within a row with
different superscripts are significantly different (P < 0.05).
Table 4: Role of GLP-2 on starvation-induced skeletal muscle
atrophy. Data are means SEM, n=5 rats per group. Statistical
differences were assessed by two-way ANOVA, followed by the "a
posteriori" test of PLSD Fisher's. N, starvation effect; G,
GLP-2 effect. Values within a row with different superscripts
are significantly different (P < 0.05).
Examples:
Materials
Rat recombinant GLP-2 was purchased from Washington
Biotechnology Inc. (Columbia, MD, USA) . [Ala] in position 2
was substituted by [Gly] to make the peptide resistant to DPP
IV degradation. The GLP-2 peptide sequence used in this study
is as follows: HGDGSFSDEMNTILDNLATRDFINWLIQTKITD.
Animals, Housing and Experimental Design
Young male Wistar rats (50-60 g) were obtained from Charles
River (L'Arbresle, France) and maintained in a temperature
controlled room (22 1 C) with a 12 h light/12 h dark cycle.
They were given free access to a standard rodent diet (A03;
UAR, Epernay sur Orge, France) and to water during a 5 days
acclimatization period. Three experiments were conducted. (1)
In the first experiment, rats were fed ad libitum or fasted
for 1 or 2 days. At the end of the fasting period, rats were
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
anesthetized with intraperitoneal injection of urethane (1.7
g/kg body weight, Sigma Aldrich, Lyon, France) and sacrificed.
(2) In the second experiment, animals were randomly divided
into control and GLP-2 treated groups (n=26-30 per group).
Injections of saline (400 pL) or GLP-2 (20 }gig/400 pL of saline)
every 12 h started at day 0 and continued until the end of the
experiment. At day 4, half of each group was deprived of food
for 2 days. At day 6, animals were sacrificed as described. (3)
In the last experiment, rats were allocated as described in
experiment 2. Control and GLP-2 treated groups (n=20 per group)
were divided into 2 groups of fed (n=5) and starved rats
(n=15). Saline and GLP-2 injections continued until the
sacrifice of the rats. At day 6, 5 rats from the fed and the
48h-fasted groups treated or not with GLP-2 were sacrificed as
described. The remaining fasted animals from the control and
GLP-2 treated groups were refed ad libitum from day 6 for 6 or
24h. After refeeding, rats were sacrificed as described.
Tissue Collection
The entire small intestine was rapidly excised, rinsed three
times with ice-cold PBS, blotted and weighed. Ten cm caudal to
the pyloric sphincter and ten cm cranial to the ileo-caecal
junction were taken and discarded. Jejunum and ileum were
excised, weighed, and divided in small pieces of 5 cm. The
first piece was immediately processed for cathepsin activities.
The remaining pieces were frozen in liquid nitrogen, and
stored at -80 C until further analyses. In experiment 3,
skeletal muscles (EDL, gastrocnemius and tibialis anterior)
were also carefully dissected and weight.
Cathepsin Activities
16
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
The five cm pieces of jejunum and/or ileum were immediately
homogenized using a polytron homogenizer in a 10 mmol/L
phosphate buffer (pH 7.4) containing 50 mmol/L KC1, 1 mmol/L
EDTA and 0.25 mol/L sucrose as described previously.30
Homogenates were then centrifuged at 1,000g (10 minutes, 4 C).
The supernatant was centrifuged at 2,500g (10 minutes, 4 C)
and then again at 40,000g (20 minutes, 4 C). The pellet was
resuspended in 20 mmol/L sodium acetate buffer (pH 5.5)
containing 0.2 mmol/L EDTA and stored at -20 C until further
analysis. Cathepsin B and cathepsin B+L+S activities were
determined using the fluorogenic substrates Z-arginine-
arginine-AMC (ZAA-AMC, 50 pmo l / L , Sigma), Z-phenylalanine-
arginine-AMC (ZPA-AMC, 30 pmol/L, Sigma), respectively.30
Neutral pH reducing the cathepsin L activity, the bulk of the
cathepsin B+L+S activity measured with ZPA-AMC at pH 7.0
reflects the cathepsin B+S activity. The cathepsin D activity
was determined using the fluorogenic substrate MOCAc-Gly-Lys-
Pro-Ile-Leu-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 (MOCA, 20 pmol/L,
Peptide Institute Inc, Osaka, Japan). The peptidase activities
were determined by measuring the accumulation of the
fluorogenic cleavage product (methylcoumaryl-amide, AMC) at
37 C during 45 minutes using a luminescence spectrometer
FLX800 (Biotek). Fluorescence was measured continuously at 380
nm excitation and 440 nm emission wavelengths. The time course
for the accumulation of AMC after hydrolysis of the substrate
was analyzed by linear regression to calculate peptidase
activities, e.g. the slopes of best fit of accumulated AMC.
The final data were corrected by the amount of protein in the
reaction.
Proteasome Activities
Proteins from pieces of jejunum and/or ileum were homogenized
using a polytron homogenizer, in ice-cold buffer (pH 7.5)
17
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
containing 50 mmol/L Tris/HC1, 5 mmol/L MgCl2, 250 mmol/L
sucrose, 10 mmol/L ATP, 1 mmol/L DTT, 10 pg/mL aprotinin, 10
pg/mL leupeptin, 10 pg/mL antipain, 10 pg/mL pepstatin A, and
0.2 mmol/L phenylmethylsulphonylfluoride (PMSF). Proteasomes
were isolated as described.31 Proteasome pellets were
resuspended in buffer containing 50 mmol/L Tris/HC1, 5 mmol/L
MgCl2, and 20% glycerol. The isolated proteasomes were stored
at -80 C until analysis. The protein content of the proteasome
preparation was determined using the Biorad protein assay
following the manufacturer instructions. The chymotrypsin-,
the trypsin-like activities were determined using the
fluorogenic substrates succinyl-leu-leu-val-tyr-AMC (Suc-LLVY-
AMC, 300 pmol/L, Sigma) and boc-leu-arg-arg-AMC (Boc-LRR-AMC,
800 pmol/L, Biomol International LP, Exeter, Devon, UK)
respectively, in the presence and in the absence of the
proteasome inhibitor MG132 (40 pmol/L, Sigma). The
accumulation of AMC at 37 C during 45 minutes was measured
continuously as described for cathepsin activities
measurements. The difference between arbitrary fluorescence
units recorded with or without 40 pmol/L ^of the proteasome
inhibitor MG132 (Affiniti) in the reaction medium was
calculated. The final data were corrected by the amount of
protein in the reaction.
Histologic and Morphometric Measurements
Tissue samples from jejunum and ileum were fixed in 10%
formaldehyde buffered with Na2CO3 (10 g/L) and processed for
villus height and crypt depth measurements. Treatment
designation of slides was blinded at the time of measurement.
Statistics
18
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
Data are expressed as means SEM. One-way or two-way ANOVA
were used to address for fasting effect in experiment 1 and
for fasting and GLP-2 effects experiment 2 and 3. A posteriori
PLSD Fisher's test was performed in order to assess for
differences among groups. P values < 0.05 were considered
statistical significance and P values < 0.10 were considered
statistical tendency.
Results
Small intestine peptidase activities following fasting
Table 1 shows that fasting induced a strong and progressive
loss of body weight following 1 and 2 days of food deprivation
(-16% and -28%, respectively). The mass of the small intestine
and the EDL muscle decreased progressively until 2 days of
starvation to reach 27% of atrophy (Table 1).
To characterize the role of proteolysis in the small intestine
atrophy, peptidase activities from the lysosomal and the
proteasome dependent proteolytic pathways were assessed in the
jejunum (Table 2).
Starvation induced an increase of the chymotrypsin- (+47%, ns),
the trypsin- (+66%), and the caspase-like (+111%) activities
of the 20S proteasome. In addition, cathepsin B, B+S, and
B+L+S activities increased by 34 to 38% in 48h starved rats
compared to fed animals. Cathepsin D activity increased as
soon as 24h of food deprivation (+91%) and still rose up to
161% after 48h of fasting. The atrophy of the small intestine
is thus correlated with an elevation of cathepsin and of
proteasome activities in the jejunum with a maximal effect
following 48h of food deprivation. The effects of GLP-2 on
small intestinal proteolysis were thus studied on fed and 48h
starved rats.
19
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
Effect of GLP-2 on starvation-induced body weight loss, small
intestine atrophy and histological modifications
The daily food intake of animals was not modified by the GLP-2
treatment (data not shown). Starvation induced a strong loss
of body weight which was similar between untreated and treated
groups (-25% and -22% respectively, P<0.0001, Table 3) . The
small intestine was strongly atrophied following starvation (-
29%, P<0.0001) and the atrophy was similar in the jejunum and
in the ileum (-32 and -22% respectively, P<0.001, table 3).
Two-way ANOVA analysis indicated that, in addition to the
atrophy induced by the starvation, GLP-2 treatment increased
total small intestinal, jejunal and ileal mass by 22%
(P<0.0001), 21% (P<0.0001) and 17.5% (P<0.005), respectively.
Although, the effect of starvation was similar in saline and
GLP-2 injected rats, the whole small intestine and the ileum
mass was similar in saline injected-fed rats and in GLP-2
treated-starved rats. In addition, GLP-2 limited the atrophy
of the jejunum in the GLP-2-treated starved rats (-12s6 vs.
saline injected-fed rats, P<0.005) compared with the untreated
starved rats (-32% vs. saline injected-fed rats, P<O.0001)
(Table 3) . Fasting induced a decrease of villus height and
crypt depth in the jejunum (-23% and -31% respectively, P<0.05,
Fig. 1). On the opposite, starvation induced only few
morphological changes in the ileum (Fig. 2) . In the jejunum,
GLP-2 treatment limited the reduction of the villus height (-
13%) and blocked the decrease of crypt depth following
starvation (Fig. 1). The effects of GLP-2 treatment were quite
different in the ileum since it had no effect on the villus
height and did not inhibit the reduction of crypt depth
following fasting (Fig. 2).
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
Effect of GLP-2 on starvation-induced elevation of peptidase
activities of the proteasome in the small intestine
In experiment 2, starvation induced a strong increase of
chymotrypsin-like (+ 98%, P<0.0001) and trypsin-like (+40%,
P<0.0005) activities of the proteasome in the jejunum (Fig. 3A)
but had no effect on these activities in the ileum (Fig. 3B)
in saline injected rats. Peptidase activities of the
proteasome in the jejunum (Fig. 3A) or in the ileum (Fig. 3B)
are not modified by the daily administration of GLP-2.
Moreover, GLP-2 treatment did not block the increase of the
chymotrypsin- and the trypsin-like activities seen in the
jejunum following fasting (Fig. 3A).
Lysosomal proteolytic activities were measured in both the
jejunum and the ileum. Cathepsin B+L+S and D activities were
increased following starvation in the jejunum by 25% (P<0.01)
and 90% (P<0.05), respectively (Fig. 4A). In addition,
cathepsin B and B+S activities tended to increase respectively
by 50% (P<0.10) and 31% (P>0.1) in the jejunum of starved rats.
By contrast, cathepsin B and B+L+S did not increase at all in
the ileum of starved rats compared with fed controls (Fig. 4B).
Interestingly, GLP-2 treatment blocked the increase in
cathepsin activities in the jejunum of starved rats (Fig 4A).
Furthermore, GLP-2 administration induced a decrease of
cathepsin B (-43%, P<0.002) and B+L+S (-50%, P<0.0005)
activities in the ileum compared with untreated rats, even
starvation did not modify the lysosomal activities in this
tissue (Fig. 4B). These results indicated that the GLP-2
protective effects on the jejunum may result from an
inhibition of the lysosomal pathway.
Effect of GLP-2 on starvation-induced skeletal muscle atrophy
21
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
The tibialis anterior, the gastrocnemius and the EDL muscles
atrophied by -20% (P<0.0001) following 2 days of starvation.
GLP-2 administration did not prevent this skeletal muscle loss.
However, GLP-2 is believed to be a physiologic regulator of
the dynamic adaptation of the gut mucosal epithelium in
response to luminal nutrients. Thus, the impact of GLP-2
treatment has been studied in refed rats following the 48h
starvation period. Figure 5 showed that GLP-2 treated animals
exhibited an accelerated recovery of the small intestinal mass
compared to saline injected animals. The small intestinal
atrophy was reduced to 15% (P<0.001) after 6h and totally
absent after 24h of refeeding when rats received the GLP-2,
while it still prevailed both at 6h (-32%, P<0.0001) and 24h
(-26%, P<0.0001) in saline injected rats. Interestingly,
skeletal muscle mass recovery paralleled the small intestine
recovery and was improved by the treatment. The tibialis
anterior (Fig. 6A), the gastrocnemius (Fig. 6B) and the EDL
(Fig. 6C) muscles were still atrophied respectively by 10%,
16.5% and 18% (P<0.0001) after 24h of refeeding in saline
injected rats. This was almost totally identical to the muscle
mass loss observed after 48h of starvation (Fig. 6). By
contrast, GLP-2 treatment enhanced the skeletal muscle
recovery. Tibialis anterior and EDL muscles totally recovered
after 24h of refeeding, whereas the gastrocnemius was still
slightly atrophied by 9% (P<0.05) compared to GLP-2 treated
fed rats.
22
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
SEQUENCE LISTING
<110> Nestec S.A.
<120> The intestine and muscle recovery
<130> NO 10200
<160> 4
<170> Patentln version 3.1
<210> 1
<211> 33
<212> PRT
<213> Homo sapiens
<400> 1
His Ala Asp Gly Ser Phe Ser Asp Glu Met Asn Thr Ile Leu Asp Asn
1 5 10 15
Leu Ala Ala Arg Asp Phe Ile Asn Trp Leu Ile Gln Thr Lys Ile Thr
20 25 30
Asp
<210> 2
<211> 33
<212> PRT
<213> Artificial
<220>
<223> Human GLP-2 sequence with an Ala-->Gly exchange in position
2
<400> 2
His Gly Asp Gly Ser Phe Ser Asp Glu Met Asn Thr Ile Leu Asp Asn
1 5 10 15
Leu Ala Ala Arg Asp Phe Ile Asn Trp Leu Ile Gln Thr Lys Ile Thr
20 25 30
Asp
<210> 3
<211> 33
<212> PRT
<213> Rattus rattus
23
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
<400> 3
His Ala Asp Gly Ser Phe Ser Asp Glu Met Asn Thr Ile Leu Asp Asn
1 5 10 15
Leu Ala Thr Arg Asp Phe Ile Asn Trp Leu Ile Gln Thr Lys Ile Thr
20 25 30
Asp
<210> 4
<211> 33
<212> PRT
<213> Artificial
<220>
<223> Rat GLP-2 sequence with an Ala-->Gly exchange in position 2
<400> 4
His Gly Asp Gly Ser Phe Ser Asp Glu Met Asn Thr Ile Leu Asp Asn
1 5 10 15
Leu Ala Thr Arg Asp Phe Ile Asn Trp Leu Ile Gln Thr Lys Ile Thr
20 25 30
Asp
45
24
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
Table 1:
Fed 1-day fasted 2-days fasted
Body weight (g) 96.3 2.2a 80.6 1.9b 68.5 1.0
Small intestinal weight (g) 5.48 0.21a 4.40 0.16' 4.03 0.13'
EDL (mg) 43.8 1.3a 38.1 0.9' 32.0 0.6c
Table 2:
Jejunum
Fed 1-day starved 2-days starved
Proteasome
Chymotrypsin-like 100 24.5a 143.9 20.2a 146.6 16.5a
Trypsin-like 100 15.9a 142.7 11.2b 165.8 17.5b
Caspase-like 100 24.0a 146.4 28.3a 210.6 36.2b
Lysosomal
Cathepsin B 100 6.9a 124.6 8.9ab 135.5 10.7b
Cathepsin B+S 100 11.Oa 119.9 15.7ab 134.3 11.8b
Cathepsin B+L+S 100 15.5a 115.7 14.5ab 138.2 12.4 b
Cathepsin D 100 10.8a 191.5 20.7 b 261.2 24.6 c
CA 02776964 2012-04-05
WO 2011/042501 PCT/EP2010/065021
z z z z
z z z
0 0
N N
N - o o a +I
0 0 0 õ~ ry
-H -H
N N
N o b o
N C)
cf)
o A
Id co r" ~
u
+ +
_ t
'-' --O O M pq
O O O to
-H +I +I o
V1 l Cl vl
7r C:) Gc
~ M N O
M
N `n ~ O
N O O O U M
r4 kr, + + +
=--n M =--"~
N
cn N N
N -H
o +I
N o 0 0 +I
c + + r-
OC o
b~q
~ bD
F. a
[~ GG Cl) ti H bb
26
