Note: Descriptions are shown in the official language in which they were submitted.
Controlled-release CNP agonists with reduced side-effects
The present invention relates a pharmaceutical composition comprising a
controlled-release
CNP agonist which reduces CNP agonist-associated side-effects, the use of such
controlled-
release CNP agonist and to methods of treatment.
Achondroplasia (ACH) is caused by a gain-of-function mutation in FGFR3.
Binding of CNP to
its receptor, natriuretic-peptide receptor B (NPR-B), inhibits FGFR3
downstream signaling and
thus triggers endochondral growth and skeletal overgrowth, as observed in both
mice and
humans overexpressing CNP. Overproduction of CNP in the cartilage or
continuous delivery
of CNP through intravenous (iv) infusion normalizes the dwarfism of
achondroplasic mice,
suggesting that administration of CNP at supraphysiological levels is a
strategy for treating
ACH.
However, given the short half-life of natural CNP-22 (2 min after iv
administration) CNP as a
therapeutic agent is challenging in a pediatric population because it would
require continuous
infusion. Furthermore, as CNP is extensively inactivated in the subcutaneous
tissue iv infusion
is required.
Increasing exposure to efficacious levels of the natriuretic peptide CNP is
challenging. As
natriuretic peptides are a family of hormones that may affect blood volume and
blood pressure,
an increase in dose may be associated with cardiovascular adverse effects. A
study in healthy
volunteers demonstrated that CNP injection caused a transient but significant
decrease in both
systolic and diastolic blood pressure with a significant increase in heart
rate (Igaki, et al.
Hypertens Res 1998; 21: 7-13). Similarly, a CNP variant with increased NEP
resistance (BMN-
111) in development for the treatment of achondroplasia, has demonstrated mild
hypotension
in a Phase 1 study in healthy volunteers (BioMarin press release Sep 26,
2012). Studies of
BMN-111 in animals and man have demonstrated that as the dose increases,
arterial blood
pressure (BP) drops and heart rate (HR) increases.
CNP produces hemodynamic effects in mice, nonhuman primates, rats, dogs, and
humans. In
order to evaluate the cardiovascular effects of various CNP variants,
anesthetized wild-type
FVB/nJ male mice were fitted with a pressure monitoring catheter connected to
a telemetry
transmitter. All variants showed similar BP-reducing and HR-increasing
activity. In most
1
NfAecue/Date Received 2023-02-08
animals, effects were observed within 5 minutes of subcutaneous
administration, with maximal
drop in MAP occurring between 5 and 20 minutes postdose. This timing
correlated well with
the maximum concentration of the CNP variants, and demonstrated a clear PIC/PD
relationship
for this physiologic response. Because the hemodynamic responses were similar
between the
doses and variants tested, cardiovascular activity was determined not to be a
differentiating
property (Wendt et. al. J Pharmacol Exp Ther 353:132-149, April 2015).
In addition to investigating various variants of CNP, different CNP conjugates
were obtained
by conjugating the CNP moiety to either PEG or proteinaceous compounds. These
PEGylated
and chimeric CNP exhibited a similar hemodynamic response as observed for the
non-
PEGylated CNP variants (Wendt, J Pharmacol Exp Ther 353:132-149, April 2015).
Therefore increasing the dose of a drug having CNP activity to increase drug
exposure may be
associated with unacceptable cardiovascular side-effects, such as hypotension.
In summary, there is a need for a more efficacious and safer treatment which
avoids the
cardiovascular side-effects, such as hypotension.
It is therefore an object of the present invention to at least partially
overcome the shortcomings
described above.
This object is achieved with a pharmaceutical composition comprising a
controlled-release
CNP agonist, wherein upon subcutaneous administration of said controlled-
release CNP agonist
a reduction or elimination of one or more side-effects is obtained compared to
the subcutaneous
administration of the corresponding free CNP agonist in an equivalent dosage.
It was surprisingly found that a controlled-release CNP agonists can be
administered to a patient
at a higher dose with reduced site-effects compared to the corresponding free
CNP agonist
which leads to a more convenient and efficacious treatment for the patient.
In another aspect the present invention relates to the use of a controlled-
release CNP agonist in
the treatment of a patient having a disease that can be treated with a CNP
agonist, wherein
administration of the controlled-release CNP agonist reduces or eliminates one
or more side-
2
NfAecue/Date Received 2023-02-08
effects associated with the administration of the corresponding free CNP
agonist in an
equivalent dosage.
In a further aspect the present invention relates to a method of treating a
patient suffering from
a disease that can be treated with a CNP agonist, the method comprising the
step of
administering to said patient a controlled-release CNP agonist, wherein the
administration of
the controlled-release CNP agonist reduces or eliminates one or more side-
effects associated
with the administration of the corresponding free CNP agonist in an equivalent
dosage.
Within the present invention the terms are used having the meaning as follows.
As used herein the term "CNP agonist" refers to any compound that activates
natriuretic peptide
receptor B (NPR-B) and has an EC50 that is at most 50-fold higher than the NPR-
B activity of
CNP-22 (SEQ ID NO:1).
As used herein "EC50" with regard to controlled-release CNP agonist and CNP
agonist refers
to the concentration of controlled-release CNP agonist and CNP agonist with
which a half-
maximum cGMP production of NPR-B is elicited. NPR-B activity in the form of
its EC50 of the
controlled-release CNP agonist, of the released CNP agonist and of CNP-22 is
measured by
cultivating NIH-3T3 (Murine Embryo Fibroblast cell line) cells which express
NPR-B on their
cell surface, incubating the cells with the controlled-release CNP agonist,
the corresponding
released CNP agonist or CNP-22, respectively, and determining the
intracellular production of
the second messenger cGMP with a standard cGMP assay. In particular the assay
is performed
as follows:
(1) murine NIH-3T3 cells expressing endogenous NPR-B are cultivated in DMEM F-
12
medium with 5% FBS and 5 rnM glutamine at 37 C and 5% CO2;
(2) for each assay 50,000 cells are resuspended in Dulbecco's PBS with IBMX
and
incubated with either the controlled-release CNP agonist, the corresponding
released
CNP agonist or CNP-22; each in different concentrations;
(3) after incubating for 30 mm at 37 C and 5% CO2, the cells are lysed and
cGMP levels
are determined; and
(4) generating an EC50 value from the determined cGMP levels.
Preferably, the IBMX concentration in step (2) is 0.5 mM.
3
WAecue/Date Received 2023-02-08
Step (3) can be performed using any assay for measuring cGMP which is a
standard procedure
well known to the person skilled in the art. Preferably step (3) is done with
a cGMP TR-FRET
assay, more preferably with the cGMP TR-FRET assay from Cisbio, Cat. No.
62GM2PEB.
As during such experiments the controlled-release CNP agonist releases a
certain amount of
CNP agonist which released CNP agonist would distort the results, measurements
for the NPR-
B activity of the controlled-release CNP agonist are preferably made in the
form of a stable
analog which does not release CNP agonist.
As used herein the term "controlled-release CNP agonist" refers to any
compound, conjugate,
crystal or admixture that comprises at least one CNP agonist and from which
the at least one
CNP agonist is released with a release half-life of at least 6 hours.
As used herein the term "equivalent dosage" with regard to the controlled-
release CNP agonist
and the corresponding free CNP agonist refers to an equimolar dosage of
controlled-release
CNP and corresponding free CNP agonist.
As used herein the term "unit dose" refers to the dose of controlled-release
CNP agonist
administered to a patient in one administration.
As used herein the term "CNP agonist equivalent" refers to the total mass of
CNP agonist or
CNP agonist moieties comprised in a controlled-release CNP agonist. In other
words, if the
controlled-release CNP agonist is for example a prodrug in which the CNP
agonist moiety is
reversibly conjugated to a polymer the term "CNP agonist equivalent" refers to
the total mass
of CNP agonist moieties, but not to the total mass of CNP agonist prodrug. If
the controlled-
release CNP agonist is for example a fusion protein in which the CNP agonist
moiety is fused
with an naturally or unnaturally occurring amino acid sequence the twit "CNP
agonist
equivalent" refers to the total mass of CNP agonist moieties, but not to the
total mass of the
fusion protein.
As used herein the term "release half-life" refers to the time needed until
half of all CNP agonist
molecules are released from the controlled-release CNP agonist. Such release
may for example
occur through diffusion, hydrolysis or enzymatic cleavage.
4
NfAecue/Date Received 2023-02-08
As used herein the term "CNP" refers to all CNP polypeptides, preferably from
mammalian
species, more preferably from human and mammalian species, more preferably
from human
and murine species, as well as their variants, analogs, orthologs, homologs,
and derivatives and
fragments thereof, that are characterized by regulating the growth,
proliferation and
differentiation of cartilaginous growth plate chondrocytes. Preferably, the
term "CNP" refers to
the CNP polypeptide of SEQ ID NO:24 as well as its variants, homologs and
derivatives
exhibiting essentially the same biological activity, i.e. regulating the
growth, proliferation and
differentiation of cartilaginous growth plate chondrocytes. More preferably,
the term "CNP"
refers to the polypeptide of SEQ ID NO:24. In another preferred embodiment the
term "CNP"
refers to the polypeptide of SEQ ID NO:20. In another preferred embodiment the
term "CNP"
refers to the polypeptide of SEQ ID NO :21. In another preferred embodiment
the term "CNP"
refers to the polypeptide of SEQ ID NO:22. In another preferred embodiment the
term "CNP"
refers to the polypeptide of SEQ ID NO:23. In another preferred embodiment the
term "CNP"
refers to the polypeptide of SEQ ID NO:30.
Naturally occurring CNP-22 (SEQ ID NO:!) has the following sequence:
GLSKGCF GLKLDRIGSMSGLGC,
wherein the cysteines at position 6 and 22 are connected through a disulfide-
bridge, as
illustrated in Fig. 1.
SEQ ID NO:24 has the following sequence:
LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC,
wherein the cysteines at position 22 and 38 are connected through a disulfide-
bride.
The term "CNP" also includes all CNP variants, analogs, orthologs, homologs
and derivatives
and fragments thereof as disclosed in WO 2009/067639 A2 and WO 2010/135541 A2.
Accordingly, the term "CNP" also refers preferably to the following peptide
sequences:
SEQ ID NO:2 (CNP-53):
DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:3 (G-CNP-53):
GDLRVDTKSRAAWARLL QEHPNARKYKGANKKGL SKGCF GLICLDRIGSMSGLGC ;
SEQ ID NO:4 (M-CNP-53):
MDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
5
NfAecue/Date Received 2023-02-08
SEQ ID NO:5 (P-CNP-53):
PDLRVDTKSRAAWARLLQEHPNARKYKGANICKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:6 (CNP-53 M48N):
DLRVDTKSRAAWARLLQEHPNARKYKGANICKGLSKGCFGLICLDRIGSNSGLGC;
SEQ ID NO:7 (CNP-53 A15-31):
DLRVDTKSRAAWARGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:8 (CNP-52):
LRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:9 (CNP-51):
RVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:10 (CNP-50):
VDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:11 (CNP-49):
DTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:12 (CNP-48):
TKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:13 (CNP-47):
KSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:14 (CNP-46):
SRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:15 (CNP-45):
RAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:16 (CNP-44):
AAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:17 (CNP-44 A14-22):
AAWARLLQEHPNAGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:18 (CNP-44 A15-22):
AAWARLLQEHPNARGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:19 (CNP-43):
AWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:20 (CNP-42):
WARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:21 (CNP-41):
ARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
6
NfAecue/Date Received 2023-02-08
SEQ ID NO:22 (CNP-40):
RLLQEHPNARKYKGANICKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:23 (CNP-39):
LLQEHPNARKYKGANICKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:24 (CNP-38):
LQEHPNARKYKGANKKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:25 (CNP-37):
QEHPNARKYKGANICKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:26 (CNP-37 Q1pQ, wherein pQ = pyroglutamate):
pQEHPNARKYKGANICKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:27 (G-CNP-37):
GQEHPNARKYKGANICKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:28 (P-CNP-37):
PQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:29 (M-CNP-37):
MQEHPNARKYKGANICKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:30 (PG-CNP-37):
PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:31 (MG-CNP-37):
MGQEHPNARKYKGANIUCGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:32 (CNP-37 M32N):
QEHPNARKYKGANICKGLSKGCFGLICLDRIGSNSGLGC;
SEQ ID NO:33 (G-CNP-37 M32N):
GQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC;
SEQ ID NO:34 (G-CNP-37 K14Q):
GQEHPNARKYKGANQKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:35 (G-CNP-37 K14P):
GQEHPNARKYKGANPKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:36 (G-CNP-37 K14Q, M5):
GQE1-1PNARKYKGANQGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:37 (G-CNP-37 K14Q, K15Q):
GQEHPNARKYKGANQQGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:38 (CNP-36):
EHPNARKYKGANICKGLSKGCFGLICLDRIGSMSGLGC;
7
IllfAecue/Date Received 2023-02-08
SEQ ID NO:39 (CNP-35):
HPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:40 (CNP-34):
PNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:41 (CNP-33):
NARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:42 (CNP-32):
ARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:43 (CNP-3I):
RKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:44 (CNP-30):
KYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:45 (CNP-29):
YKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:46 (CNP-28):
KGANKKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:47 (GHKSEVAHRF-CNP-28):
GHKSEVAHRFKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:48 (CNP-27):
GANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:49 (CNP-27 K4Q, K5Q):
GANQQGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:50 (CNP-27 K4R,K5R):
GANRRGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:51 (CNP-27 K4P,K5R):
GANPRGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:52 (CNP-27 K4S,K5S):
GANSSGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:53 (CNP-27 K4P,K5R):
GANGANPRGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:54 (CNP-27 K4R, K5R, K9R):
GANRRGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:55 (CNP-27 K4R, K5R, K9R, M22N):
GANRRGLSRGCFGLKLDRIGSNSGLGC;
8
Vraecue/Date Received 2023-02-08
SEQ ID NO:56 (P-CNP-27 K4R, K5R, K9R):
PGANRRGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:57 (M-CNP-27 K4R, K5R, K9R):
MGANRRGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:58 (HSA fragment-CNP-27):
GHKSEVAHRFKGANKKGLSKGCFGLICLDRIGSMSGLG;
SEQ ID NO:59 (HSA fragment-CNP-27 M22N):
GHKSEVAHRFKGANICKGLSKGCFGLICLDRIGSNSGLGC;
SEQ ID NO:60 (M-HSA fragment-CNP-27):
MGHKSEVAHRFKGANICKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:61 (P-HSA fragment-CNP-27):
PGHKSEVAHRFKGANICKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:62 (CNP-26):
ANICKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:63 (CNP-25):
NICKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:64 (CNP-24):
ICKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:65 (CNP-23):
KGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:66 (R-CNP-22):
RGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:67 (ER-CNP-22):
ERGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:68 (R-CNP-22 K4R):
RGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:69 (ER-CNP-22 4I(R):
ERGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:70 (RR-CNP-22):
RRGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:71 (HRGP fragment-CNP-22):
GHHSHEQHPHGANQQGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:72 (HRGP fragment-CNP-22):
GAHHPHEHDTHGANQQGLSKGCFGLKLDRIGSMSGLGC;
9
NfAecue/Date Received 2023-02-08
SEQ ID NO:73 (HRGP fragment-CNP-22):
GHHSHEQHPHGANPRGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:74 (IgGi(Fe) fragment-CNP-22):
GQPREPQVYTLPPSGLSKGCFGLKLDRIGSMSGLGC;
.. SEQ ID NO:75 (HSA fragment-CNP-22):
GQHICDDNPNLPRGANPRGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:76 (HSA fragment-CNP-22):
GERAFKAWAVARLSQGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:77 (osteocrin NPR C inhibitor fragment-CNP22):
FGIPMDRIGRNPRGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:78 (FGF2 heparin-binding domain fragment-CNP22):
GKRTGQYKLGSKTGPGPKGLSKGCFGLICLDRIGSMSGLGC;
SEQ ID NO:79 (IgGi(Fe) fragment-CNP-22 K4R):
GQPREPQVYTGANQQGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:80 (HSA fragment-CNP-22 K4R):
GVPQVSTSTGANQQGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:81 (fibronectin fragment-CNP-22 K4R):
GQPSSSSQSTGANQQGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:82 (fibronectin fragment-CNP-22 K4R):
GQTHSSGTQSGANQQGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:83 (fibronectin fragment-CNP-22 K4R):
GSTGQWHSESGANQQGLSRGCFGLKLDRIGSMSGLGC;
SEQ ID NO:84 (zinc finger fragment-CNP-22 K4R):
GSSSSSSSSSGANQQGLSRGCFGLKLDRIGSMSGLGC;
.. SEQ ID NO:85 (CNP-21):
LSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:86 (CNP-20):
SKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:87 (CNP-19):
KGCFGLKLDRIGSMSGLGC;
SEQ ID NO:88 (CNP-18):
GCFGLICLDRIGSMSGLGC;
SEQ ID NO:89 (CNP-17):
CFGL1CLDRIGSMSGLGC;
IllfAecue/Date Received 2023-02-08
SEQ ID NO:90 (BNP fragment-CNP-17-BNP fragment):
SPKMVQGSGCFGLKLDRIGSMSGLGCKVLRRH;
SEQ ID NO:91 (CNP-38 L1G):
GQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
SEQ ID NO:92 (Ac-CNP-37; wherein Ac= acetyl):
Ac-QEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC.
It is understood that the equivalents of the cysteines in positions 22 and 38
of SEQ ID NO:24
are also connected through a disulfide-bridge in SEQ ID NOs: 2 to 92.
More preferably, the term "CNP" refers to the sequence of SEQ ID:NOs 2, 19,
20, 21, 22, 23,
24, 25, 26, 30, 32, 38, 39, 40, 41, 42, 43, 91, 92. Even more preferably, the
term "CNP" refers
to the sequence of SEQ ID:NOs 23, 24, 25, 26, 38, 39, 91 and 92. In a
particularly preferred
embodiment the term "CNP" refers to the sequence of SEQ ID NO:24.
In another preferred embodiment the twit "CNP" refers to a sequence of SEQ ID
NO:93
QEHPNARX1YX2GANX3X4GLSX5GCFGLX6LDRIGSMSGLGC,
wherein Xi, X2, X3, X4, X5 and X6 are independently of each other selected
from the group
consisting of K, R, P, S and Q, with the provision that at least one of Xi,
X2, X3, X4, X5 and
X6 is selected from the group consisting of R, P, S and Q; preferably Xi, X2,
X3, X4, X5 and
X6 are selected from the group consisting of K and R, with the provision that
at least one of
Xi, X2, X3, X4, X5 and X6 is R;
even more preferably to a sequence of SEQ ID NO:94
QEHPNARKYKGANXiX2GLSX3GCFGLX4LDRIGSMSGLGC,
wherein Xi, X2, X3 and Xi are independently of each other selected from the
group consisting
of K, R, P, S and Q, with the provision that at least one of Xi, X2, X3 and X4
is selected from
the group consisting of R, P, S and Q; preferably Xi, X2, X3 and X4 are
selected from K and
R, with the provision that at least one of Xi, X2, X3 and X4 is R;
and most preferably to a sequence of SEQ ID NO:95
QEHPNARKYKGANXIX2GLSKGCFGLKLDRIGSMSGLGC,
wherein XiX2 are selected from the group consisting of KR, RK, KP, PK, SS, RS,
SR, QK,
QR, KQ, RQ, RR and QQ.
11
IllfAecue/Date Received 2023-02-08
It is understood that in all CNP sequences given in this specification the
equivalents of the
cysteines in positions 22 and 38 of SEQ ID NO:24 are also connected through a
disulfide-bridge
in SEQ ID NOs: 93 to 95.
It is understood that the present invention also encompasses CNP variants in
which any one or
more, up to all, residues susceptible to deamidation or a deamidation-like
reaction (e.g.,
isomerization) may be converted to other residue(s) via deamidation or a
deamidation-like
reaction to any extent, up to 100% conversion per converted residue. In
certain embodiments,
the disclosure encompasses CNP variants in which:
(1) any one or more, up to all, asparagine (Asn/N) residues may be converted
to aspartic acid
or aspartate, and/or to isoaspartic acid or isoaspartate, via deamidation up
to about 5%, 10%,
20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% conversion per converted
residue; or
(2) any one or more, up to all, glutamine (Gln/Q) residues may be converted to
glutarnic acid
or glutamate, and/or to isoglutamic acid or isoglutamate, via deamidation up
to about 5%, 10%,
20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% conversion per converted
residue; or
(3) any one or more, up to all, aspartic acid or aspartate (Asp/D) residues
may be converted to
isoaspartic acid or isoaspartate via a deamidation-like reaction (also called
isomerizati on) up to
about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% conversion per
converted residue; or
(4) any one or more, up to all, glutamic acid or glutamate (Glu/E) residues
may be converted to
isoglutamic acid or isoglutamate via a deamidation-like reaction (also called
isomerization) up
to about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% conversion
per
converted residue; or
(5) the N-terminal glutamine (if present) may be converted into pyroglutamate
up to about
5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% conversion; or
(6) a combination of the above.
As used herein, the term "CNP polypeptide variant" refers to a polypeptide
from the same
species that differs from a reference CNP polypeptide. Preferably, such
reference CNP
polypeptide sequence is the sequence of SEQ ID NO:24. Generally, differences
are limited so
that the amino acid sequence of the reference and the variant are closely
similar overall and, in
many regions, identical. Preferably, CNP polypeptide variants are at least
70%, 80%, 90%, or
95% identical to a reference CNP polypeptide, preferably the CNP polypeptide
of SEQ ID
12
NfAecue/Date Received 2023-02-08
NO:24. By a polypeptide having an amino acid sequence at least, for example,
95% "identical"
to a query amino acid sequence, it is intended that the amino acid sequence of
the subject
polypeptide is identical to the query sequence except that the subject
polypeptide sequence may
include up to five amino acid alterations per each 100 amino acids of the
query amino acid
sequence. These alterations of the reference sequence may occur at the amino
(N-terminal) or
carboxy terminal (C-terminal) positions of the reference amino acid sequence
or anywhere
between those terminal positions, interspersed either individually among
residues in the
reference sequence or in one or more contiguous groups within the reference
sequence. The
query sequence may be an entire amino acid sequence of the reference sequence
or any
fragment specified as described herein. Preferably, the query sequence is the
sequence of SEQ
ID NO:24.
Such CNP polypeptide variants may be naturally occurring variants, such as
naturally occurring
allelic variants encoded by one of several alternate forms of a CNP occupying
a given locus on
a chromosome or an organism, or isofonns encoded by naturally occurring splice
variants
originating from a single primary transcript. Alternatively, a CNP polypeptide
variant may be
a variant that is not known to occur naturally and that can be made by
mutagenesis techniques
known in the art.
It is known in the art that one or more amino acids may be deleted from the N-
terminus or C-
terminus of a bioactive peptide or protein without substantial loss of
biological function. Such
N- and/or C-terminal deletions are also encompassed by the term CNP
polypeptide variant.
It is also recognized by one of ordinary skill in the art that some amino acid
sequences of CNP
polypeptides can be varied without significant effect of the structure or
function of the peptide.
Such mutants include deletions, insertions, inversions, repeats, and
substitutions selected
according to general rules known in the art so as to have little effect on
activity. For example,
guidance concerning how to make phenotypically silent amino acid substitutions
is provided in
Bowie et al. (1990), Science 247:1306-1310, wherein the authors indicate that
there are two
main approaches for studying the tolerance of the amino acid sequence to
change.
The term CNP polypeptide also encompasses all CNP polypeptides encoded by CNP
analogs,
orthologs, and/or species homologs. As used herein, the term "CNP analog"
refers to CNP of
different and unrelated organisms which perform the same functions in each
organism, but
13
NfAecue/Date Received 2023-02-08
which did not originate from an ancestral structure that the organisms'
ancestors had in
common. Instead, analogous CNPs arose separately and then later evolved to
perfoiiii the same
or similar functions. In other words, analogous CNP polypeptides are
polypeptides with quite
different amino acid sequences but that perfoim the same biological activity,
namely regulating
.. the growth, proliferation and differentiation of cartilaginous growth plate
chondrocytes.
As used herein the term "CNP ortholog" refers to CNP within two different
species which
sequences are related to each other via a common homologous CNP in an
ancestral species, but
which have evolved to become different from each other.
As used herein, the telin "CNP homolog" refers to CNP of different organisms
which perform
the same functions in each organism and which originate from an ancestral
structure that the
organisms' ancestors had in common. In other words, homologous CNP
polypeptides are
polypeptides with quite similar amino acid sequences that perfoiin the same
biological activity,
namely regulating the growth, proliferation and differentiation of
cartilaginous growth plate
chondrocytes. Preferably, CNP polypeptide homologs may be defined as
polypeptides
exhibiting at least 40%, 50%, 60%, 70%, 80%, 90% or 95% identity to a
reference CNP
polypeptide, preferably the CNP polypeptide of SEQ ID NO:24.
Thus, a CNP polypeptide according to the invention may be, for example: (i)
one in which at
least one of the amino acid residues is substituted with a conserved or non-
conserved amino
acid residue, preferably a conserved amino acid residue, and such substituted
amino acid
residue may or may not be one encoded by the genetic code; and/or (ii) one in
which at least
one of the amino acid residues includes a substituent group; and/or (iii) one
in which the CNP
polypeptide is fused with another compound, such as a compound to increase the
half-life of
the polypeptide (for example, polyethylene glycol); and/or (iv) one in which
additional amino
acids are fused to the CNP polypeptide, such as an IgG Fc fusion region
peptide or leader or
secretory sequence or a sequence which is employed for purification of the
above form of the
polypeptide or a pre-protein sequence.
As used herein, the term "CNP polypeptide fragment" refers to any peptide
comprising a
contiguous span of a part of the amino acid sequence of a CNP polypeptide,
preferably the
polypeptide of SEQ ID NO:24.
14
NfAecue/Date Received 2023-02-08
More specifically, a CNP polypeptide fragment comprises at least 6, such as at
least 8, at least
or at least 17 consecutive amino acids of a CNP polypeptide, more preferably
of the
polypeptide of SEQ ID NO:24. A CNP polypeptide fragment may additionally be
described as
sub-genuses of CNP polypeptides comprising at least 6 amino acids, wherein "at
least 6" is
5 defined as any integer between 6 and the integer representing the C-
terminal amino acid of a
CNP polypeptide, preferably of the polypeptide of SEQ ID No:24. Further
included are species
of CNP polypeptide fragments at least 6 amino acids in length, as described
above, that are
further specified in terms of their N-terminal and C-terminal positions. Also
encompassed by
the term "CNP polypeptide fragment" as individual species are all CNP
polypeptide fragments,
10 at least 6 amino acids in length, as described above, that may be
particularly specified by a N-
tenninal and C-terminal position. That is, every combination of a N-terminal
and C-terminal
position that a fragment at least 6 contiguous amino acid residues in length
could occupy, on
any given amino acid sequence of a CNP polypeptide, preferably the CNP
polypeptide of SEQ
ID:N024 is included in the present invention.
The term "CNP" also includes poly (amino acid) conjugates which have a
sequence as described
above, but having a backbone that comprises both amide and non-amide linkages,
such as ester
linkages, like for example depsipeptides. Depsipeptides are chains of amino
acid residues in
which the backbone comprises both amide (peptide) and ester bonds.
Accordingly, the term
"side chain" as used herein refers either to the moiety attached to the alpha-
carbon of an amino
acid moiety, if the amino acid moiety is connected through amine bonds such as
in polypeptides,
or to any carbon atom-comprising moiety attached to the backbone of a
poly(amino acid)
conjugate, such as for example in the case of depsipeptides. Preferably, the
term "CNP" refers
to polypeptides having a backbone foimed through amide (peptide) bonds.
As the term CNP includes the above-described variants, analogs, orthologs,
homologs,
derivatives and fragments of CNP, all references to specific positions within
a reference
sequence also include the equivalent positions in the variants, analogs,
orthologs, homologs,
derivatives and fragments of a CNP moiety, even if not specifically mentioned.
As used herein, the tean "ring moiety" refers to the stretch of consecutive
amino acid residues
of the CNP drug or moiety that is located between two cysteine residues that
form an
intramolecular disulfide bridge or between homologous amino acid residues
which are
connected through a chemical linker. Preferably, the ring moiety is located
between two
cysteine residues that form an intramolecular disulfide bridge. These two
cysteines correspond
NfAecue/Date Received 2023-02-08
to the cysteines at position 22 and position 38 in the sequence of CNP-38 (SEQ
ID NO:24).
Accordingly, amino acids 23 to 37 are located in said ring moiety, if the CNP
drug or moiety
has the sequence of CNP-22.
Independently of the length of the CNP moiety, the sequence of the ring moiety
of wild-type
CNP is FGLICI,DRIGSMSGLG (SEQ ID NO:96).
As described above, the term "CNP" relates to CNP drugs or moieties having
different numbers
of amino acids. The person skilled in the art understands that in CNP drugs or
moieties of
different lengths the positions of equivalent amino acids vary and the skilled
artisan will have
no difficulty identifying the two cysteines forming the disulfide bridge or
their two homologous
amino acid residues connected to each other through a chemical linker in
longer, shorter and/or
otherwise modified CNP versions.
As the term CNP includes the above-described variants, analogs, orthologs,
homologs,
derivatives and fragments of CNP, the term "ring moiety" also includes the
corresponding
variants, analogs, orthologs, homologs, derivatives and fragments of the
sequence of SEQ ID
NO:96. Accordingly, all references to specific positions within a reference
sequence also
include the equivalent positions in variants, analogs, orthologs, homologs,
derivatives and
fragments of a CNP moiety, even if not explicitly mentioned.
As used herein, the term "random coil" refers to a peptide or protein
adopting/having/forming,
preferably having, a conformation which substantially lacks a defined
secondary and tertiary
structure as determined by circular dichroism spectroscopy performed in
aqueous buffer at
.. ambient temperature, and pH 7.4. Preferably, ambient temperature is about
20 C, i.e. between
18 C and 22 C, most preferably ambient temperature is 20 C.
As used herein the term "micelle" means an aggregate of amphiphilic molecules
dispersed in a
liquid colloid. In aqueous solution a typical micelle forms an aggregate with
the hydrophilic
moiety of the surfactant molecules facing the surrounding solvent and the
hydrophobic moiety
of the surfactant molecule facing inwards, also called "normal-phase micelle".
"Invers
micelles" have the hydrophilic moiety facing inwards and the hydrophobic
moiety facing the
surrounding solvent.
16
NfAecue/Date Received 2023-02-08
As used herein the term "liposome" refers to a vesicle, preferably a spherical
vesicle, having at
least one lipid bilayer. Preferably, liposomes comprise phospholipids, even
more preferably
phosphatidylcholine. The term "liposome" refers to various structures and
sizes, such as, for
example, to multilamellar liposome vesicles (MLV) having more than one
concentric lipid
bilayer with an average diameter of 100 to 1000 nm, small unilamellar liposome
vesicles (SUV)
having one lipid bilayer and an average diameter of 25 to 100 nm, large
unilamellar liposome
vesicles (LUV) having one lipid bilayer and an average diameter of about 1000
m and giant
unilamellar vesicles (GUV) having one lipid bilayer and an average diameter of
1 to 100 gm.
The term "liposome" also includes elastic vesicles such as transferosomes and
ethosomes, for
example.
As used herein the term "aquasome" refers to spherical nanoparticles having a
diameter of 60
to 300 nm that comprise at least three layers of self-assembled structure,
namely a solid phase
nanocrystalline core coated with an oligomeric film to which drug molecules
are adsorbed with
or without modification of the drug.
As used herein the term "ethosome" refers to lipid vesicles comprising
phospholipids and
ethanol and/or isopropanol in relatively high concentration and water, having
a size ranging
from tens of nanometers to micrometers.
As used herein the term "LeciPlex" refers to positively charged phospholipid-
based vesicular
system which comprises soy PC, a cationic agent, and a bio-compatible solvent
like PEG 300,
PEG 400, diethylene glycol monoethyl ether, tetrahydrofurfuryl alcohol
polyethylene glycol
ether or 2-pyrrolidoneor N-methyl-2-pyrrolidone.
As used herein the term "niosome" refers to unilamellar or multilamellar
vesicles comprising
non-ionic surfactants.
As used herein the term "pharinacosome" refers to ultrafine vesicular,
micellar or hexagonal
aggregates from lipids covalently bound to biologically active moieties.
As used herein the term "proniosome" refers to dry formulations of surfactant-
coated carrier
which on rehydration and mild agitation gives niosomes.
17
NfAecue/Date Received 2023-02-08
As used herein the term "polymersome" refers to an artificial spherical
vesicle comprising a
membrane formed from amphiphilic synthetic block copolymers and may optionally
comprise
an aqueous solution in its core. A polymersome has a diameter ranging from 50
nm to 5 gm
and larger. The term also includes syntosomes, which are polymersomes
engineered to
comprise channels that allow certain chemicals to pass through the membrane
into or out of the
vesicle.
As used herein the twit "sphingosome" refers to a concentric, bilayered
vesicle in which an
aqueous volume is entirely enclosed by a membranous lipid bilayer mainly
composed of natural
.. or synthetic sphingolipid.
As used herein the term "transferosome" refers to ultraflexible lipid vesicles
comprising an
aqueous core that are formed from a mixture of common polar and suitable edge-
activated lipids
which facilitate the formation of highly curved bilayers which render the
transferosome highly
deformable.
As used herein the term "ufasome" refers to a vesicle comprising unsaturated
fatty acids.
As used herein the term "aptamer" refers to an oligonucleotide or peptide
molecule that binds
a specific molecule. The term "aptarner" includes DNA, RNA, XNA and peptide
aptamers.
As used herein, the term "oligonucleotide" refers to a short nucleic acid
polymer of up to 100
bases.
As used herein the tean "polypeptide" refers to a peptide comprising up to and
including 50
amino acid monomers. Only for CNP drugs and CNP moieties also sequences having
more than
50 amino acids will be referred to as "polypeptide" for simplification.
As used herein the term "protein" refers to a peptide of more than 50 amino
acid residues.
Preferably a protein comprises at most 20000 amino acid residues, such as at
most 15000 amino
acid residues, such as at most 10000 amino acid residues, such as at most 5000
amino acid
residues, such as at most 4000 amino acid residues, such as at most 3000 amino
acid residues,
such as at most 2000 amino acid residues, such as at most 1000 amino acid
residues.
18
NfAecue/Date Received 2023-02-08
As used herein the terms "small molecule drug" and "small molecule
biologically active
moiety" refer to drugs and biologically active moieties that are organic
compounds having a
molecular weight of no more than 1 kDa, such as up to 900 kDa.
As used herein the term "natural product" refers to purified organic compounds
isolated from
natural sources that are produced by the pathways of primary or secondary
metabolism.
As used herein the term "physiological conditions" refers to an aqueous buffer
at pH 7.4, 37 C.
As used herein the term "pharmaceutical composition" refers to a composition
containing one
or more active ingredients, such as for example the controlled-release CNP
agonists of the
present invention, and one or more excipients, as well as any product which
results, directly or
indirectly, from combination, complexation or aggregation of any two or more
of the
ingredients of the composition, or from dissociation of one or more of the
ingredients, or from
other types of reactions or interactions of one or more of the ingredients.
Accordingly, the
pharmaceutical compositions of the present invention encompass any composition
made by
admixing one or more controlled-release CNP agonists of the present invention
and a
pharmaceutically acceptable excipient.
As used herein the term "liquid composition" refers to a mixture comprising
water-soluble
controlled-release CNP agonist and one or more solvents, such as water.
The term "suspension composition" relates to a mixture comprising water-
insoluble controlled-
release CNP agonist and one or more solvents, such as water.
As used herein, the term "dry composition" means that a pharmaceutical
composition is
provided in a dry four!. Suitable methods for drying are spray-drying and
lyophilization, i.e.
freeze-drying. Such dry composition of the controlled-release CNP agonist of
the present
invention has a residual water content of a maximum of 10 %, preferably less
than 5% and more
preferably less than 2%, determined according to Karl Fischer. Preferably, the
pharmaceutical
composition of the present invention is dried by lyophilization.
The term "drug" as used herein refers to a substance used in the treatment,
cure, prevention, or
diagnosis of a disease or used to otherwise enhance physical or mental well-
being. If a drug is
19
NfAecue/Date Received 2023-02-08
conjugated to another moiety, the moiety of the resulting product that
originated from the drug
is referred to as "biologically active moiety".
As used herein the term "prodrug" refers to a biologically active moiety
reversibly and
covalently connected to a specialized protective group through a reversible
prodrug linker
moiety which is a linker moiety comprising a reversible linkage with the
biologically active
moiety and wherein the specialized protective group alters or eliminates
undesirable properties
in the parent molecule. This also includes the enhancement of desirable
properties in the drug
and the suppression of undesirable properties. The specialized non-toxic
protective group is
referred to as "carrier". A prodrug releases the reversibly and covalently
bound biologically
active moiety in the form of its corresponding drug. In other words, a prodrug
is a conjugate
comprising a biologically active moiety which is covalently and reversibly
conjugated to a
carrier moiety via a reversible prodrug linker moiety, which covalent and
reversible conjugation
of the carrier to the reversible prodrug linker moiety is either directly or
through a spacer. Such
conjugate releases the formerly conjugated biologically active moiety in the
form of a free drug.
A "biodegradable linkage" or a "reversible linkage" is a linkage that is
hydrolytically
degradable, i.e. cleavable, in the absence of enzymes under physiological
conditions (aqueous
buffer at pH 7.4, 37 C) with a half-life ranging from one hour to six months,
preferably from
one hour to four months, even more preferably from one hour to three months,
even more
preferably from one hour to two months, even more preferably from one hour to
one month.
Accordingly, a stable linkage is a linkage having a half-life under
physiological conditions
(aqueous buffer at pH 7.4, 37 C) of more than six months.
Accordingly, a "reversible prodrug linker moiety" is a moiety which is
covalently conjugated
to a biologically active moiety, such as a CNP agonist moiety, through a
reversible linkage and
is also covalently conjugated to a carrier moiety, such as -Z or -Z', wherein
the covalent
conjugation to said carrier moiety is either directly or through a spacer
moiety, such as -L2-.
Preferably the linkage between -Z or -Z' and 42- is a stable linkage.
As used herein, the term "traceless prodrug linker" means a reversible prodrug
linker which
upon cleavage releases the drug in its free form. As used herein, the temi
"free fomi" of a drug
means the drug in its unmodified, pharmacologically active form.
NfAecue/Date Received 2023-02-08
As used herein, the term "excipient" refers to a diluent, adjuvant, or vehicle
with which the
therapeutic, such as a drug or prodrug, is administered. Such pharmaceutical
excipient can be
sterile liquids, such as water and oils, including those of petroleum, animal,
vegetable or
synthetic origin, including but not limited to peanut oil, soybean oil,
mineral oil, sesame oil and
the like. Water is a preferred excipient when the pharmaceutical composition
is administered
orally. Saline and aqueous dextrose are preferred excipients when the
pharmaceutical
composition is administered intravenously. Saline solutions and aqueous
dextrose and glycerol
solutions are preferably employed as liquid excipients for injectable
solutions. Suitable
pharmaceutical excipients include starch, glucose, lactose, sucrose, mannitol,
trehalose, gelatin,
malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate,
talc, sodium chloride,
dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The
pharmaceutical
composition, if desired, can also contain minor amounts of wetting or
emulsifying agents, pH
buffering agents, like, for example, acetate, succinate, tris, carbonate,
phosphate, HEPES (4-(2-
hydroxyethyl)-1-piperazineethanesulfonic acid), MES (2-(N-
morpholino)ethanesulfonic acid),
or can contain detergents, like Tween, poloxamers, poloxamines, CHAPS, Igepal,
or amino
acids like, for example, glycine, lysine, or histidine. These pharmaceutical
compositions can
take the form of solutions, suspensions, emulsions, tablets, pills, capsules,
powders, sustained-
release formulations and the like. The pharmaceutical composition can be
formulated as a
suppository, with traditional binders and excipients such as triglycerides.
Oral formulation can
include standard excipients such as pharmaceutical grades of mannitol,
lactose, starch,
magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
Such
compositions will contain a therapeutically effective amount of the drug or
biologically active
moiety, together with a suitable amount of excipient so as to provide the form
for proper
administration to the patient. The formulation should suit the mode of
administration.
As used herein, the term "reagent" means a chemical compound which comprises
at least one
functional group for reaction with the functional group of another chemical
compound or drug.
It is understood that a drug comprising a functional group (such as a primary
or secondary
amine or hydroxyl functional group) is also a reagent.
As used herein, the term "moiety" means a part of a molecule, which lacks one
or more atom(s)
compared to the corresponding reagent. If, for example, a reagent of the
formula "H-X-H"
reacts with another reagent and becomes part of the reaction product, the
corresponding moiety
of the reaction product has the structure "H¨X¨" or "¨X¨ ", whereas each "¨ "
indicates
21
NfAecue/Date Received 2023-02-08
attachment to another moiety. Accordingly, a biologically active moiety is
released from a
prodrug as a drug.
It is understood that if the sequence or chemical structure of a group of
atoms is provided which
.. group of atoms is attached to two moieties or is interrupting a moiety,
said sequence or chemical
structure can be attached to the two moieties in either orientation, unless
explicitly stated
otherwise. For example, a moiety "-C(0)N(R1)-" can be attached to two moieties
or interrupting
a moiety either as "-C(0)N(R1)-" or as "-N(R1)C(0)-". Similarly, a moiety
0
0/ _________ s.
can be attached to two moieties or can interrupt a moiety either as
0
,
)
0 /
S 0//
or as
As used herein, the term "functional group" means a group of atoms which can
react with other
groups of atoms. Functional groups include but are not limited to the
following groups:
carboxylic acid (¨(C=0)0H), primary or secondary amine (¨NH2, ¨NH¨),
maleimide, thiol
(-SH), sulfonic acid (¨(0=S)OH), carbonate, carbamate (-0(C=0)N1, hydroxyl
(¨OH),
aldehyde (¨(C=0)H), ketone (¨(C=0)¨), hydrazine (>N-N1, isocyanate,
isothiocyanate,
phosphoric acid (-0(P=0)0HOH), phosphonic acid (-0(P=0)0HH), haloacetyl, alkyl
halide,
acryloyl, aryl fluoride, hydroxylamine, disulfide, sulfonamides, sulfuric
acid, vinyl sulfone,
vinyl ketone, diazoalkane, oxirane, and aziridine.
In case the controlled-release CNP agonists of the present invention comprise
one or more
acidic or basic groups, the invention also comprises their corresponding
pharmaceutically or
toxicologically acceptable salts, in particular their pharmaceutically
utilizable salts. Thus, the
controlled-release CNP agonists of the present invention comprising acidic
groups can be used
according to the invention, for example, as alkali metal salts, alkaline earth
metal salts or as
ammonium salts. More precise examples of such salts include sodium salts,
potassium salts,
22
NfAecue/Date Received 2023-02-08
calcium salts, magnesium salts or salts with ammonia or organic amines such
as, for example,
ethylamine, ethanolamine, triethanolamine or amino acids. Controlled-release
CNP agonists of
the present invention comprising one or more basic groups, i.e. groups which
can be protonated,
can be present and can be used according to the invention in the form of their
addition salts with
inorganic or organic acids. Examples for suitable acids include hydrogen
chloride, hydrogen
bromide, phosphoric acid, sulfuric acid, nitric acid, methanesulfonic acid, p-
toluenesulfonic
acid, naphthalenedisulfonic acids, oxalic acid, acetic acid, tartaric acid,
lactic acid, salicylic
acid, benzoic acid, formic acid, propionic acid, pivalic acid, diethylacetic
acid, malonic acid,
succinic acid, pimelic acid, fumaric acid, maleic acid, malic acid, sulfaminic
acid,
phenylpropionic acid, gluconic acid, ascorbic acid, isonicotinic acid, citric
acid, adipic acid,
and other acids known to the person skilled in the art. For the person skilled
in the art further
methods are known for converting the basic group into a cation like the
alkylation of an amine
group resulting in a positively-charge ammonium group and an appropriate
counterion of the
salt. If the controlled-release CNP agonists of the present invention
simultaneously comprise
acidic and basic groups, the invention also includes, in addition to the salt
forms mentioned,
inner salts or betaines (zwitterions). The respective salts can be obtained by
customary methods
which are known to the person skilled in the art like, for example by
contacting these prodrugs
with an organic or inorganic acid or base in a solvent or dispersant, or by
anion exchange or
cation exchange with other salts. The present invention also includes all
salts of the prodrugs
of the present invention which, owing to low physiological compatibility, are
not directly
suitable for use in pharmaceuticals but which can be used, for example, as
intermediates for
chemical reactions or for the preparation of pharmaceutically acceptable
salts.
The tem! "pharmaceutically acceptable" means a substance that does cause harm
when
administered to a patient and preferably means approved by a regulatory
agency, such as the
EMA (Europe) and/or the FDA (US) and/or any other national regulatory agency
for use in
animals, preferably for use in humans.
As used herein the term "about" in combination with a numerical value is used
to indicate a
range ranging from and including the numerical value plus and minus no more
than 10% of said
numerical value, more preferably no more than 8% of said numerical value, even
more
preferably no more than 5% of said numerical value and most preferably no more
than 2% of
said numerical value. For example, the phrase "about 200" is used to mean a
range ranging
from and including 200 +/- 10%, i.e. ranging from and including 180 to 220;
preferably 200 +/-
23
NfAecue/Date Received 2023-02-08
8%, i.e. ranging from and including 184 to 216; even more preferably ranging
from and
including 200 +1-5%, i.e. ranging from and including 190 to 210; and most
preferably 200 +/-
2%, i.e. ranging from and including 196 to 204. It is understood that a
percentage given as
"about 20%" does not mean "20% +/- 10%", i.e. ranging from and including 10 to
30%, but
"about 20%" means ranging from and including 18 to 22%, i.e. plus and minus
10% of the
numerical value which is 20.
As used herein, the term "polymer" means a molecule comprising repeating
structural units, i.e.
the monomers, connected by chemical bonds in a linear, circular, branched,
crosslinked or
dendrimeric way or a combination thereof, which may be of synthetic or
biological origin or a
combination of both. It is understood that a polymer may also comprise one or
more other
chemical groups and/or moieties, such as, for example, one or more functional
groups.
Preferably, a soluble polymer has a molecular weight of at least 0.5 kDa, e.g.
a molecular weight
of at least 1 kDa, a molecular weight of at least 2 kDa, a molecular weight of
at least 3 kDa or
a molecular weight of at least 5 kDa. If the polymer is soluble, it preferable
has a molecular
weight of at most 1000 kDa, such as at most 750 kDa, such as at most 500 kDa,
such as at most
300 kDa, such as at most 200 kDa, such as at most 100 kDa. It is understood
that for insoluble
polymers, such as hydrogels, no meaningful molecular weight ranges can be
provided. It is
understood that also a protein is a polymer in which the amino acids are the
repeating structural
units, even though the side chains of each amino acid may be different.
As used herein, the term "polymeric" means a reagent or a moiety comprising
one or more
polymers or polymer moieties. A polymeric reagent or moiety may optionally
also comprise
one or more other moiety/moieties, which are preferably selected from the
group consisting of:
= C1-50 alkyl, C2-50 alkenyl, C2_50 alkynyl, C3_10 cycloalkyl, 3- to 10-
membered
heterocyclyl, 8-to 11-membered heterobicyclyl, phenyl, naphthyl, indenyl,
indanyl, and
tetralinyl; and
= linkages selected from the group comprising
24
NfAecue/Date Received 2023-02-08
__________________________ 211+,
OR NR 0 NR 0 0
, __________________
,
0 ik
0
, I xi. 11
l
¨LIN ¨C-1N + , and +N a' I I a
S
0
wherein
dashed lines indicate attachment to the remainder of the moiety or reagent,
and
-R and -Ra are independently of each other selected from the group consisting
of -H,
methyl, ethyl, propyl, butyl, pentyl and hexyl.
The person skilled in the art understands that the polymerization products
obtained from a
polymerization reaction do not all have the same molecular weight, but rather
exhibit a
molecular weight distribution. Consequently, the molecular weight ranges,
molecular weights,
ranges of numbers of monomers in a polymer and numbers of monomers in a
polymer as used
herein, refer to the number average molecular weight and number average of
monomers, i.e. to
the arithmetic mean of the molecular weight of the polymer or polymeric moiety
and the
arithmetic mean of the number of monomers of the polymer or polymeric moiety.
Accordingly, in a polymeric moiety comprising "x" monomer units any integer
given for "x"
therefore corresponds to the arithmetic mean number of monomers. Any range of
integers given
for "x" provides the range of integers in which the arithmetic mean numbers of
monomers lies.
An integer for "x" given as "about x" means that the arithmetic mean numbers
of monomers
lies in a range of integers of x +/- 10%, preferably x +/- 8%, more preferably
x +/- 5% and most
preferably x +/- 2%.
As used herein, the term "number average molecular weight" means the ordinary
arithmetic
mean of the molecular weights of the individual polymers.
As used herein the term "water-soluble" with reference to a carrier means that
when such carrier
is part of the controlled-release CNP agonists of the present invention at
least 1 g of the
NfAecue/Date Received 2023-02-08
controlled-release CNP agonists comprising such water-soluble carrier can be
dissolved in one
liter of water at 20 C to form a homogeneous solution. Accordingly, the term
"water-insoluble"
with reference to a carrier means that when such carrier is part of a
controlled-release CNP
agonists of the present invention less than 1 g of the controlled-release CNP
agonists comprising
such water-insoluble carrier can be dissolved in one liter of water at 20 C to
Ruin a
homogeneous solution.
As used herein, the term "hydrogel" means a hydrophilic or amphiphilic
polymeric network
composed of homopolymers or copolymers, which is insoluble due to the presence
of covalent
chemical crosslinks. The crosslinks provide the network structure and physical
integrity.
As used herein the term "thermogelling" means a compound that is a liquid or a
low viscosity
solution having a viscosity of less than 500 cps at 25 C at a shear rate of
about 0.1 /second at a
low temperature, which low temperature ranges between about 0 C to about 10 C,
but which
is a higher viscosity compound of less than 10000 cps at 25 C at a shear rate
of about 0.1/second
at a higher temperature, which higher temperature ranges between about 30 C to
about 40 C,
such as at about 37 C.
As used herein, the tem! "PEG-based" in relation to a moiety or reagent means
that said moiety
or reagent comprises PEG. Preferably, a PEG-based moiety or reagent comprises
at least 10%
(w/w) PEG, such as at least 20% (w/w) PEG, such as at least 30% (w/w) PEG,
such as at least
40% (w/w) PEG, such as at least 50% (w/w), such as at least 60 (w/w) PEG, such
as at least
70% (w/w) PEG, such as at least 80% (w/w) PEG, such as at least 90% (w/w) PEG,
such as at
least 95% (w/w) PEG. The remaining weight percentage of the PEG-based moiety
or reagent
are other moieties preferably selected from the following moieties and
linkages:
= C1-50 alkyl, C2-50 alkenyl, C2-50 aikynyl, C3-10 cycloalkyl, 3- to 10-
membered
heterocyclyl, 8-to 11-membered heterobicyclyl, phenyl, naphthyl, indenyl,
indanyl, and
tetralinyl; and
= linkages selected from the group comprising
26
NfAecue/Date Received 2023-02-08
-IHN=N-k
11Z
OR NR 0 NR 0 0
, II , II õ II ,
I '
0 R
0
,-1\11¨C-111¨, and 1-N\
I a I a
0 0 \ ______________________________________________________ õ
wherein
dashed lines indicate attachment to the remainder of the moiety or reagent,
and
-R and -It' are independently of each other selected from the group consisting
of -H,
methyl, ethyl, propyl, butyl, pentyl and hexyl.
As used herein, the term "PEG-based comprising at least X% PEG" in relation to
a moiety or
reagent means that said moiety or reagent comprises at least X% (w/w) ethylene
glycol units
(-CH2CH20-), wherein the ethylene glycol units may be arranged blockwise,
alternating or may
be randomly distributed within the moiety or reagent and preferably all
ethylene glycol units of
said moiety or reagent are present in one block; the remaining weight
percentage of the PEG-
based moiety or reagent are other moieties preferably selected from the
following moieties and
linkages:
= C1_50 alkyl, C2-50 alkenyl, C2-50 alkynyl, C3-10 cycloalkyl, 3- to 10-
membered
heterocyclyl, 8-to 11-membered heterobicyclyl, phenyl, naphthyl, indenyl,
indanyl, and
tetralinyl; and
= linkages selected from the group comprising
õ
H-0 ______________________ ; , , _______________ S ,
I
OR NR 0 NR
0
0
II
and
fk la' I I a
0
27
NfAecue/Date Received 2023-02-08
wherein
dashed lines indicate attachment to the remainder of the moiety or reagent,
and
-R and -Ra are independently of each other selected from the group consisting
of -H,
methyl, ethyl, propyl, butyl, pentyl and hexyl.
The term "hyaluronic acid-based comprising at least X% hyaluronic acid" is
used accordingly.
The term "substituted" as used herein means that one or more -H atom(s) of a
molecule or
moiety are replaced by a different atom or a group of atoms, which are
referred to as
"substituent".
Preferably, the one or more further optional substituents are independently of
each other
selected from the group consisting of halogen, -CN, -COOW1, -OR', -C(0)R',
-C (0)N(Rx 11t)(1 a), - S(0)2N(Rx 11IX la), -S(0)N(Rx1Rx
-S (0)2Rx 1,
-N(Rx 1)S (0)2N(Rx laRx1b) _SR'',
_N(RxiRx1a), -NO2, 0C(0)R" , -N(Rx1)C(0)Rxla,
-N(Rx1)S(0)212X1a, -N(Rx1)S(0)11'da, -
N(Rx1)C(0)01r1a, -N(RX1)C(0)N(RxlaRx13),
-0C(0)N(Rx1R
xla),
C1-50 alkyl, C2_50 alkenyl, and C2_50 alkynyl; wherein -T , C1-50 alkyl,
C2-50 alkenyl, and C2-50 alkynyl are optionally substituted with one or more -
Rx2, which are the
same or different and wherein C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl
are optionally
interrupted by one or more groups selected from the group consisting of -T -, -
C(0)0-, -0-,
-C(0)-, -C(0)N(W3)-, -S(0)2N(Rx3)-, -S(0)N(W3)-, -S(0)2-, -S(0)-, -
N(Rx3)S(0)2N(R)(3a)-,
-S-, -N(Rx3)-, -0C(01V3)(lea)-, -N(10C(0)N(R(31)-, and -0C(0)N(Rx3)-;
_Rxi, _Rxla, --rs,x1b
are independently of each other selected from the group consisting of -H, -T ,
C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T , C1-50 alkyl, C2-50
alkenyl, and C2-50
alkynyl are optionally substituted with one or more -Rx2, which are the same
or different and
wherein C1_50 alkyl, C2_50 alkenyl, and C2_50 alkynyl are optionally
interrupted by one or more
groups selected from the group consisting of -T -, -C(0)0-, -0-, -C(0)-,
-C(0)N(Rx3)-, -S(0)2N(Rx3)-, -S(0)N(Rx3)-; -S(0)2-, -S(0)-, -
N(Rx3)S(0)2N(Rx3a)-, -S-,
-N(Rx3)-, -0C(ORx3)(R)31)-, -N(Rx3)C(0)N(Rx3a)-, and -0C(0)N(Rx3)-;
each T is independently selected from the group consisting of phenyl,
naphthyl, indenyl,
indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, and 8-
to 11-membered
28
NfAecue/Date Received 2023-02-08
heterobicyclyl; wherein each T is independently optionally substituted with
one or more -W2,
which are the same or different;
each -W2 is independently selected from the group consisting of halogen, -CN,
oxo
(-0), -000Rx4, -OR", -C(0)Rx4, -C(0)N(Rx4Rx4a), -S(0)2N(Rx4Rx4a), -
S(0)N(Rx4Rx4a),
-S(0)2Rx4, -S(0)Rx4, -N(Rx4)S(0)2N(Rx4aRx413) _
SR", -N(Rx4Rx4a), -NO2, -0C(0)W4,
-N(Rx4)C(0)Rx4a, -N(Rx4)S(0)2Rx4a, -N(Rx4)S(0)Rx4a, -
N(Rx4)C(0)0W4a,
-N(Rx4)C(0)N(Rx4aRx413), _
OC(0)N(Rx4W4a), and C1_6 alkyl; wherein C1_6 alkyl is optionally
substituted with one or more halogen, which are the same or different;
_Rx3, _Roa, _Rx4, _Rx4a, _Rx4b
each is
independently selected from the group consisting of -H and
C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one or more
halogen, which are the
same or different.
More preferably, the one or more further optional substituents are
independently of each other
selected from the group consisting of halogen, -CN, -000Rx1, -
C(0)R',
-C(0)N(Rx1R(i1), -S(0)2N(Rx1Rxi1), - S (0)N(Rx1Rx la),
-S (0)2Rx -S(0)Rx1,
-N(W1)S(0)2N(R xlaRx1b% _
) SRx1, -N(Rx1W la), -NO2, -0C(0)W 1, -N(Rx1)C (0)Rx
-N(Rx1)S(0)2Rx1a, -N(Rx1)S(0)Rxla, -N(Rx1)C(0)0Rx1a, -
N(Rx1)C(0)N(R
xlaRx113),
-0C(0)N(Rx1R)x1a,,
T , C1-10 alkyl, C2-10 alkenyl, and C2-10 alkynyl; wherein -T , Ci-io alkyl,
C2-10 alkenyl, and C2-io alkynyl are optionally substituted with one or more -
W2, which are the
same or different and wherein C1_10 alkyl, C2-10 alkenyl, and C2-10 alkynyl
are optionally
interrupted by one or more groups selected from the group consisting of -r-, -
C(0)0-, -0-,
-C(0)-, -C(0)N(Rx3)-, -S(0)2N(Rx3)-, -S(0)N(Rx3)-, -S(0)2-, -S(0)-, -
N(Rx3)S(0)2N(Rx3a)-,
-S-, -N(Rx3)-, -0C(ORx3)(Rx3a)-, -N(Rx3)C(0)N(Rx3a)-, and -0C(0)N(Rx3)-;
each -Rx1, -Rxla, _Rx113, _Rx3,
K is
independently selected from the group consisting of -H,
halogen, C1_6 alkyl, C2_6 alkenyl, and C2-6 alkynyl;
each T is independently selected from the group consisting of phenyl,
naphthyl, indenyl,
indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, and 8-
to 11-membered
heterobicyclyl; wherein each r is independently optionally substituted with
one or more
which are the same or different;
29
IllfAecue/Date Received 2023-02-08
each -IV' is independently selected from the group consisting of halogen, -CN,
oxo
(-0), -COORx4, -0Rx4, -C(0)R'4, -C(0)N(Rx4R"), -S(0)2N(W4R4a), -S(0)N(W4Rx4a),
-S(0)2Rx4, -S(0)Rx4, -N(R(4)S(0)2N(R"Rx4b), _SR", -N(Rx 4R) x4aµ, -NO2
, -0C(0)Rx4,
-N(Rx4)C(0)R', -N(W4)S(0)2R", -N(R")S(0)Rx4a,
-N(Rx4)C(0)N(Rx4aRx4b), _
OC(0)N(Rx4R'), and C1_6 alkyl; wherein C1_6 alkyl is optionally
substituted with one or more halogen, which are the same or different;
each -Rx4, -Rx4a, _R' is independently selected from the group consisting of -
H, halogen, C1-6
alkyl, C2-6 alkenyl, and C2_6 alkynyl;
Even more preferably, the one or more further optional substituents are
independently of each
other selected from the group consisting of halogen, -CN, -COORxl, -OR'', -
C(0)R'',
-C(0)N(Rx1R)(1a), -S(0)2N(W1Rx1a), -S(0)N(W1Rx la), -S(0)2R'
-N(Rx1)S(0)2N(RxlaR
SRx 1, -N(Rx1Rx la) -NO2
, -0C(0)R' -
N(Rx1)C (0)Rx la,
_Notx i)s(0)2Rx _N(tx )s(o)Rx la, -
N(Rx1)C(0)0Rxla, -N(Rx1)C(0)N(RxlaRx1b),
-0C(0)N(Rx1R
xla),
1 C1-6 alkyl, C2_6 alkenyl, and C2-6 alkynyl; wherein -T , Ci_6 alkyl, C2-6
alkenyl, and C2-6 alkynyl are optionally substituted with one or more -Rx2,
which are the same
or different and wherein C1_6 alkyl, C2-6 alkenyl, and C2-6 alkynyl are
optionally interrupted by
one or more groups selected from the group consisting of -
C(0)0-, -0-, -C(0)-,
-C(0)N(Rx3)-, -S(0)2N(Rx3)-, -S(0)N(Rx3)-, -S(0)2-, -S(0)-, -
N(Rx3)S(0)2N(Rx3a)-, -S-,
-N(Rx3)-, -0C(ORx3)(Rx3a)-, -N(Rx3)C(0)N(R)(3a)-, and -0C(0)N(Rx3)-;
each -Rxl, -R
xla, _Rxlb, _Rx2, _Rx3, _T.x3a
K is independently selected from the group consisting
of -H, halogen, C1_6 alkyl, C2_6 alkenyl, and C2_6 alkynyl;
each T is independently selected from the group consisting of phenyl,
naphthyl, indenyl,
indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, and 8-
to 11-membered
heterobicyclyl; wherein each T is independently optionally substituted with
one or more
which are the same or different.
Preferably, a maximum of 6 -H atoms of an optionally substituted molecule are
independently
replaced by a substituent, e.g. 5 -H atoms are independently replaced by a
substituent, 4 -H
atoms are independently replaced by a substituent, 3 -H atoms are
independently replaced by a
NfAecue/Date Received 2023-02-08
substituent, 2 -H atoms are independently replaced by a substituent, or 1 -H
atom is replaced
by a substituent.
The term "interrupted" means that a moiety is inserted between two carbon
atoms or ¨ if the
insertion is at one of the moiety's ends ¨ between a carbon or heteroatom and
a hydrogen atom,
preferably between a carbon and a hydrogen atom.
As used herein, the term "C14 alkyl" alone or in combination means a straight-
chain or branched
alkyl moiety having 1 to 4 carbon atoms. If present at the end of a molecule,
examples of
straight-chain or branched C1-4 alkyl are methyl, ethyl, n-propyl, isopropyl,
n-butyl, isobutyl,
sec-butyl and tert-butyl. When two moieties of a molecule are linked by the C1-
4 alkyl, then
examples for such C1-4 alkyl groups are -CH2-
, -CH2-CH2-,
-CH(CH3)-, -CH2-CH2-CH2-, -CH(C2H5)-, -C(CH3)2-. Each hydrogen of a C1-4 alkyl
carbon
may optionally be replaced by a substituent as defined above. Optionally, a C1-
4 alkyl may be
interrupted by one or more moieties as defined below.
As used herein, the term "C1-6 alkyl" alone or in combination means a straight-
chain or branched
alkyl moiety having 1 to 6 carbon atoms. If present at the end of a molecule,
examples of
straight-chain and branched C1_6 alkyl groups are methyl, ethyl, n-propyl,
isopropyl, n-butyl,
isobutyl, sec-butyl, tert-butyl, n-pentyl, 2-methylbutyl, 2,2-dimethylpropyl,
n-hexyl, 2-
methylpentyl, 3-methylpentyl, 2,2-dimethylbutyl, 2,3-dimethylbutyl and 3,3-
dimethy 1propyl.
When two moieties of a molecule are linked by the C1-6 alkyl group, then
examples for such
C1-6 alkyl groups are -CH2-, -CH2-CH2-, -CH(CH3)-, -CH2-CH2-CH2-,
-CH(C2H5)- and -C(CH3)2-. Each hydrogen atom of a C1_6 carbon may optionally
be replaced
by a substituent as defined above. Optionally, a C1_6 alkyl may be interrupted
by one or more
moieties as defined below.
Accordingly, "Ci_io alkyl", "C1_20 alkyl" or "C1_50 alkyl" means an alkyl
chain having 1 to 10,
1 to 20 or 1 to 50 carbon atoms, respectively, wherein each hydrogen atom of
the C1-10, C1-20 or
C1-50 carbon may optionally be replaced by a substituent as defined above.
Optionally, a C1_10
or C1-50 alkyl may be interrupted by one or more moieties as defined below.
As used herein, the term "C2_6 alkenyl" alone or in combination means a
straight-chain or
branched hydrocarbon moiety comprising at least one carbon-carbon double bond
having 2 to
31
NfAecue/Date Received 2023-02-08
6 carbon atoms. If present at the end of a molecule, examples are -CH=CH2, -
CH=CH-CH3,
-CH2-CH=CH2, -CH=CHCH2-CH3 and -CH=CH-CH=CH2. When two moieties of a molecule
are linked by the C2-6 alkenyl group, then an example for such C2-6 alkenyl is
-CH=CH-. Each
hydrogen atom of a C2-6 alkenyl moiety may optionally be replaced by a
substituent as defined
above. Optionally, a C2-6 alkenyl may be interrupted by one or more moieties
as defined below.
Accordingly, the teim "C2-10 alkenyl", "C2-20 alkenyl" or "C2-50 alkenyl"
alone or in combination
means a straight-chain or branched hydrocarbon moiety comprising at least one
carbon-carbon
double bond having 2 to 10, 2 to 20 or 2 to 50 carbon atoms. Each hydrogen
atom of a C2_10
alkenyl, C2-20 alkenyl or C2-50 alkenyl group may optionally be replaced by a
substituent as
defined above. Optionally, a C2_10 alkenyl, C2-20 alkenyl or C2-50 alkenyl may
be interrupted by
one or more moieties as defined below.
As used herein, the term "C2_6 alkynyl" alone or in combination means a
straight-chain or
branched hydrocarbon moiety comprising at least one carbon-carbon triple bond
having 2 to 6
carbon atoms. If present at the end of a molecule, examples are -C-CH, CH2-
CH2-
CCH and CH2-CC-CH3. When two moieties of a molecule are linked by the alkynyl
group,
then an example is -CEC-. Each hydrogen atom of a C2-6 alkynyl group may
optionally be
replaced by a substituent as defined above. Optionally, one or more double
bond(s) may occur.
Optionally, a C2-6 alkynyl may be interrupted by one or more moieties as
defined below.
Accordingly, as used herein, the temi "C2_10 alkynyl", "C2_20 alkynyl" and
"C2_50 alkynyl" alone
or in combination means a straight-chain or branched hydrocarbon moiety
comprising at least
one carbon-carbon triple bond having 2 to 10, 2 to 20 or 2 to 50 carbon atoms,
respectively.
Each hydrogen atom of a C2_10 alkynyl, C2_20 alkynyl or C2_50 alkynyl group
may optionally be
replaced by a substituent as defined above. Optionally, one or more double
bond(s) may occur.
Optionally, a C2_10 alkynyl, C2_20 alkynyl or C2_50 alkynyl may be interrupted
by one or more
moieties as defined below.
As mentioned above, a C1-4 alkyl, C1_6 alkyl, Ci_io alkyl, C1-20 alkyl, C1-50
alkyl, C2-6 alkenyl,
C2-11) alkenyl, C2-20 alkenyl, C2-50 alkenyl, C2-6 alkynyl, C2-10 alkynyl, C2-
20 alkenyl or C2-50
alkynyl may optionally be interrupted by one or more moieties which are
preferably selected
from the group consisting of
32
NfAecue/Date Received 2023-02-08
I I I I I I
-HO _____________ , -HS __ ,
OR NR 0 NR 0 0
!
o
I
I
-HN-C-11-1H, and ji '
RI a
S
0
wherein
dashed lines indicate attachment to the remainder of the moiety or reagent;
and
-R and -IV are independently of each other selected from the group consisting
of -H,
methyl, ethyl, propyl, butyl, pentyl and hexyl.
As used herein, the term "C3-10 cycloalkyl" means a cyclic alkyl chain having
3 to 10 carbon
atoms, which may be saturated or unsaturated, e.g. cyclopropyl, cyclobutyl,
cyclopentyl,
cyclohexyl, cyclohexenyl, cycloheptyl, cyclooctyl, cyclononyl or cyclodecyl.
Each hydrogen
atom of a C3-u) cycloalkyl carbon may be replaced by a substituent as defined
above. The term
"C340 cycloalkyl" also includes bridged bicycles like norbomane or norbomene.
The term "8- to 30-membered carbopolycycly1" or "8- to 30-membered
carbopolycycle" means
a cyclic moiety of two or more rings with 8 to 30 ring atoms, where two
neighboring rings share
at least one ring atom and that may contain up to the maximum number of double
bonds
(aromatic or non-aromatic ring which is fully, partially or un-saturated).
Preferably a 8- to
30-membered carbopolycyclyl means a cyclic moiety of two, three, four or five
rings, more
preferably of two, three or four rings.
As used herein, the term "3- to 10-membered heterocycly1" or "3- to 10-
membered heterocycle"
means a ring with 3, 4, 5, 6, 7, 8, 9 or 10 ring atoms that may contain up to
the maximum
number of double bonds (aromatic or non-aromatic ring which is fully,
partially or un-saturated)
wherein at least one ring atom up to 4 ring atoms are replaced by a heteroatom
selected from
the group consisting of sulfur (including -S(0)-, -S(0)2-), oxygen and
nitrogen (including
=N(0)-) and wherein the ring is linked to the rest of the molecule via a
carbon or nitrogen atom.
Examples for 3- to 10-membered heterocycles include but are not limited to
aziridine, oxirane,
33
NfAecue/Date Received 2023-02-08
thiirane, azirine, oxirene, thiirene, azetidine, oxetane, thietane, furan,
thiophene, pyrrole,
pyrroline, imidazole, imidazoline, pyrazole, pyrazoline, oxazole, oxazoline,
isoxazole,
isoxazoline, thiazole, thiazoline, isothiazole, isothiazoline, thiadiazole,
thiadiazoline,
tetrahydrofuran, tetrahydrothiophene, pyrrolidine, imidazolidine,
pyrazolidine, oxazolidine,
isoxazolidine, thiazolidine, isothiazolidine, thiadiazolidine, sulfolane,
pyran, dihydropyran,
tetrahydropyran, imidazolidine, pyridine, pyridazine, pyrazine, pyrimidine,
piperazine,
piperidine, morpholine, tetrazole, triazole, triazolidine, tetrazolidine,
diazepane, azepine and
homopiperazine. Each hydrogen atom of a 3- to 10-membered heterocyclyl or 3-
to 10-
membered heterocyclic group may be replaced by a substituent as defined below.
As used herein, the term "8- to 11-membered heterobicycly1" or "8- to 11-
membered
heterobicycle" means a heterocyclic moiety of two rings with 8 to 11 ring
atoms, where at least
one ring atom is shared by both rings and that may contain up to the maximum
number of
double bonds (aromatic or non-aromatic ring which is fully, partially or un-
saturated) wherein
at least one ring atom up to 6 ring atoms are replaced by a heteroatom
selected from the group
consisting of sulfur (including -S(0)-, -S(0)2-), oxygen and nitrogen
(including =N(0)-) and
wherein the ring is linked to the rest of the molecule via a carbon or
nitrogen atom. Examples
for an 8- to 11-membered heterobicycle are indole, indoline, benzofuran,
benzothiophene,
benzoxazole, benzisoxazole, benzothiazole, benzisothiazole, benzimidazole,
benzimidazoline,
quinoline, quinazoline, dihydroquinazoline, quinoline, dihydroquinoline,
tetrahydroquinoline,
decahydroquinoline, isoquinoline, decahydroisoquinoline,
tetrahydroisoquinoline,
dihydroisoquinoline, benzazepine, purine and pteridine. The term 8- to 11-
membered
heterobicycle also includes spiro structures of two rings like 1,4-dioxa-8-
azaspiro[4.5]decane
or bridged heterocycles like 8-aza-bicyclo[3.2.1]octane. Each hydrogen atom of
an 8- to 11-
membered heterobicyclyl or 8- to 11-membered heterobicycle carbon may be
replaced by a
substituent as defined below.
Similary, the term "8- to 30-membered heteropolycycly1" or "8- to 30-membered
heteropolycycle" means a heterocyclic moiety of more than two rings with 8 to
30 ring atoms,
preferably of three, four or five rings, where two neighboring rings share at
least one ring atom
and that may contain up to the maximum number of double bonds (aromatic or non-
aromatic
ring which is fully, partially or unsaturated), wherein at least one ring atom
up to 10 ring atoms
are replaced by a heteroatom selected from the group of sulfur (including
34
NfAecue/Date Received 2023-02-08
¨S(0)-, -S(0)2-), oxygen and nitrogen (including =N(0)-) and wherein the ring
is linked to the
rest of a molecule via a carbon or nitrogen atom.
It is understood that the phrase "the pair Rx/RY is joined together with the
atom to which they
are attached to form a C3-10 cycloalkyl or a 3- to 10-membered heterocycly1"
in relation with a
moiety of the structure
Rx RY
means that Rx and RY form the following structure:
,
wherein R is C3-10 cycloalkyl or 3- to 10-membered heterocyclyl.
It is also understood that the phrase "the pair Ir/RY is joint together with
the atoms to which
they are attached to form a ring A" in relation with a moiety of the structure
RY
means that RX and RY form the following structure:
A
As used herein, "halogen" means fluoro, chloro, bromo or iodo. It is generally
preferred that
halogen is fluoro or chloro.
In general, the term "comprise" or "comprising" also encompasses "consist of'
or "consisting
of'.
In one aspect the present invention relates to a pharmaceutical composition
comprising a
controlled-release CNP agonist, wherein upon subcutaneous administration of
said controlled-
release CNP agonist a reduction or elimination of one or more side-effects is
obtained compared
NfAecue/Date Received 2023-02-08
to the subcutaneous administration of the corresponding free CNP agonist in an
equivalent
dosage.
Preferably, the side-effects are cardiovascular side-effects, even more
preferably the side-effect
is hypotension.
Preferably the pharmaceutical composition of the present invention comprises
at least 25
nmol/ml of CNP agonist equivalents. More preferably the pharmaceutical
composition
comprises at least 50 nmol/ml of CNP agonist equivalents, such as at least 75
nmol/ml of CNP
agonist equivalents; such as at least 100 nmol/ml of CNP agonist equivalents;
such as at least
150 nmol/ml of CNP agonist equivalents; such as at least 250 nmol/ml of CNP
agonist
equivalents; such as at least 500 nmol/ml of CNP agonist equivalents; such as
at least 750
nmol/ml of CNP agonist equivalents; such as at least 1 timol/m1 of CNP agonist
equivalents.
Preferably, the pharmaceutical composition of the present invention comprises
at most 10
mol/m1 of CNP agonist equivalents.
Preferably one unit dose of the controlled-release CNP agonist comprises at
least 2 nmol/kg;
such as at least 5 nmol/kg; such as at least 10 nmol/kg; such as at least 20
nmol/kg; such as at
least 30 nmolikg; such as at least 40 nmol/kg; such as at least 50 nmol/kg;
such as at least 100
nmol/kg. Preferably one unit dose of the controlled-release CNP agonist
comprises a dose of
no more than 250 ttmol/kg.
Preferably administration of one unit dose of the pharmaceutical composition
provides a
pharmaceutically effective amount of CNP agonist for at least 24 hours. Even
more preferably
administration of one unit dose of the pharmaceutical composition provides a
pharmaceutically
effective amount of CNP agonist for at least 48 hours. Even more preferably
administration of
one "nit dose of the pharmaceutical composition provides a pharmaceutically
effective amount
of CNP agonist for at least 72 hours. Even more preferably administration of
one unit dose of
the pharmaceutical composition provides a pharmaceutically effective amount of
CNP agonist
for at least 96 hours. Even more preferably administration of one unit dose of
the
pharmaceutical composition provides a pharmaceutically effective amount of CNP
agonist for
at least 120 hours. Even more preferably administration of one unit dose of
the pharmaceutical
composition provides a pharmaceutically effective amount of CNP agonist for at
least 144
36
NfAecue/Date Received 2023-02-08
hours. Even more preferably administration of one unit dose of the
pharmaceutical composition
provides a pharmaceutically effective amount of CNP agonist for at least 168
hours.
Said pharmaceutical composition comprises a controlled-release CNP agonist and
at least one
excipient.
In one embodiment said pharmaceutical composition is a liquid or suspension
formulation. It is
understood that the pharmaceutical composition is a suspension formulation if
the controlled-
release CNP agonist is water-insoluble.
In another embodiment said pharmaceutical composition is a dry formulation.
Excipients used in parenteral formulations may be categorized as, for example,
buffering
agents, isotonicity modifiers, preservatives, stabilizers, anti-adsorption
agents, oxidation
protection agents, viscosifiers/viscosity enhancing agents, or other auxiliary
agents. However,
in some cases, one excipient may have dual or triple functions. Preferably,
the at least one
excipient comprised in the pharmaceutical composition of the present invention
is selected from
the group consisting of
(i) Buffering agents: physiologically tolerated buffers to maintain pH in a
desired range,
such as sodium phosphate, bicarbonate, succinate, histidine, citrate and
acetate,
sulphate, nitrate, chloride, pyruvate; antacids such as Mg(OH)2 or ZnCO3 may
be also
used;
(ii) Isotonicity modifiers: to minimize pain that can result from cell
damage due to osmotic
pressure differences at the injection depot; glycerin and sodium chloride are
examples;
effective concentrations can be determined by osmometry using an assumed
osmolality
of 285-315 mOsmol/kg for serum;
(iii) Preservatives and/or antimicrobials: multidose parenteral formulations
require the
addition of preservatives at a sufficient concentration to minimize risk of
patients
becoming infected upon injection and corresponding regulatory requirements
have been
established; typical preservatives include m-cresol, phenol, methylparaben,
ethylparaben, propylparaben, butylparaben, chlorobutanol, benzyl alcohol,
37
NfAecue/Date Received 2023-02-08
phenylmercuric nitrate, thimerosol, sorbic acid, potassium sorbate, benzoic
acid,
chlorocresol, and benzalkonium chloride;
(iv) Stabilizers: Stabilisation is achieved by strengthening of the protein-
stabilising forces,
by destabilisation of the denatured state, or by direct binding of excipients
to the protein;
stabilizers may be amino acids such as alanine, arginine, aspartic acid,
glycine, histidine,
lysine, proline, sugars such as glucose, sucrose, trehalose, polyols such as
glycerol,
mannitol, sorbitol, salts such as potassium phosphate, sodium sulphate,
chelating agents
such as EDTA, hexaphosphate, ligands such as divalent metal ions (zinc,
calcium, etc.),
other salts or organic molecules such as phenolic derivatives; in addition,
oligomers or
polymers such as cyclodextrins, dextran, dendrimers, PEG or PVP or protamine
or H SA
may be used;
(v) Anti-adsorption agents: Mainly ionic or non-ionic surfactants or other
proteins or
soluble polymers are used to coat or adsorb competitively to the inner surface
of the
foimulation's container; e.g., poloxamer (Pluronic F-68), PEG dodecyl ether
(Brij 35),
poly sorbate 20 and 80, dextran, polyethylene glycol, PEG-polyhistidine, BSA
and HSA
and gelatins; chosen concentration and type of excipient depends on the effect
to be
avoided but typically a monolayer of surfactant is formed at the interface
just above the
CMC value;
(vi) Oxidation protection agents: antioxidants such as ascorbic acid,
ectoine, methionine,
glutathione, monothioglycerol, morin, polyethylenimine (PEI), propyl gallate,
and
vitamin E; chelating agents such as citric acid, EDTA, hexaphosphate, and thi
glycolic
acid may also be used;
(vii) Viscosifiers or viscosity enhancers: retard settling of the particles in
the vial and syringe
and are used in order to facilitate mixing and resuspension of the particles
and to make
the suspension easier to inject (i.e., low force on the syringe plunger);
suitable
viscosifiers or viscosity enhancers are, for example, carbomer viscosifiers
like Carbopol
940, Carbopol Ultrez 10, cellulose derivatives like
hydroxypropylmethylcellulose
(hypromellose, HPMC) or diethylaminoethyl cellulose (DEAE or DEAE-C),
colloidal
magnesium silicate (Veegum) or sodium silicate, hydroxyapatite gel, tricalcium
phosphate gel, xanthans, carrageenans like Satia gum UTC 30, aliphatic
poly(hydroxy
38
NfAecue/Date Received 2023-02-08
acids), such as poly(D,L- or L-lactic acid) (PLA) and poly(glycolic acid)
(PGA) and
their copolymers (PLGA), terpolymers of D,L-lactide, glycolide and
caprolactone,
poloxamers, hydrophilic poly (oxy ethy lene) blocks and
hydrophobic
poly(oxypropylene) blocks to make up a triblock of poly(oxyethylene)-
poly (oxypropylene)-poly(oxyethylene) (e.g. PluronicR), polyetherester
copolymer,
such as a polyethylene glycol terephthalate/polybutylene terephthalate
copolymer,
sucrose acetate isobutyrate (SAIB), dextran or derivatives thereof,
combinations of
dextrans and PEG, polydimethylsiloxane, collagen, chitosan, polyvinyl alcohol
(PVA)
and derivatives, polyalkylimides, poly (acrylamide-co-diallyldimethyl ammonium
(DADMA)), polyvinylpyrrolidone (PVP), glycosaminoglycans (GAGs) such as
definatan sulfate, chondroitin sulfate, keratan sulfate, heparin, heparan
sulfate,
hyaluronan, ABA triblock or AB block copolymers composed of hydrophobic A-
blocks,
such as polylactide (PLA) or poly(lactide-co-glycolide) (PLGA), and
hydrophilic B-
blocks, such as polyethylene glycol (PEG) or polyvinyl pyrrolidone; such block
copolymers as well as the abovementioned poloxamers may exhibit reverse
thermal
gelation behavior (fluid state at room temperature to facilitate
administration and gel
state above sol-gel transition temperature at body temperature after
injection);
(viii) Spreading or diffusing agent: modifies the permeability of connective
tissue through the
hydrolysis of components of the extracellular matrix in the intrastitial space
such as but
not limited to hyaluronic acid, a polysaccharide found in the intercellular
space of
connective tissue; a spreading agent such as but not limited to hyaluronidase
temporarily
decreases the viscosity of the extracellular matrix and promotes diffusion of
injected
drugs; and
(ix) Other auxiliary agents: such as wetting agents, viscosity modifiers,
antibiotics,
hyaluronidase; acids and bases such as hydrochloric acid and sodium hydroxide
are
auxiliary agents necessary for pH adjustment during manufacture.
In another aspect the present invention relates to the use of a controlled-
release CNP agonist in
the treatment of a patient having a disease that can be treated with a CNP
agonist, wherein
administration of the controlled-release CNP agonist reduces or eliminates one
or more side-
effects associated with the administration of the corresponding free CNP
agonist in an
equivalent dosage.
39
NfAecue/Date Received 2023-02-08
Preferably the side-effects are cardiovascular side-effects. Even more
preferably the side-effect
is hypotension.
In one embodiment said disease is selected from the group consisting of
achondroplasia,
hypochondroplasia, short stature, dwarfism, osteochondrodysplasias,
thanatophoric dysplasia,
osteogenesis imperfecta, achondrogenesis, chondrodysplasia punctata,
homozygous
achondroplasia, camptomelic dysplasia, congenital lethal hypophosphatasia,
perinatal lethal
type of osteogenesis imperfecta, short-rib polydactyly syndromes, rhizomelic
type of
chondrodysplasia punctata, Jansen-type metaphyseal dysplasia,
spondyloepiphyseal dysplasia
congenita, atelosteogenesis, diastrophic dysplasia, congenital short femur,
Langer-type
mesomelic dysplasia, Nievergelt-type mesomelic dysplasia, Robinow syndrome,
Reinhardt
syndrome, acrodysostosis, peripheral dysostosis, Kniest dysplasia,
fibrochondrogenesis,
Roberts syndrome, acromesomelic dysplasia, micromelia, Morquio syndrome,
Kniest
syndrome, metatrophic dysplasia, spondyloepimetaphyseal dysplasia,
neurofibromatosis,
Legius syndrome, LEOPARD syndrome, Noonan syndrome, hereditary gingival
fibromatosis,
neurofibromatosis type 1, Legius syndrome, cardiofaciocutaneous syndrome,
Costello
syndrome, SHOX deficiency, idiopathic short stature, growth hormone
deficiency,
osteoarthritis, cleidocranial dysostosis, craniosynostosis (e.g., Muenke
syndrome, Crouzon
syndrome, Apert syndrome, Jackson-Weiss syndrome, Pfeiffer syndrome, or
Crouzonodermoskeletal syndrome), dactyly, brachydactyly, camptodactyly,
polydactyly,
syndactyly, dyssegmental dysplasia, enchondromatosis, fibrous dysplasia,
hereditary multiple
exostoses, hypophosphatemic rickets, Jaffe-Lichtenstein syndrome, Marfan
syndrome,
McCune-Albright syndrome, osteopetrosis and osteopoikilosis.
In another embodiment said disease is an ophthalmic disorder, such as glaucoma
and/or
elevated intraocular pressure.
In another embodiment said disease is associated with overactivation of FGFR3
in cancer, e.g.,
multiple myeloma, my eloproliferative syndrome, leukemia, plasma cell
leukemia, lymphoma,
glioblastoma, prostate cancer, bladder cancer, or mammary cancer.
In another embodiment said disease is a vascular smooth muscle disorder,
preferably selected
from the group consisting of hypertension, restenosis, arteriosclerosis, acute
decompensated
NfAecue/Date Received 2023-02-08
heart failure, congestive heart failure, cardiac edema, nephredema, hepatic
edema, acute renal
insufficiency, and chronic renal insufficiency.
In another embodiment said disease is hemorrhagic shock.
In another embodiment said disease is an achondroplasia phenotype selected
from the group
consisting of growth retardation, skull deformities, orthodontic defects,
cervical cord
compression, spinal stenosis, hydrocephalus, hearing loss due to chronic
otitis, cardiovascular
disease, neurological disease, and obesity.
Most preferably said disease is achondroplasia.
Preferably the controlled-release CNP agonist is dosed to a mammal, preferably
to a human,
with a dose of at least 2 nmol/kg; such as with a dose of at least 5 nmol/kg;
such as with a dose
of at least 10 nmoVkg; such as with a dose of at least 20 nmol/kg; such as
with a dose of at least
30 nmol/kg; such as with a dose of at least 40 nmol/kg; such as with a dose of
at least 50
nmol/kg; such as with a dose of at least 100 nmol/kg. Preferably the
controlled-release CNP
agonist will be dosed to a mammal, preferably to a human, with a dose of no
more than 250
timol/kg.
In another aspect the present invention relates to a method of treating a
patient suffering from
a disease that can be treated with a CNP agonist, the method comprising the
step of
administering to said patient a controlled-release CNP agonist, wherein the
administration of
the controlled-release CNP agonist reduces or eliminates one or more side-
effects associated
with the administration of the corresponding free CNP agonist in an equivalent
dosage.
Preferably the side-effects are cardiovascular side-effect. Even more
preferably the side-effect
is hypotension.
In one embodiment said disease is selected from the group consisting of
achondroplasia,
hypochondroplasia, short stature, dwarfism, osteochondrodysplasias,
thanatophoric dysplasia,
osteogenesis imperfecta, achondrogenesis, chondrody splasi a punctata,
homozygous
achondroplasia, camptomelic dysplasia, congenital lethal hypophosphatasia,
perinatal lethal
type of osteogenesis imperfecta, short-rib polydactyly syndromes, rhizomelic
type of
41
NfAecue/Date Received 2023-02-08
chondrodysplasia punctata, Jansen-type metaphyseal dysplasia,
spondyloepiphyseal dysplasia
congenita, atelosteogenesis, diastrophic dysplasia, congenital short femur,
Langer-type
mesomelic dysplasia, Nievergelt-type mesomelic dysplasia, Robinow syndrome,
Reinhardt
syndrome, acrodysostosis, peripheral dysostosis, Kniest dysplasia,
fibrochondrogenesis,
Roberts syndrome, acromesomelic dysplasia, micromelia, Morquio syndrome,
Kniest
syndrome, metatrophic dysplasia, spondyloepimetaphyseal dysplasia,
neurofibromatosis,
Legius syndrome, LEOPARD syndrome, Noonan syndrome, hereditary gingival
fibromatosis,
neurofibromatosis type 1, Legius syndrome, cardiofaciocutaneous syndrome,
Costello
syndrome, SHOX deficiency, idiopathic short stature, growth hormone
deficiency,
osteoarthritis, cleidocranial dysostosis, craniosynostosis (e.g., Muenke
syndrome, Crouzon
syndrome, Apert syndrome, Jackson-Weiss syndrome, Pfeiffer syndrome, or
Crouzonodennoskeletal syndrome), dactyly, brachydactyly, camptodactyly,
polydactyly,
syndactyly, dyssegmental dysplasia, enchondromatosis, fibrous dysplasia,
hereditary multiple
exostoses, hypophosphatemic rickets, Jaffe-Lichtenstein syndrome, Marfan
syndrome,
McCune-Albright syndrome, osteopetrosis and osteopoikilosis.
In another embodiment said disease is an ophthalmic disorder, such as glaucoma
and/or
elevated intraocular pressure.
In another embodiment said disease is associated with overactivation of FGFR3
in cancer, e.g.,
multiple myeloma, myeloproliferative syndrome, leukemia, plasma cell leukemia,
lymphoma,
glioblastoma, prostate cancer, bladder cancer, or mammary cancer.
In another embodiment said disease is a vascular smooth muscle disorder,
preferably selected
from the group consisting of hypertension, restenosis, arteriosclerosis, acute
decompensated
heart failure, congestive heart failure, cardiac edema, nephredema, hepatic
edema, acute renal
insufficiency, and chronic renal insufficiency.
In another embodiment said disease is hemorrhagic shock.
In another embodiment said disease is an achondroplasia phenotype selected
from the group
consisting of growth retardation, skull deformities, orthodontic defects,
cervical cord
compression, spinal stenosis, hydrocephalus, hearing loss due to chronic
otitis, cardiovascular
disease, neurological disease, and obesity.
42
NfAecue/Date Received 2023-02-08
Most preferably said disease is achondroplasia.
Preferably the controlled-release CNP agonist is dosed to a mammal, preferably
to a human,
with a dose of at least 2 nmol/kg; such as with a dose of at least 5 nmol/kg;
such as with a dose
of at least 10 nmol/kg; such as with a dose of at least 20 nmol/kg; such as
with a dose of at least
30 nmol/kg; such as with a dose of at least 40 nmol/kg; such as with a dose of
at least 50
nmol/kg; such as with a dose of at least 100 nmol/kg. Preferably the
controlled-release CNP
agonist will be dosed to a mammal, preferably to a human, with a dose of no
more than 250
timol/kg.
In all embodiments the controlled-release CNP agonist of the present invention
releases at least
one CNP agonist under physiological conditions with a release half-life of at
least 6 hours.
Preferably the controlled-release CNP agonist of the present invention
releases at least one CNP
agonist under physiological conditions with a release half-life of at least 12
hours. Even more
preferably the controlled-release CNP agonist of the present invention
releases at least one CNP
agonist under physiological conditions with a release half-life of at least 24
hours. Even more
preferably the controlled-release CNP agonist of the present invention
releases at least one CNP
agonist under physiological conditions with a release half-life of at least 48
hours. Even more
preferably the controlled-release CNP agonist of the present invention
releases at least one CNP
agonist under physiological conditions with a release half-life of at least 72
hours. Even more
preferably the controlled-release CNP agonist of the present invention
releases at least one CNP
agonist under physiological conditions with a release half-life of at least 96
hours. Even more
preferably the controlled-release CNP agonist of the present invention
releases at least one CNP
agonist under physiological conditions with a release half-life of at least
120 hours. Even more
preferably the controlled-release CNP agonist of the present invention
releases at least one CNP
agonist under physiological conditions with a release half-life of at least
144 hours. Even more
preferably the controlled-release CNP agonist of the present invention
releases at least one CNP
agonist under physiological conditions with a release half-life of at least
168 hours. Even more
preferably the controlled-release CNP agonist of the present invention
releases at least one CNP
agonist under physiological conditions with a release half-life of at least
192 hours.
43
NfAecue/Date Received 2023-02-08
The controlled-release CNP agonist preferably comprises a CNP agonist selected
from the
group consisting of small molecules, natural products, oligonucleotides,
polypeptides and
proteins.
.. In one embodiment the CNP agonist comprises a small molecule. Preferably,
the CNP agonist
is a small molecule.
In another embodiment the CNP agonist comprises a natural product. Preferably,
the CNP
agonist is a natural product.
In another embodiment the CNP agonist comprises an oligonucleotide.
Preferably, such
oligonucleotide is selected from the group consisting of antisense
oligonucleotides, aptamers,
RNAi and siRNA. Preferably, the CNP agonist is an oligonucleotide, more
preferably selected
from the group consisting of antisense oligonucleotides, aptamers, RNAi and
siRNA.
In another embodiment the CNP agonist comprises a protein. Preferably, the CNP
agonist is a
protein.
In a preferred embodiment the CNP agonist comprises a polypeptide. More
preferably the CNP
agonist is a polypeptide. Preferably the CNP agonist comprises a CNP molecule
or moiety.
More preferably the CNP agonist is CNP. Even more preferably the CNP agonist
comprises a
CNP molecule or moiety having the sequence of SEQ ID NO:24, SEQ ID NO:25 or
SEQ ID
NO:30. Even more preferably the CNP agonist is CNP having the sequence of SEQ
ID NO:24,
SEQ ID NO:25 or SEQ ID NO:30. Even more preferably the CNP agonist comprises a
CNP
molecule or moiety CNP having the sequence of SEQ ID NO:24. Most preferably
the CNP
agonist is a CNP having the sequence of SEQ ID NO:24. It is also preferred
that the CNP
agonist is a CNP having the sequence of SEQ ID NO:20. It is also preferred
that the CNP
agonist is a CNP having the sequence of SEQ ID NO:21. It is also preferred
that the CNP
agonist is a CNP having the sequence of SEQ ID NO:22. It is also preferred
that the CNP
agonist is a CNP having the sequence of SEQ ID NO:22. It is also preferred
that the CNP
agonist is a CNP having the sequence of SEQ ID NO:30.
In one embodiment the controlled-release CNP agonist is water-insoluble.
44
NfAecue/Date Received 2023-02-08
Preferably, the controlled-release CNP agonist is selected from the group
consisting of crystals,
nanoparticles, microparticles, nanospheres and microspheres.
In one embodiment the controlled-release CNP agonist is a crystal comprising
at least one CNP
agonist.
In another embodiment the controlled-release CNP agonist is a nanoparticle
comprising at least
one CNP agonist.
In another embodiment the controlled-release CNP agonist is a microparticle
comprising at
least one CNP agonist.
In another embodiment the controlled-release CNP agonist is a nanosphere
comprising at least
one CNP agonist.
In another embodiment the controlled-release CNP agonist is a microsphere
comprising at least
one CNP agonist.
In one embodiment the controlled-release CNP agonist is a vesicle comprising
at least one CNP
agonist. Preferably, such vesicle comprising at least one CNP agonist is a
micelle, liposome or
polymersome.
In one embodiment the controlled-release CNP agonist is a micelle comprising
at least one CNP
agonist.
In another embodiment the controlled-release CNP agonist is a liposome
comprising at least
one CNP agonist. Preferably, such liposome is selected from the group
consisting of
aquasomes; non-ionic surfactant vesicles, such as niosomes and proniosomes;
cationic
liposomes, such as LeciPlex; transfersomes; ethosomes; ufasomes; sphingosomes;
and
pharmacosomes.
In another embodiment the controlled-release CNP agonist is a polymersome
comprising at
least one CNP agonist.
NfAecue/Date Received 2023-02-08
In another embodiment the controlled-release CNP agonist comprises at least
one CNP agonist
non-covalently embedded in a water-insoluble polymer. Preferably, such water-
insoluble
polymer comprises a polymer selected from the group consisting of 2-
methacryloyl-oxyethyl
phosphoyl cholins, poly(acrylic acids), poly(acrylates), poly(acrylamides),
poly(alkyloxy)
polymers, poly(amides), poly(amidoamines), poly(amino acids),
poly(anhydrides),
poly(aspartamides), poly(butyric acids), poly(glycolic acids), polybutylene
terephthalates,
poly(caprolactones), poly(carbonates), poly(cyanoacrylates),
poly(dimethylacrylamides),
poly(esters), poly(ethylenes), poly(ethyleneglycols), poly(ethylene oxides),
poly(ethyl
phosphates), poly(ethyloxazolines), poly(glycolic acids), poly(hydroxyethyl
acrylates),
poly (hy droxy ethyl-oxazolin es),
poly(hydroxymethacrylates),
poly (hy droxypropy lmethacry lami des), poly (hydroxypropyl
methacrylates),
poly(hydroxypropyloxazolines), poly(iminocarbonates), poly(lactic acids),
poly(lactic-co-
glycolic acids), poly(methacrylamides), poly(methacrylates),
poly(methyloxazolines),
poly(organophosphazenes), poly(ortho esters), poly(oxazolines), poly(propylene
glycols),
poly (sil oxanes), poly (urethanes), poly (vinyl alcohols),
poly (vinyl amines),
poly(vinylmethylethers), poly(vinylpyrrolidones), silicones, celluloses,
carbomethyl celluloses,
hydroxypropyl methylcelluloses, chitins, chitosans, dextrans, dextrins,
gelatins, hyaluronic
acids and derivatives, functionalized hyaluronic acids, mannans, pectins,
rhamnogalacturonans,
starches, hydroxy alkyl starches, hy droxy ethyl starches and other
carbohydrate-based polymers,
xylans, and copolymers thereof.
In a preferred embodiment the controlled-release CNP comprises at least one
CNP agonist non-
covalently embedded in poly(lactic-co-glycolic acid) (PLGA).
In another embodiment the controlled-release CNP agonist comprises at least
one CNP agonist
covalently and reversibly conjugated to a water-insoluble polymer. Preferably
such water-
insoluble polymer comprises a polymer selected from the group consisting of 2-
methacryloyl-
oxyethyl phosphoyl cholins, poly(acrylic acids), poly(acrylates),
poly(acrylamides),
poly(alkyloxy) polymers, poly(arnides), poly(amidoamines), poly(amino acids),
poly(anhydrides), poly(aspartamides), poly(butyric acids), poly(glycolic
acids), polybutylene
terephthalates, poly (caprolactones), poly(carbonates), poly
(cyanoacry lates),
poly (dimethylacry lami des), poly (esters), poly (ethylenes), poly (ethy
lenegly c ols), poly (ethyl ene
oxides), poly (ethyl phosphates), poly(ethyloxazolines),
poly(glycolic acids),
poly(hydroxyethyl acrylates), poly(hydroxyethyl-oxazolines),
poly(hydroxymethacrylates),
46
NfAecue/Date Received 2023-02-08
poly (hy droxy propy lmethacry lamides), poly(hydroxypropyl
methacry lates),
poly(hydroxypropyloxazolines), poly(iminocarbonates), poly(lactic acids),
poly(lactic-co-
gly colic acids), poly(methacrylamides), poly(methacrylates),
poly(methyloxazolines),
poly(organophosphazenes), poly(ortho esters), poly(oxazolines), poly(propylene
glycols),
poly(siloxanes), poly(urethanes), poly(vinyl alcohols), poly(vinyl amines),
poly(vinylmethylethers), poly(vinylpyrrolidones), silicones, celluloses,
carbomethyl celluloses,
hydroxypropyl methylcelluloses, chitins, chitosans, dextrans, dextrins,
gelatins, hyaluronic
acids and derivatives, functionalized hyaluronic acids, mannans, pectins,
rhamnogalacturonans,
starches, hydroxyalkyl starches, hydroxyethyl starches and other carbohydrate-
based polymers,
xylans, and copolymers thereof.
Preferably such controlled-release CNP agonist comprising at least one CNP
agonist covalently
and reversibly conjugated to a water-insoluble polymer is a CNP agonist
prodrug comprising a
conjugate D-L, wherein
-D is a CNP agonist moiety; and
-L comprises a reversible prodrug linker moiety -0--;
wherein -LI- is substituted with -L2-Z' and is optionally further substituted;
wherein
-L2- is a single chemical bond or a spacer moiety; and
-Z' is a water-insoluble carrier moiety.
It is understood that a multitude of moieties -L2-L'-D is connected to a water-
insoluble
carrier -Z'.
The water-insoluble carrier -Z' is preferably a hydrogel. Preferably, such
hydrogel comprises a
polymer selected from the group consisting of 2-methacryloyl-oxyethyl
phosphoyl cholins,
poly(acrylic acids), poly(acrylates), poly(acrylarnides), poly (alkyloxy)
polymers,
poly(amides), poly(amidoamines), poly(amino acids), poly(anhydrides),
poly(aspartamides),
poly(butyric acids), poly(glycolic acids), polybutylene terephthalates,
poly(caprolactones),
poly(carbonates), poly(cyanoacrylates),
poly(dimethylacrylamides), poly(esters),
poly(ethylenes), poly(ethyleneglycols), poly(ethylene oxides), poly (ethyl
phosphates),
poly (ethy loxazolines), poly (gly colic acids), poly (hy droxy ethyl
acrylates), poly (hy droxy ethyl-
oxazolines), poly(hydroxymethacrylates), poly
(hy droxypropy lmethacrylami des),
47
NfAecue/Date Received 2023-02-08
poly(hydroxypropyl methacrylates), poly(hydroxypropyloxazolines), poly
(iminocarbonates),
poly(lactic acids), poly(lactic-co-glycolic acids), poly(methacrylamides),
poly(methacrylates),
poly(methyloxazolines), poly(organophosphazenes), poly(ortho esters),
poly(oxazolines),
poly(propylene glycols), poly(siloxanes), poly(urethanes), poly(vinyl
alcohols), poly(vinyl
amines), poly(vinylmethylethers), poly(vinylpyrrolidones), silicones,
celluloses, carbomethyl
celluloses, hydroxypropyl methylcelluloses, chitins, chitosans, dextrans,
dextrins, gelatins,
hyaluronic acids and derivatives, functionalized hyaluronic acids, mannans,
pectins,
rhamnogalacttu-onans, starches, hydroxyalkyl starches, hydroxyethyl starches
and other
carbohydrate-based polymers, xylans, and copolymers thereof.
If the carrier -Z' is a hydrogel, it is preferably a hydrogel comprising PEG
or hyaluronic acid.
Most preferably such hydrogel comprises PEG. In another preferred embodiment
such hydrogel
comprises hyaluronic acid.
Even more preferably, the carrier -Z' is a hydrogel as described in WO
2006/003014 A2, WO
2011/012715 Al or WO 2014/056926 Al.
In another embodiment -Z' is a polymer network formed through the physical
aggregation of
polymer chains, which physical aggregation is preferably caused by hydrogen
bonds,
crystallization, helix formation or complexation. In one embodiment such
polymer network is
a thermogelling polymer.
In another embodiment the controlled-release CNP agonist is water soluble.
In one embodiment the CNP agonist is a polypeptide or protein and the
controlled-release CNP
agonist is a fusion protein comprising such polypeptide or protein CNP agonist
moiety fused to
one or more further polypeptide or protein moiety. Preferably, the CNP agonist
is released from
the fusion protein through enzymatic cleavage. Preferably, such at least one
or more further
polypeptide or protein moieties are selected from the group consisting of
carboxyl-terminal
peptide of the chorionic gonadotropin as described in US 2012/0035101 Al;
albumin; XTEN
sequences as described in WO 2011123813 A2; proline/alanine random coil
sequences as
described in WO 2011/144756 Al; proline/alanine/serine random coil sequences
as described
in WO 2008/155134 Al and WO 2013/024049 Al; and Fc fusion proteins.
48
NfAecue/Date Received 2023-02-08
In a preferred embodiment the controlled-release CNP agonist is a CNP agonist
prodrug of
formula (Ia) or (Ib)
z+2¨LLD
X
(Ia)
D(LLL_Z)
Y (Ib),
wherein
-D is a CNP agonist moiety;
-0- is a reversible prodrug linker moiety;
-L2- is a single chemical bond or a spacer moiety;
-Z is a water-soluble carrier moiety;
xis an integer selected from the group consisting of 1, 2, 3,4, 5, 6, 7, 8, 9,
10, Ti, 12,
13, 14, 15 or 16; and
y is an integer selected from the group consisting of 1, 2, 3, 4 and 5.
Preferably, x of formula (Ia) is an integer selected from the group consisting
of!, 2, 3,4, 6 and
8. More preferably x of formula (Ia) is an integer selected from the group
consisting of 1, 2, 4,
and 6. Even more preferably x of formula (Ia) is an integer selected from the
group consisting
of 1, 4 and 6 and most preferably x of formula (Ia) is T.
Preferably, y of formula (lb) is an integer selected from the group consisting
of 2, 3, 4 and 5,
even more preferably an integer selected from the group consisting of 2, 3 or
4 and most
preferably an integer selected from the group consisting of 2 or 3.
In another preferred embodiment y of formula (Ib) is an integer selected from
the group
consisting of 1, 2 or 3. In one preferred embodiment y of fonnula (Ib) is 1.
In an equally
preferred embodiment y of formula (lb) is 2.
Preferably the controlled-release CNP agonist is a CNP agonist prodrug of
formula (Ia) with x
= T.
The moiety -1)- is a reversible prodrug linker from which the drug, i.e. the
CNP agonist, is
released in its free form, i.e. is a
traceless prodrug linker. Suitable prodrug linkers are
49
NfAecue/Date Received 2023-02-08
known in the art, such as for example the reversible prodrug linker moieties
disclosed in WO
2005/099768 A2, WO 2006/136586 A2, WO 2011/089216 Al and WO 2013/024053 Al.
In another embodiment -0- is a reversible prodrug linker as described in WO
2011/012722 Al,
WO 2011/089214 Al, WO 2011/089215 Al, WO 2013/024052 Al and WO 2013/160340 Al.
The moiety -L1- can be connected to -D through any type of linkage, provided
that it is
reversible. Preferably, -12- is connected to -D through a linkage selected
from the group
consisting of amide, ester, carbamate, acetal, aminal, imine, oxime,
hydrazone, disulfide and
acylguanidine. Even more preferably -L1- is connected to -D through a linkage
selected from
the group consisting of amide, ester, carbamate and acylguanidine. It is
understood that these
linkages may notper se be reversible, but that neighboring groups comprised in
-LI- may render
the linkage reversible.
In a preferred embodiment, the moiety -L1- is connected to -D through an amide
linkage.
A particularly preferred moiety -LI- is disclosed in WO 2009/095479 A2.
Accordingly, in one
preferred embodiment the moiety -L1- is of formula (II):
R3a
X3 RI Rla
µ,2 111
3N A X
_NN, Nx.Y (II)
R2/ R2a I
H* 0
wherein the dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by foiiiiing an amide bond;
-X- is -C(R4R4a)-; -N(R4)-; -0-; -
C(R4R4a)-C(R5R5a)-;
-C(R5R5a)-C(R4R4a)-; -C(R4R4a)-N(R6)-; -N(R6)-C(R4R4a)-; -C(R4R4a)-0-;
-0-C(R4R4a)-; or -C(R7R7a)-;
X1 is C; or S(0);
-X2- is -C(R8R8a)-; or -C(R8R8a)-C(Ielea)-;
=X' is =0; =S; or =N-CN;
-Ria, -R2, -lea, -R4, -R4a, -R5, -R5a, -R6, -R8, -R8a, -R9, -R9a are
independently
selected from the group consisting of -H; and C1_6 alkyl;
NfAecue/Date Received 2023-02-08
-R3, -R3a are independently selected from the group consisting of -H; and C1-6
alkyl,
provided that in case one of -R3, -R3a or both are other than -H they are
connected
to N to which they are attached through an SP3-hybridized carbon atom;
-R7 is -N(RioRma); or -NR1 -(C=0)-R";
_R7a, _R10a,
-R11 are independently of each other -H; or C1_6 alkyl;
optionally, one or more of the pairs -Riai_Raa,
_4a/_5a, _R8ai_R9a
form a chemical bond;
optionally, one or more of the pairs -R1/-R', _R4/_R4a7 _R8/_R8a,
-R9/-R9a are joined together with the atom to which they are attached to form
a
C3-10 cycloalkyl; or 3- to 10-membered heterocyclyl;
optionally, one or more of the
pairs -R1/-R4, -R1/-R5, -R11-R6, -R1/-R7a, -R41-R5, -R41-R6, -R8/-R9, -R2/-R3
are
joined together with the atoms to which they are attached to form a ring A;
optionally, R3/1t3a are joined together with the nitrogen atom to which they
are attached
to form a 3- to 10-membered heterocycle;
A is selected from the group consisting of phenyl; naphthyl;
indenyl; indanyl;
tetralinyl; C3_10 cycloalkyl; 3- to 10-membered heterocyclyl; and 8- to 11-
membered heterobicyclyl; and
wherein -L1- is substituted with -L2-Z or -L2-Z' and wherein -L1- is
optionally further
substituted, provided that the hydrogen marked with the asterisk in formula
(II) is not
replaced by -L2-Z or -L2-Z' or a substituent;
wherein
-L2- is a single chemical bond or a spacer;
-Z is a water-soluble carrier; and
-Z' is a water-insoluble carrier.
Preferably -12- of formula (II) is substituted with one moiety -L2-Z or -L2-
Z7.
The optional further substituents of -L1- of formula (II) are preferably as
described above.
In one embodiment -L1- of formula (II) is not further substituted.
It is understood that if -R3/-R3a of formula (II) are joined together with the
nitrogen atom to
which they are attached to form a 3- to 10-membered heterocycle, only such 3-
to 10-membered
51
NfAecue/Date Received 2023-02-08
heterocycles may be formed in which the atoms directly attached to the
nitrogen are SP3-
hybridized carbon atoms. In other words, such 3- to 10-membered heterocycle
formed
by -R3/-R3a together with the nitrogen atom to which they are attached has the
following
structure:
Qtot
R ,
T/
wherein
the dashed line indicates attachment to the rest of -1}-;
the ring comprises 3 to 10 atoms comprising at least one nitrogen; and
R# and R" represent an SP3-hydridized carbon atom.
It is also understood that the 3- to 10-membered heterocycle may be further
substituted.
Exemplary embodiments of suitable 3- to 10-membered heterocycles formed by -
R3/-R3a of
foimula (II) together with the nitrogen atom to which they are attached are
the following:
( \N
N
/ ,
N R¨ I \T 0/ \I
and \
wherein
dashed lines indicate attachment to the rest of the molecule; and
-R is selected from the group consisting of -H and C1-6 alkyl.
-LI- of foimula (II) may optionally be further substituted. In general, any
substituent may be
used as far as the cleavage principle is not affected, i.e. the hydrogen
marked with the asterisk
in formula (II) is not replaced and the nitrogen of the moiety
3
R \
3a/
52
NfAecue/Date Received 2023-02-08
of formula (II) remains part of a primary, secondary or tertiary amine, i.e. -
R3 and -R3a are
independently of each other -H or are connected to ¨N< through an SP3-
hybridized carbon
atom.
In one embodiment -R1 or -R1a of formula (II) is substituted with -L2-Z or -L2-
Z'. In another
embodiment -R2 or -R2a of formula (II) is substituted with -L2-Z or -L2-Z'. In
another
embodiment -R3 or -R3a of formula (II) is substituted with -L2-Z or -L2-Z'. In
another
embodiment -R4 of formula (II) is substituted with -L2-Z or -L2-Z'. In another
embodiment -R5
or -R5a of formula (II) is substituted with -L2-Z or -L2-Z'. In another
embodiment -R6 of formula
(II) is substituted with -L2-Z or -L2-Z'. In another embodiment -R7 or -R7a of
formula (II) is
substituted with -L2-Z or -L2-Z'. In another embodiment -le or -lea of formula
(II) is substituted
with -L2-Z or -L2-Z'. In another embodiment -R9 or -R9a of formula (II) is
substituted with -L2-Z
or -L2-Z'.
Most preferably -12.4 of formula (II) is substituted with -L2-Z or -L2-Z'.
Preferably, -X- of formula (II) is -C(R4,-K) "a,_
or -N(R4)-. Most preferably, -X- of formula (II)
is -C(R4R4a)-.
Preferably, X1 of formula (II) is C.
Preferably, =X3 of formula (II) is O.
Preferably, -X2- of formula (II) is -C(Ielea)-.
Preferably -R8 and -R8a of formula (II) are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably at least one of -R8 and -R8a of
formula (II) is -H. Even
more preferably both -le and -R8a of formula (II) are -H.
Preferably, -1t1 and -R1a of formula (II) are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably, at least one of -R1 and -R1a of
formula (II) is -H. Even
more preferably both -R1 and -R1a of formula (II) are -H.
53
NfAecue/Date Received 2023-02-08
Preferably, -R2 and -R2a of formula (II) are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably, at least one of -R2 and -R2a of
formula (II) is -H. Even
more preferably both -R2 and -R2a of formula (II) are H.
.. Preferably, -R3 and -R3a of formula (II) are independently selected from
the group consisting
of -H, methyl, ethyl, propyl and butyl. Even more preferably at least one of -
R3 and -R3a of
formula (II) is methyl. In an equally preferred embodiment -R3 and -R3a of
formula (II) are
both -H. In another equally preferred embodiment -R3 and -R3a of formula (II)
are both methyl.
Preferably, -R3 of formula (II) is -H and -R3a of formula (II) is methyl.
Preferably, -R4 and -R4a of formula (II) are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably, at least one of -R4 and -R4a of
formula (II) is -H. Even
more preferably both -R4 and -R4a of formula (II) are -H.
Preferably the moiety -L1- is of fonnula (Ha):
R3a
0 R1 Rla
N X2
RY 'N (Ha)
2 D22 I 4 4a
R R R 0
wherein the dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond;
_Ria, _R2a, _R3, _R3a, _
x lea and -X2- are used as defined in formula (II); and
wherein is substituted with -
L2-Z or -L2-Z' and wherein -L1- is optionally further
substituted, provided that the hydrogen marked with the asterisk in formula
(ha) is not
replaced by -L2-Z or -L2-Z' or a substituent.
Preferably -L1- of formula (Ha) is substituted with one moiety -L2-Z or -L2-
Z'.
The optional further substituents of -L1- of formula (ha) are preferably as
described above.
Preferably the moiety -0- of founula (Ha) is not further substituted.
54
NfAecue/Date Received 2023-02-08
Preferably, -IV and -R1a of formula (ha) are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably, at least one of -R1 and -R1a of
formula (Ha) is -H.
Even more preferably both -le and -R1a of formula (ha) are -H.
Preferably, -le and -lea of formula (Ha) are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably, at least one of -le and -R4a of
formula (Ha) is -H.
Even more preferably both -le and -lea of formula (Ha) are -H.
Preferably, -X2- of formula (Ha) is -C(R8R8a)-.
Preferably -R8 and -R8a of formula (Ha) are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably at least one of -R8 and -lea of
formula (Ha) is -H.
Even more preferably both -R8 and -R8a of formula (Ha) are -H.
Preferably, -R2 and -R2a of formula (ha) are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably, at least one of -R2 and -R2a of
formula (Ha) is -H.
Even more preferably both -R2 and -R2a of formula (Ha) are H.
Preferably, -R3 and -R3a of formula (Ha) are independently selected from the
group consisting
of -H, methyl, ethyl, propyl and butyl. Even more preferably at least one of -
R3 and -R3a of
formula (Ha) is methyl. In an equally preferred embodiment -R3 and -R3a of
formula (Ha) are
both -H. In another equally preferred embodiment -R3 and -R3a of formula (ha)
are both methyl.
Preferably, -R3 of formula (ha) is -H and -R3a of formula (Ha) is methyl.
Preferably the moiety -0- is of formula (IIb):
3a
0
2
3 N
N (Ib)
2 R2a
H* 0
wherein the dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond;
_R2a, _R3a and
A are used as defined in formula (II); and
NfAecue/Date Received 2023-02-08
wherein -L1- is substituted with -L2-Z or -L2-Z' and wherein -L1- is
optionally further
substituted, provided that the hydrogen marked with the asterisk in formula
(Hb) is not
replaced by -L2-Z or -L2-Z' or a substituent.
Preferably -0- of formula (11b) is substituted with one moiety -L2-Z or -L2-
Z'.
The optional further substituents of -L1- of formula (IIb) are preferably as
described above.
Preferably the moiety of formula (Hb) is not further substituted.
Preferably, -X2- of foimula (lib) is -C(R8R8a)-.
Preferably -R8 and -R8a of formula (Jlb) are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably at least one of -R8 and -R8a of
formula (IIb) is -H.
Even more preferably both -R8 and -R8a of formula (lib) are -H.
Preferably, -R2 and -R2a of formula (lib) are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably, at least one of -R2 and -R2a of
formula (Jib) is -H.
Even more preferably both -R2 and -R22 of fonnula (lib) are H.
Preferably, -R3 and -R3a of formula (Jib) are independently selected from the
group consisting
of -H, methyl, ethyl, propyl and butyl. Even more preferably at least one of -
R3 and -R3a of
formula (IIb) is methyl. In an equally preferred embodiment -R3 and -R3a of
formula (lib) are
both -H. In another equally preferred embodiment -R3 and -R3a of formula (Hb)
are both methyl.
Most preferably, -R3 of formula (Hb) is -H and -R3a of formula (Hb) is methyl.
Even more preferably the moiety -L1- is of formula (IIb'):
R3a 0
3 N
2'" 2a
R R H* * 0
wherein
56
NfAecue/Date Received 2023-02-08
wherein the dashed line indicates the attachment to a nitrogen of D which is a
CNP
agonist moiety by forming an amide bond;
the dashed line marked with the asterisk indicates attachment to -L2-;
_R27 _R2a7 _R37 _R3a and
A are used as defined in formula (II); and
wherein 42- is optionally further substituted, provided that the hydrogen
marked with
the asterisk in formula (IIb') is not replaced by a substituent.
Preferably the moiety 42- of formula (IIb') is not further substituted.
Preferably, -X2- of formula (IIb') is -C(R8R8a)-.
Preferably -R8 and -R8a of formula (iib') are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably at least one of -R8 and -R8a of
formula (IIb') is -H.
Even more preferably both -R8 and -R8a of formula (IIb') are -H.
Preferably, -R2 and -R2a of formula (IIb') are independently selected from the
group consisting
of -H, methyl and ethyl. More preferably, at least one of -R2 and -R2a of
formula (IIb') is -H.
Even more preferably both -R2 and -R2a of formula (IIb') are H.
Preferably, -R3 and -R3a of formula (lib') are independently selected from the
group consisting
of -H, methyl, ethyl, propyl and butyl. Even more preferably at least one of -
R3 and -R3a of
folinula (llb') is methyl. In an equally preferred embodiment -R3 and -R3a of
formula (IIb') are
both -H. In another equally preferred embodiment -R3 and -R3a of formula
(lib') are both
methyl.
Most preferably, -R3 of formula (IIb') is -H and -R3a of formula (IIb') is
methyl.
Preferably the moiety 42- is of formula (Tic):
0
(IIc)
H* 0
wherein the dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
57
NfAecue/Date Received 2023-02-08
wherein -L1- is substituted with -L2-Z or -L2-Z' and wherein -L1- is
optionally further
substituted, provided that the hydrogen marked with the asterisk in formula
(IIc) is not
replaced by -L2-Z or -L2-Z' or a substituent.
Preferably -L1- of formula (IIc) is substituted with one moiety -L2-Z or -L2-
Z'.
Preferably the moiety -L1- of formula (TIc) is not further substituted.
In another preferred embodiment the moiety -L1- is of formula (IIc-a):
0
H 2 N 10 (lie-a)
H* 0
wherein the dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
wherein -L1- is substituted with -L2-Z or -L2-Z' and wherein -L1- is
optionally further
substituted, provided that the hydrogen marked with the asterisk in formula
(lie-a) is
not replaced by -L2-Z or -L2-Z' or a substituent.
Preferably -L1- of formula (lie-a) is substituted with one moiety -L2-Z or -L2-
Z'.
Preferably the moiety -L1- of formula (lie-a) is not further substituted.
In another preferred embodiment the moiety -L1- is of formula (IIc-b):
0
ss (IIc-b)
H* 0
wherein the dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by foiiiiing an amide bond; and
wherein -L1- is substituted with -L2-Z or -L2-Z' and wherein -L1- is
optionally further
substituted, provided that the hydrogen marked with the asterisk in formula
(lie-b) is
not replaced by -L2-Z or -L2-Z' or a substituent.
58
NfAecue/Date Received 2023-02-08
Preferably of formula (lie-b) is substituted with one moiety -I2-Z or
Preferably the moiety -L1- of foimula (lie-b) is not further substituted.
Even more preferably the moiety -0- is selected from the group consisting of
formula (IIc-i),
(he-ii), (he-iii), (IIc-iv) and (IIc-v):
0 õ
Tµr (lie-i),
H* 0
0
(IIc-ii),
I - - - -
H* * 0
0
H *
(IIc-),
H* 0
0
(IIc-iv),
H* 0
and
H* 0
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond;
the dashed line marked with the asterisk indicates attachment to -L2-Z or -L2-
Z'; and
-LI- is optionally further substituted, provided that the hydrogen marked with
the
asterisk in formula (IIc-i), (he-ii), (Hc-
iv) and (IIc-v) is not replaced by a
substituent.
59
NfAecue/Date Received 2023-02-08
Preferably, the moiety -LI- of formula (IIc-i), (IIc-ii), (IIc-iii), (Hc-iv)
and (IIc-v) is not further
substituted.
In a particularly preferred embodiment the moiety -L1- is of formula (IIc-ii)
0
(Hc-ii),
0
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -L2-Z or -L2-
Z'.
Preferably -0- of foimula (IIc-ii) is substituted with one moiety -L2-Z or -L2-
Z'.
In an equally preferred embodiment the moiety -Li- is selected from the group
consisting of
founula (IIc-i'), (IIc-ii'), (he-iii'), (Ilc-iv') and (IIc-v'):
0 *
H2 N
H* 0
(IIc-i '),
0
)H:r
H2
-
H* * 0
(IIc-ii'),
0
H N
2
H* 0
(he-iii'),
0
H 2 N N
H* 0
(IIc-iv'), and
NfAecue/Date Received 2023-02-08
H N
H* 0
(lIc-v');
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond;
the dashed line marked with the asterisk indicates attachment to -L2-Z or -L2-
Z'; and
-L1- is optionally further substituted, provided that the hydrogen marked with
the
asterisk in formula (IIc-i'), (IIc-ii'), (IIc-
iv') and (IIc-v') is not replaced by a
substituent.
Preferably, the moiety -L1- of formula (IIc-i'), (IIc-ii'), (IIc-iii'), (IIc-
iv') and (IIc-v') is not
further substituted.
In another particularly preferred embodiment the moiety -L1- is of foimula
(Ilc-ii')
0
H
0
(IIc-ii'),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -L2-Z or -L2-
Z'.
Preferably -L1- of formula (Ilc-ii') is substituted with one moiety -L2-Z or -
L2-Z'.
In an equally preferred embodiment the moiety -L1- is selected from the group
consisting of
formula (IIc-i"), (IIc-ii"), (IIc-iii") and (IIc-iv"):
0 *
H* 0
(IIc-i"),
61
NfAecue/Date Received 2023-02-08
0
H* * 0
(IIc-ii"),
I - - 0
H* 0
(he-iii"), and
0
H* 0
(IIc-iv");
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond;
the dashed line marked with the asterisk indicates attachment to -L2-Z or -L2-
Z'; and
-12- is optionally further substituted, provided that the hydrogen marked with
the
asterisk in formula (IIc-i"), (lie-ii"), (he-iii") and (Hc-iv") is not
replaced by a
substituent.
Preferably, the moiety -0- of formula (IIc-i"), (IIc-ii"), (he-iii") and (IIc-
iv") is not further
substituted.
In another particularly preferred embodiment the moiety -L1- is of formula
(IIc-ii")
0
0
(IIc-ii"),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -L2-Z or -L2-
Z'.
Preferably of formula (Ilc-ii") is substituted with one moiety -L2-Z or -
L2-Z'.
62
NfAecue/Date Received 2023-02-08
The optional further substituents of-L'- of formula (II), (ha), (lib), (lib'),
(IIc), (lie-a), (IIc-b),
(lie-i), (he-ii), (Tic-iii), (IIc-iv), (IIc-v), (IIc-i'), (IIc-ii'), (he-
iii'), (IIc-iv'), (IIc-v'), (lie-i"),
(IIc-ii"), (he-iii") and (IIc-iv") are preferably as described above.
Another preferred moiety -L1- is disclosed in W02016/020373A1. Accordingly, in
another
preferred embodiment the moiety -L1- is of formula (III):
R5 -R6a R6-
R4 R7a R7
R
sa NI
NI
a2 al
3a 3-
2, R2 Rla RI
R R
(III),
wherein
the dashed line indicates attachment to a primary or secondary amine or
hydroxyl of -D
which is a CNP moiety by forming an amide or ester linkage, respectively;
-R1, -Rla, -R2, -Rh, -R3 and -R3a are independently of each other selected
from the group
consisting of -H, , -
C(R8R8aR8b), CODAS, -CEN, -C(=NR8)lea,
-Cle(=CR8aIC-rµ8b), _CCIe and -T;
-R4, -R5 and -R5a are independently of each other selected from the group
consisting
of -H, -C(R9R9aR9b) and -T;
al and a2 are independently of each other 0 or 1;
each -R6, -R6a, -R7, -R7a, _R8, _R8a, _R8b, _R9, lc..Rob are independently of
each other
selected from the group consisting of -H, halogen, -CN, -000R10
,
-0R10, -C(0)R1 , -C(0)N(R1 R1 a), -S(0)2N(R1OR10a), _s(0)N(R1OR10a),
-S(0)2R10, -S(0)R10, , -N(R1 )S(0)2N(RlOaRlOb)s SR10,
, -N(R1OR10a), NO2,
-0C(0)R1 , -N(R1 )C(0)RI0a, -
1=I(R10)S(0)2R10a, _NR10)s(0)R10a,
-N(R10)C(0)0R1th, -N(R1 )C(0)N ),
(RlOaRlObs OC(0)N(R1 R1 a), -T,
C1-20 alkyl, C2-20 alkenyl, and C2-20 alkynyl; wherein -T, Cr-20 alkyl, C2-20
alkenyl,
and C2_20 alkynyl are optionally substituted with one or more -R", which are
the
same or different and wherein Cr-20 alkyl, C2-20 alkenyl, and C2-20 alkynyl
are
optionally interrupted by one or more groups selected from the group
consisting
of -T-, -C(0)0-, -0-, -C(0)-, -C(0)N(R12)-, -S(0)2N(R12)-,
-S(0)N(R12)-, -S(0)2-, -S(0)-, -N(R12)S(0)2N(R12a)-, -S-, -N(R12)-,
-0C(OR12)(R)2a)_, _N(ltr2)c(0)-wr2a)_, and -0C(0)N(R12)-;
each -R1 , -Rroa, K
_-10b
is independently selected from the group consisting of -H, -T, C
20 alkyl, C2-20 alkenyl, and C2-20 alkynyl; wherein -T, C1-20 alkyl, C2-20
alkenyl,
63
NfAecue/Date Received 2023-02-08
and C2-20 alkynyl are optionally substituted with one or more -R11, which are
the
same or different and wherein C1-20 alkyl, C2-20 alkenyl, and C2-20 alkynyl
are
optionally interrupted by one or more groups selected from the group
consisting
of -T-, -C(0)0-, -0-, -C(0)-, -C(0)N(R12)-, -S(0)2N(R12)-,
-S(0)N( ) _s( 0)2-, -S(0)-, -N(R12)S(0)2N( ) -S-, -N(R12)-,
-0C(0R12)(R12a)_, _N(R12)c(o)N(R12as_
),
and -0C(0)N(R12)-;
each T is independently of each other selected from the group consisting of
phenyl,
naphthyl, indenyl, indanyl, tetralinyl, C3_10 cycloalkyl, 3- to 10-membered
heterocyclyl, and 8- to 11-membered heterobicyclyl; wherein each T is
independently optionally substituted with one or more -R11, which are the same
or different;
each -R11 is independently of each other selected from halogen, -CN, oxo
(-0), -000R13, -0R13, -C(0)R13, -C(0)N(R13R13a), _S(0)2N(R13R13a),
,
-S(0)N(R13R13a.µ) S(0)2R13, -S(0)R13, -N(R13)S(0)2N(R13aRl3b), _SR13,
_Noti3Ri3a%
) -NO2, -0C(0)R13, _N(R13)c(0)R13a, _N(R13)S(0)2R13a,
-N(R13)S(0)R13a, -
1\1(2_13)C(0)0R13a, -N(R13)C(0)N(R13aRl3b),
-0C(0)N(R13I(".13a), and C1-6 alkyl; wherein C1_6 alkyl is optionally
substituted
with one or more halogen, which are the same or different;
each -R12, _R12a, _R13, _R13a,
I(l3b is independently selected from the group consisting
of -H, and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one
or
more halogen, which are the same or different;
optionally, one or more of the pairs -Rv_Ria, _R2/_R2a, _R3/_R3a, _R6/_R6a,
_R7/_R7a are
joined together with the atom to which they are attached to form a C3-10
cycloalkyl or a 3- to 10-membered heterocyclyl;
optionally, one or more of the pairs -R1/4e, -R'/-R3, -R1/-R5,
-R21-R3, -R2/-R4, -R21-R6, -R31-
R4, -R31-R5, -R31-R6,
-R3/-R7, -R4/-R5, -R41-R6, -R4/-R7, -R51-R6, -R5/4z7, -R6
1-R7 are joint together
with the atoms to which they are attached to form a ring A;
A is selected from the group consisting of phenyl; naphthyl; indenyl; indanyl;
tetralinyl;
C3-10 cycloalkyl; 3- to 10-membered heterocyclyl; and 8- to 11-membered
heterobicyclyl;
wherein -L1- is substituted with -L2-Z or -L2-Z' and wherein -L1- is
optionally further
substituted;
wherein
64
IllfAecue/Date Received 2023-02-08
-L2- is a single chemical bond or a spacer;
-Z is a water-soluble carrier; and
-Z' is a water-insoluble carrier.
The optional further substituents of -0- of foimula (III) are preferably as
described above.
Preferably -L1- of formula (III) is substituted with one moiety -L2-Z or -L2-
Z'.
In one embodiment -L1- of formula (III) is not further substituted.
Additional preferred embodiments for -L1- are disclosed in EP 1536334B1,
W02009/009712A1, W02008/034122A1, W02009/143412A2, W02011/082368A2, and
US8618124B2.
Additional preferred embodiments for -L1- are disclosed in US8946405B2 and
US8754190B2.
Accordingly, a preferred moiety -L1- is of formula (IV):
2
R5
0
ii I ii '
R C [ C=C _________________ C X C
m I 5
(IV),
wherein
the dashed line indicates attachment to -D which is a CNP agonist moiety and
wherein
attachment is through a functional group of -D selected from the group
consisting of -OH, -SH and -NH2;
m is 0 or 1;
at least one or both of -R1 and -R2 is/are independently of each other
selected from the
group consisting of -CN, -NO2, optionally substituted aryl, optionally
substituted
heteroaryl, optionally substituted alkenyl, optionally substituted
alkynyl, -C(0)R3, -S(0)1e, -S(0)2R3, and -Sle,
one and only one of -R1 and -R2 is selected from the group consisting of -H,
optionally
substituted alkyl, optionally substituted arylalkyl, and optionally
substituted
heteroarylalkyl;
-R3 is selected from the group consisting of -H, optionally substituted
alkyl,
optionally substituted aryl, optionally substituted arylalkyl, optionally
substituted heteroaryl, optionally substituted heteroarylalkyl, -0R9 and -
N(R9)2;
NfAecue/Date Received 2023-02-08
-R4 is selected from the group consisting of optionally substituted alkyl,
optionally
substituted aryl, optionally substituted arylalkyl, optionally substituted
heteroaryl, and optionally substituted heteroarylalkyl;
each -le is independently selected from the group consisting of -H, optionally
substituted alkyl, optionally substituted alkenylalkyl, optionally substituted
alkynylalkyl, optionally substituted aryl, optionally substituted arylalkyl,
optionally substituted heteroaryl and optionally substituted heteroarylalkyl;
-R9 is selected from the group consisting of -H and optionally substituted
alkyl;
-Y- is absent and -X- is -0- or -S-; or
-Y- is -N(Q)CH2- and -X- is -0-;
Q is selected from the group consisting of optionally substituted
alkyl, optionally
substituted aryl, optionally substituted arylalkyl, optionally substituted
heteroaryl and optionally substituted heteroarylalkyl;
optionally, -RI and -R2 may be joined to folui a 3 to 8-membered ring; and
optionally, both -R9 together with the nitrogen to which they are attached
form a
heterocyclic ring;
wherein -LI- is substituted with -L2-Z or -L2-Z' and wherein -L1- is
optionally further
substituted;
wherein
-L2- is a single chemical bond or a spacer;
-Z is a water-soluble carrier; and
-Z' is a water-insoluble carrier.
The optional further substituents of -1,1- of foirnula (IV) are preferably as
described above.
Preferably -0- of formula (IV) is substituted with one moiety -L2-Z or -L2-Z'.
In one embodiment -L1- of formula (IV) is not further substituted.
Only in the context of formula (IV) the terms used have the following meaning:
The temi "alkyl" as used herein includes linear, branched or cyclic saturated
hydrocarbon
groups of 1 to 8 carbons, or in some embodiments 1 to 6 or 1 to 4 carbon
atoms.
66
NfAecue/Date Received 2023-02-08
The term "alkoxy" includes alkyl groups bonded to oxygen, including methoxy,
ethoxy,
isopropoxy, cyclopropoxy, cyclobutoxy, and similar.
The tem "alkenyl" includes non-aromatic unsaturated hydrocarbons with carbon-
carbon
double bonds.
The term "alkynyl" includes non-aromatic unsaturated hydrocarbons with carbon-
carbon triple
bonds.
The term "aryl" includes aromatic hydrocarbon groups of 6 to 18 carbons,
preferably 6 to 10
carbons, including groups such as phenyl, naphthyl, and anthracenyl. The term
"heteroaryl"
includes aromatic rings comprising 3 to 15 carbons containing at least one N,
0 or S atom,
preferably 3 to 7 carbons containing at least one N, 0 or S atom, including
groups such as
pyrrolyl, pyridyl, pyrimidinyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl,
isothiazolyl,
quinolyl, indolyl, indenyl, and similar.
In some instance, alkenyl, alkynyl, aryl or heteroaryl moieties may be coupled
to the remainder
of the molecule through an alkylene linkage. Under those circumstances, the
substituent will be
referred to as alkenylalkyl, alkynylalkyl, arylalkyl or heteroarylalkyl,
indicating that an
alkylene moiety is between the alkenyl, alkynyl, aryl or heteroaryl moiety and
the molecule to
which the alkenyl, alkynyl, aryl or heteroaryl is coupled.
The term "halogen" includes bromo, fluor , chloro and iodo.
The term "heterocyclic ring" refers to a 4 to 8 membered aromatic or non-
aromatic ring
comprising 3 to 7 carbon atoms and at least one N, 0, or S atom. Examples are
piperidinyl,
piperazinyl, tetrahydropyranyl, pyrrolidine, and tetrahydrofuranyl, as well as
the exemplary
groups provided for the tem' "heteroaryl" above.
When a ring system is optionally substituted, suitable substituents are
selected from the group
consisting of alkyl, alkenyl, alkynyl, or an additional ring, each optionally
further substituted.
Optional substituents on any group, including the above, include halo, nitro,
cyano, -OR, -SR, -NR2, -OCOR, -NRCOR, -COOR, -CONR2, -SOR, -SO2R, -SONR2,
67
NfAecue/Date Received 2023-02-08
-SO2NR2, wherein each R is independently alkyl, alkenyl, alkynyl, aryl or
heteroaryl, or two R
groups taken together with the atoms to which they are attached form a ring.
An additional preferred embodiment for -L1- is disclosed in W02013/036857A1.
Accordingly,
a preferred moiety -L1- is of formula (V):
0 H R4
0
I II I II
R¨S¨C _________________ 0¨C-4--
II 12 3
RRo
(V),
wherein
the dashed line indicates attachment to -D which is a CNP agonist moiety and
wherein
attachment is through an amine functional group of -D;
-R1 is selected from the group consisting of optionally substituted Ci-C6
linear,
branched, or cyclic alkyl; optionally substituted aryl; optionally substituted
heteroaryl; alkoxy; and -NR52;
-R2 is selected from the group consisting of -H; optionally
substituted Ci-C6 alkyl;
optionally substituted aryl; and optionally substituted heteroaryl;
-R3 is selected from the group consisting of -H; optionally substituted Cl-
C6 alkyl;
optionally substituted aryl; and optionally substituted heteroaryl;
-le is selected from the group consisting of -H; optionally substituted Ci-C6
alkyl;
optionally substituted aryl; and optionally substituted heteroaryl;
each -R5 is independently of each other selected from the group consisting of -
H;
optionally substituted Ci-C6 alkyl; optionally substituted aryl; and
optionally
substituted heteroaryl; or when taken together two -R5 can be cycloalkyl or
cycloheteroalkyl;
wherein -1,1- is substituted with -L2-Z or -L2-Z' and wherein -L1- is
optionally further
substituted;
wherein
-L2- is a single chemical bond or a spacer;
-Z is a water-soluble carrier; and
-Z' is a water-insoluble carrier.
The optional further substituents of -L1- of folinula (V) are preferably as
described above.
Preferably -0- of formula (V) is substituted with one moiety -L2-Z or -L2-Z'.
68
NfAecue/Date Received 2023-02-08
In one embodiment -L1- of formula (V) is not further substituted.
Only in the context of formula (V) the terms used have the following meaning:
"Alkyl", "alkenyl", and "alkynyl" include linear, branched or cyclic
hydrocarbon groups of 1-
8 carbons or 1-6 carbons or 1-4 carbons wherein alkyl is a saturated
hydrocarbon, alkenyl
includes one or more carbon-carbon double bonds and alkynyl includes one or
more carbon-
carbon triple bonds. Unless otherwise specified these contain 1-6 C.
"Aryl" includes aromatic hydrocarbon groups of 6-18 carbons, preferably 6-10
carbons,
including groups such as phenyl, naphthyl, and anthracene "Heteroaryl"
includes aromatic rings
comprising 3-15 carbons containing at least one N, 0 or S atom, preferably 3-7
carbons
containing at least one N, 0 or S atom, including groups such as pyrrolyl,
pyridyl, pyrimidinyl,
imidazolyl, oxazolyl, isoxazolyl, thiszolyl, isothiazolyl, quinolyl, indolyl,
indenyl, and similar.
The term "substituted" means an alkyl, alkenyl, alkynyl, aryl, or heteroaryl
group comprising
one or more substituent groups in place of one or more hydrogen atoms.
Substituents may
generally be selected from halogen including F, Cl, Br, and I; lower alkyl
including linear,
branched, and cyclic; lower haloalkyl including fluoroalkyl, chloroalkyl,
bromoalkyl, and
iodoalkyl; OH; lower alkoxy including linear, branched, and cyclic; SH; lower
alkylthio
including linear, branched and cyclic; amino, alkylamino, dialkylamino, silyl
including
alkylsilyl, alkoxysilyl, and arylsilyl; nitro; cyano; carbonyl; carboxylic
acid, carboxylic ester,
carboxylic amide, aminocarbonyl; aminoacyl; carbamate; urea; thiocarbamate;
thiourea; ketne;
sulfone; sulfonamide; aryl including phenyl, naphthyl, and anthracenyl;
heteroaryl including 5-
member heteroaryls including as pyrrole, imidazole, furan, thiophene, oxazole,
thiazole,
isoxazole, isothiazole, thiadiazole, triazole, oxadiazole, and tetrazole, 6-
member heteroaryls
including pyridine, pyrimidine, pyrazine, and fused heteroaryls including
benzofuran,
benzothiophene, benzoxazole, benzimidazole, indole, benzothiazole,
benzisoxazole, and
benzisothiazole.
A further preferred embodiment for -L1- is disclosed in US7585837B2.
Accordingly, a
preferred moiety -12- is of formula (VI):
69
NfAecue/Date Received 2023-02-08
Ri R2
R3
R4
_
(VI),
wherein
the dashed line indicates attachment to -D which is a CNP agonist moiety and
wherein
attachment is through an amine functional group of -D;
R1 and R2 are independently selected from the group consisting of hydrogen,
alkyl,
alkoxy, alkoxyalkyl, aryl, alkaryl, aralkyl, halogen, nitro, -S03H, -SO2NHR5,
amino,
ammonium, carboxyl, P03H2, and 0P03H2;
R3, R4, and R5 are independently selected from the group consisting of
hydrogen, alkyl,
and aryl;
wherein -12- is substituted with -L2-Z or -L2-Z' and wherein -L1- is
optionally further
substituted;
wherein
-L2- is a single chemical bond or a spacer;
-Z is a water-soluble carrier; and
-Z' is a water-insoluble carrier.
Suitable substituents for foimulas (VI) are alkyl (such as C1-6 alkyl),
alkenyl (such as C2-6
alkenyl), alkynyl (such as C2-6 alkynyl), aryl (such as phenyl), heteroalkyl,
heteroalkenyl,
heteroalkynyl, heteroaryl (such as aromatic 4 to 7 membered heterocycle) or
halogen moieties.
Preferably -LI- of formula (VI) is substituted with one moiety -L2-Z or -L2-
Z'.
In one embodiment -L1-- of formula (VI) is not further substituted.
Only in the context of formula (VI) the terms used have the following meaning:
The terms "alkyl", "alkoxy", "alkoxyalkyl", "aryl", "alkaryl" and "aralkyl"
mean alkyl radicals
of 1-8, preferably 1-4 carbon atoms, e.g. methyl, ethyl, propyl, isopropyl and
butyl, and aryl
radicals of 6-10 carbon atoms, e.g. phenyl and naphthyl. The term "halogen"
includes bromo,
fluor , chloro and iodo.
NfAecue/Date Received 2023-02-08
A further preferred embodiment for -L1- is disclosed in W02002/089789A1.
Accordingly, a
preferred moiety -12- is of formula (VII):
_____________ L1 __
0 R3 R5 Y
2
I ______________________________ X
R6
wherein
the dashed line indicates attachment to -D which is a CNP agonist moiety and
wherein
attachment is through an amine functional group of -D;
Li is a bifunctional linking group,
Yi and Y2 are independently 0, S or NR7;
R2, R3, le, R5, R6 and R7 are independently selected from the group consisting
of
hydrogen, C1-6 alkyls, C3-12 branched alkyls, C3_8 cycloalkyls, C1-6
substituted alkyls, C3-
8 substituted cycloalkyls, aryls, substituted aryls, aralkyls, Ci_6
heteroalkyls, substituted
C1-6 heteroalkyls, C1-6 alkoxy, phenoxy, and C1-6 heteroalkoxy;
Ar is a moiety which when included in formula (VII) forms a multisubstituted
aromatic
hydrocarbon or a multi-substituted heterocyclic group;
X is a chemical bond or a moiety that is actively transported into a target
cell, a
hydrophobic moiety, or a combination thereof,
y is 0 or 1;
wherein -12- is substituted with -L2-Z or -L2-Z' and wherein -L1- is
optionally further
substituted;
wherein
-L2- is a single chemical bond or a spacer;
-Z is a water-soluble carrier; and
-Z' is a water-insoluble carrier.
Preferably -LI- of formula (VII) is substituted with one moiety -L2-Z or -L2-
Z'.
In one embodiment -LI- of formula (VII) is not further substituted.
71
NfAecue/Date Received 2023-02-08
The optional further substituents of -L1- of formula (VII) are preferably as
described above.
Only in the context of formula (VII) the terms used have the following
meaning:
The term "alkyl" shall be understood to include, e.g. straight, branched,
substituted C1-12 alkyls,
including alkoxy, C3_8 cycloalkyls or substituted cycloalkyls, etc.
The term "substituted" shall be understood to include adding or replacing one
or more atoms
contained within a functional group or compounds with one or more different
atoms.
Substituted alkyls include carboxyalkyls, aminoalkyls, dialkylaminos,
hydroxyalkyls and
mercaptoalkyls; substtued cycloalkyls include moieties such as 4-
chlorocyclohexyl; aryls
include moieties such as napthyl; substituted aryls include moieties such as 3-
bromo-phenyl;
aralkyls include moieties such as toluyl; heteroalkyls include moieties such
as ethylthiophene;
substituted heteroalkyls include moieties such as 3-methoxythiophone; alkoxy
includes
moieities such as methoxy; and phenoxy includes moieties such as 3-
nitrophenoxy. Halo- shall
be understood to include fluoro, chloro, iodo and bromo.
In another preferred embodiment comprises a substructure of formula (VIII)
0 ,
\
\N
(VIII),
wherein
the dashed line marked with the asterisk indicates attachment to a nitrogen of
-D which
is a CNP agonist moiety by foiming an amide bond;
the unmarked dashed lines indicate attachment to the remainder of -L1-; and
wherein -L1- is substituted with -L2-Z or -L2-Z' and wherein -L1- is
optionally further
substituted;
wherein
is a single chemical bond or a spacer;
-Z is a water-soluble carrier; and
-Z' is a water-insoluble carrier.
72
NfAecue/Date Received 2023-02-08
Preferably -L1- of formula (VIII) is substituted with one moiety -L2-Z or -L2-
Z'.
The optional further substituents of -L1- of formula (VIII) are preferably as
described above.
In one embodiment -L1- of formula (VIII) is not further substituted.
In another preferred embodiment -L1- comprises a substructure of foimula (IX)
-*
(IX),
wherein
the dashed line marked with the asterisk indicates attachment to a nitrogen of
-D which
is a CNP agonist moiety by forming a carbamate bond;
the unmarked dashed lines indicate attachment to the remainder of -L1-; and
wherein 42- is substituted with -L2-Z or -L2-Z' and wherein -L1- is optionally
further
substituted;
wherein
-L2- is a single chemical bond or a spacer;
-Z is a water-soluble carrier; and
-Z' is a water-insoluble carrier.
Preferably -L1- of formula (IX) is substituted with one moiety -L2-Z or -L2-
Z'.
The optional further substituents of -L1- of formula (IX) are preferably as
described above.
In one embodiment -L1- of formula (IX) is not further substituted.
Preferably -D of formula (Ia), (Ib), (II), (Ha), (Hb), (IIb'), (Hc), (Hc-i),
(Hc-ii), (Hc-iii), (Hc-iv),
(Hc-v), (Hc-i'), (he-u'), (Hc-iii'), (IIc-iv'), (Hc-v'), (Hc-i"), (IIc-ii"),
(Hc-iii"), (Hc-iv"), (III),
(IV), (V), (VI), (VII), (VIII) and (IX) is a CNP moiety. The moiety -D may be
connected
to -L1- through any functional group of D-H and is preferably connected to -0-
through an
amine functional group of D-H. This may be the N-terminal amine functional
group or an amine
73
NfAecue/Date Received 2023-02-08
functional group provided by a lysine side chain, i.e. by the lysines at
position 9, 11, 15, 16, 20
and 26, if the CNP has the sequence of SEQ ID NO:24.
It was surprisingly found that attachment of -1}- to the ring of a CNP moiety
significantly
reduces the CNP prodrug's affinity to NPR-B compared to attachment at the N-
tenninus or to
the non-ring part of CNP, which reduced affinity to NPR-B in turn reduces the
risk of
cardiovascular side-effects, such as hypotension.
Accordingly, -L1- is preferably conjugated to the side chain of an amino acid
residue of said
ring moiety of -D or to the backbone of said ring moiety of -D. Even more
preferably, -L1- is
covalently and reversibly conjugated to the side chain of an amino acid
residue of said ring
moiety of -D. If -D is a CNP moiety with the sequence of SEQ ID NO:24, -Ll- is
preferably
conjugated to the amine functional group provided by the lysine at position 26
of the
corresponding drug D-H.
The moiety -L2- can be attached to -L1- by replacing any -H present, except
where explicitly
excluded.
The moiety -L2- is a chemical bond or a spacer moiety.
In one embodiment -L2- is a chemical bond.
In another embodiment -L2- is a spacer moiety.
When -L2- is other than a single chemical bond, -L2- is preferably selected
from the group
consisting of -T-, -C(0)0-, -0-, -C(0)-, -C(0)N(RY1)-, -S(0)2N(RY1)-, -
S(0)N(RY1)-, -S(0)2-,
-S(0)-, -N(RY1)S(0)2N(RY1a)-, -S-, -NRY1)-, -0C(ORY1)(Ry la)_, _NRy1)c(0)NRy
-0C(0)N(RY1)-, C1-50 alkyl, C2_50 alkenyl, and C2-50 alkynyl; wherein -T-,
Ci_50 alkyl, C2-50
alkenyl, and C2-50 alkynyl are optionally substituted with one or more -V,
which are the same
or different and wherein C1_50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are
optionally interrupted
by one or more groups selected from the group consisting of -T-, -C(0)0-,
-0-, -C(0)-, -C(0)N(RY3)-, -S(0)2N(RY3)-, -S(0)N(RY3)-, -S(0)2-, -5(0)-,
-N(RY3)S(0)2N(RY3a)-, -S-, -N(RY3)-, -
0C(0RY3)(RY3a)-, -N(RY3)C(0)N(RY3a)-,
and -0C(0)N(RY3)-;
74
NfAecue/Date Received 2023-02-08
-W1 and -Wla are independently of each other selected from the group
consisting of -H, -T,
C1-50 alkyl, C2_50 alkenyl, and C2_50 alkynyl; wherein -T, C1_50 alkyl, C2_50
alkenyl, and C2-50
alkynyl are optionally substituted with one or more -W2, which are the same or
different, and
wherein C1_50 alkyl, C2_50 alkenyl, and C2_50 alkynyl are optionally
interrupted by one or more
groups selected from the group consisting of -T-, -C(0)0-, -0-, -C(0)-, -
C(0)N(R34)-,
-S(0)2N(W4)-, -S(0)N(W4)-, -S(0)2-, -S(0)-, -N(W4)S(0)2N(W4a)-, -S-, -N(W),
-0C(ORY4)(W4a)-, -N(W4)C(0)N(W4a)-, and -0C(0)N(W4)-;
each T is independently selected from the group consisting of phenyl,
naphthyl, indenyl,
indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to
11-membered
heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered
heteropolycyclyl;
wherein each T is independently optionally substituted with one or more -W2,
which are the
same or different;
each -W2 is independently selected from the group consisting of halogen, -CN,
oxo
(=0), -00ORY5, -OW% -C(0)W5, -C(0)N(VW5a), -S(0)2N(W5W5a), -S(0)N(W5W5a),
-S(0)2W5, -S(0)W5, NRY5)S(0)2N(RY5aRY5b), -SRY5, -N(RY5RY5a), -NO2, -0C(0)R5
,
NRY5)C(0)RY5a, -N(RY5)S(0)2RY5a, -N(RY5)S(0)RY5a,
NRY5)C(0)0RY5a,
-RY5)C(0)N(RY51RY5b), -0C(0)N(RY5RY5a), and C1-6 alkyl; wherein Ci_6 alkyl is
optionally
substituted with one or more halogen, which are the same or different; and
each -W3, -W3a, -RY4, -RY4a, -RY5, -RY5a and -W5b is independently selected
from the group
consisting of -H, and C1-6 alkyl, wherein C1-6 alkyl is optionally substituted
with one or more
halogen, which are the same or different.
When -L2- is other than a single chemical bond, -L2- is even more preferably
selected
from -T-, -C(0)0-, -0-, -C(0)-, -C(0)N(W1)-, -S(0)2N(W1)-, -S(0)N(W1)-, -S(0)2-
,
-S(0)-, -N(RY 1) S(0)2N(RY la)-, -S-, -N(W1)-, -0C(ORY1)(RY la)-, -N(RY
1)C(0)N(RY la)-,
-0C(0)N(W1)-, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein C1-
20 alkyl, C2-20
alkenyl, and C2-20 alkynyl are optionally substituted with one or more -W2,
which are the same
or different and wherein C1-20 alkyl, C2-20 alkenyl, and C2-20 alkynyl are
optionally interrupted
by one or more groups selected from the group consisting of -T-, -C(0)0-, -0-,
-C(0)-, -C(0)N(V)-, -S(0)2N(V)-, -S(0)N(W3)-, -S(0)2-, -S(0)-, -
N(W3)S(0)2N(W3a)-,
-S-, -N(W3)-, -0C(ORY3)(Va)-, -N(W3)C(0)N(W3a)-, and -0C(0)N(W3)-;
NfAecue/Date Received 2023-02-08
-W1 and -Wla are independently of each other selected from the group
consisting of -H, -T,
Ci_io alkyl, C2_10 alkenyl, and C2_10 alkynyl; wherein -T, C1_10 alkyl, C2_10
alkenyl, and C2-10
alkynyl are optionally substituted with one or more -W2, which are the same or
different, and
wherein C1_10 alkyl, C2_10 alkenyl, and C2_10 alkynyl are optionally
interrupted by one or more
groups selected from the group consisting of -T-, -C(0)0-, -0-, -C(0)-, -
C(0)N(R34)-,
-S(0)2N(W4)-, -S(0)N(W4)-, -S(0)2-, -S(0)-, -N(W4)S(0)2N(W4a)-, -S-, -N(W),
-0C(0RY4)(Ry4a)_, _N(ty4)c(0)NRy4a) ,_,
and -0C(0)N(W4)-;
each T is independently selected from the group consisting of phenyl,
naphthyl, indenyl,
indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to
i1-membered
heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered
heteropolycyclyl;
wherein each T is independently optionally substituted with one or more -W2,
which are the
same or different;
-RY2 is selected from the group consisting of halogen, -CN, oxo
(=0), -000RY5, -0W5, -C(0)W5, -C(0)N(W5W5a), -S(0)2N(W5W5a), -S(0)N(W5W5a),
-S(0)2W5, -S(0)W5, -NRY5)S(0)2NRY5aRY5b), -
N(RY5RY5a), -NO2, -0C(0)W5,
-N(W5)C(0)W5a, -N(W5)S(0)2W5a, -
N(W5)S(0)W5a, -N(W5)C(0)0W5a,
NRY5)C(ONRY5aRY5b), -0C(0)N(RY5RY5a), and C1-6 alkyl; wherein C1-6 alkyl is
optionally
substituted with one or more halogen, which are the same or different; and
each -ItY3, -Ry3a5 _4y4, _Ry4a, _Ry57 _Ry5a and _,-=Ky513
is independently of each other selected from
the group consisting of -H, and C1-6 alkyl; wherein C1-6 alkyl is optionally
substituted with one
.. or more halogen, which are the same or different.
When -L2- is other than a single chemical bond, -L2- is even more preferably
selected from the
group consisting of -T-, -C(0)0-, -0-, -C(0)-, -C(0)N(W1)-, -S(0)2N(W1)-,
-S(0)N(W1)-, -S(0)2-, -S(0)-, -N(W1)S(0)2N(Wia)-, -S-, -N(W1)-, -
0C(ORY1)(Ryla)_,
NRY1)C(0)N(RY1a)-, -0C(0)N(RY1)-, C1_50 alkyl, C2_50 alkenyl, and C2-50
alkynyl; wherein -T-,
C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally substituted with
one or more -W2,
which are the same or different and wherein C1-50 alkyl, C2-50 alkenyl, and C2-
50 alkynyl are
optionally interrupted by one or more groups selected from the group
consisting of -T-, -C(0)0-
-0-, -C(0)-, -C(0)N(W3)-, -S(0)2N(W3)-, -
S(0)N(W3)-, -S(0)2-,
76
NfAecue/Date Received 2023-02-08
-S(0)-, -N(W3)S(0)2N(W3a)-, -S-, -N(R)-, -0C(OW3)(W3a)-, -N(W3)C(0)N(W3a)-,
and -0C(0)N(W3)-;
-W1 and -Wia are independently selected from the group consisting of -H, -T,
Ci-io alkyl, C2-10
alkenyl, and C2_10 alkynyl;
each T is independently selected from the group consisting of phenyl,
naphthyl, indenyl,
indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to
11-membered
heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered
heteropolycyclyl;
each -W2 is independently selected from the group consisting of halogen, and
C1_6 alkyl; and
each -W3, -Ry3a, _Ry4; _Ry4a; _Ry5; _Ry5a and --r,Ky5to
is independently of each other selected from
the group consisting of -H, and C1-6 alkyl; wherein C1_6 alkyl is optionally
substituted with one
or more halogen, which are the same or different.
Even more preferably, -L2- is a CI-20 alkyl chain, which is optionally
interrupted by one or more
groups independently selected from -0-, -T- and -C(0)N(W1)-; and which C1-20
alkyl chain is
optionally substituted with one or more groups independently selected from -
OH, -T
and -C(0)N(W6Ry6a) ,;
wherein -W1, -W6, ¨RY6a are independently selected from the group
consisting of H and C1-4 alkyl and wherein T is selected from the group
consisting of phenyl,
naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered
heterocyclyl, 8- to
11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-
membered
heteropolycyclyl.
Preferably, -L2- has a molecular weight in the range of from 14 g/mol to 750
g/mol.
Preferably, -L2- comprises a moiety selected from
77
NfAecue/Date Received 2023-02-08
y
,.....4r,'c ,
>s N NR
0 2H0--'if --IS i -4S S ; 1 1
1 1 ,
, , , ,
0 0 S
0 -
¨:--N2:¨ ¨l¨N¨P:¨N __ , ,
-N¨C¨N-
1 I I 1 I a
I
' I '
¨4¨C-0-1¨ Ra R
1 1
0
N-
-FT,-N-.-0 I N-N- ! [7=N C;0,-1 : 7/=11
N-----N
0
N 0
Ni/ I N
\N
--/ 0 =
\ \
. N_0 . N_o
I is4/ I N
N N,i.
j.r._
yr_
e.õ..,,:,/,,
0 0
, , '
,
,
N¨N ¨ ¨
H H H
,and ; ,
wherein
dashed lines indicate attachment to the rest of -L2-, -L1-, -Z and/or -Z',
respectively; and
-R and -Ra are independently of each other selected from the group consisting
of -H, methyl,
ethyl, propyl, butyl, pentyl and hexyl.
78
NfAecue/Date Received 2023-02-08
In one preferred embodiment -L2- has a chain lengths of 1 to 20 atoms.
As used herein the term "chain length" with regard to the moiety -L2- refers
to the number of
atoms of -L2- present in the shortest connection between -L1- and -Z.
Preferably, -L2- is of formula (i)
RI
N
n ,
0
(i),
wherein
the dashed line marked with the asterisk indicates attachment to -L1-;
the unmarked dashed line indicates attachment to -Z or -Z';
-R1 is selected from the group consisting of -H, C1-6 alkyl, C2-6 alkenyl and
C2-6 alkynyl;
n is selected from the group consisting of 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,
11, 12, 13, 14,
15, 16, 17 and 18; and
wherein the moiety of formula (i) is optionally further substituted.
Preferably -R1 of formula (i) is selected from the group consisting of -H,
methyl, ethyl, propyl,
and butyl. Even more preferably -R1 of formula (i) is selected from the group
consisting of -H,
methyl, ethyl and propyl. Even more preferably -R1 of formula (i) is selected
from the group
consisting of -H and methyl. Most preferably -10 of formula (i) is methyl.
Preferably n of formula (i) is selected from the group consisting of 0, 1, 2,
3, 4, 5, 6, 7, 8, 9 and
10. Even more preferably n of formula (i) is selected from the group
consisting of 0, 1, 2, 3, 4
and 5. Even more preferably n of formula (i) is selected from the group
consisting of 0, 1,2 and
3. Even more preferably n of formula (i) is selected from the group consisting
of 0 and 1. Most
preferably n of formula (i) is 0.
In one preferred embodiment -L2- is a moiety selected from the group
consisting of
= N = N
00, ",=
0 0
79
NfAecue/Date Received 2023-02-08
>,\N = N
(iv), ..)", 1.r--.=======%< (v),
0 0
= N
' (vi),'
0 0
= N = N
(ix),
O 0
= N = N
(x), >-=4, `1,r (m),
O 0
= N = N
y\X (6),
=_N
(xiv)' (xv),
0
0
>=N'it:>( (xvi) and >sNy (xvii);
O 0
wherein
the dashed line marked with the asterisk indicates attachment to -L1-;
the unmarked dashed line indicates attachment to -Z or -Z'; and
wherein the moieties (ii), (iii), (iv), (v), (vi), (vii), (viii), (ix), (x),
(xi), (xii), (xiii), (xiv),
(xv), (xvi) and (xvii) are optionally further substituted.
In a preferred embodiment -L2- is selected from the group consisting of
NfAecue/Date Received 2023-02-08
= N =
= = (xv),
0 0
(xvi) and >-=N (xvii);
0 0
wherein
the dashed line marked with the asterisk indicates attachment to -L1-; and
the unmarked dashed line indicates attachment to -Z or -Z'.
Even more preferred -L2- is selected from the group consisting of
= N =,
>-= (xiv) and Ny ocvo
0 0
wherein
the dashed line marked with the asterisk indicates attachment to -L1-; and
the unmarked dashed line indicates attachment to -Z or -Z'.
Even more preferably -L2- is of formula (xvi)
= N
y (xvi)
0
wherein
the dashed line marked with the asterisk indicates attachment to 42-; and
the unmarked dashed line indicates attachment to -Z or -Z'.
In one preferred embodiment the moiety -L'-L2- is selected from the group
consisting of
0
(IId-i), H 0
(IId-ii),
0
0 N
0
0 N
81
NfAecue/Date Received 2023-02-08
0
N (lid-iii), H 0
0 N N (II d- iv),
0 N H
0 NH 0
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z or -Z'.
In an even more preferred embodiment the moiety -L1-L2- is of formula (lid-ii)
0
(II d- ii),
0
0 N
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z or -Z'.
In a most preferred embodiment the moiety -L1-L2- is of formula (lid-u')
0
0
0 N
-----
(lid-ii '),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z or -Z'.
82
NfAecue/Date Received 2023-02-08
In another preferred embodiment the moiety -L1-L2- is selected from the group
consisting of
0
1-1 2 N (Ild-ia), 0
H2N
0 ss (IId-iia),
0 N
0
0, _N
0
0
H2NN)-
H 2 NN (IId-iva),
0
0 H
0
0 NH
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z or -Z'.
In an even more preferred embodiment the moiety -L1-L2- is of formula (IId-
iia)
0
H 2
' (IId-iia),
0
0 N
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z or -Z'.
In a most preferred embodiment the moiety -L1-L2- is of formula (IId-iia')
83
NfAecue/Date Received 2023-02-08
0
H2
N
0
0, _N
(IId-iia'),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z or -Z'.
In another preferred embodiment the moiety -L1-L2- is selected from the group
consisting of
0
NN
(IId- ib), I
0
s',
0
0 N
"*=-= 0
0 N
0
0
0 NH 0
ONH 0
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z or -Z'.
In an even more preferred embodiment the moiety -C-L2- is of formula (lid-jib)
84
NfAecue/Date Received 2023-02-08
0
0
ON
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z or -Z'.
In a most preferred embodiment the moiety -C-L2- is of formula (lid-jib')
0
0
ON
_N
=====,v
(IId-iib'),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z or -Z'.
Preferably, -Z of for ___________________________________________________ mula
(Ia) or (Ib) has a molecular weight ranging from 5 to 200 kDa. Even
more preferably, -Z of formula (Ia) or (Ib) has a molecular weight ranging
from 8 to 100 kDa,
even more preferably ranging from 10 to 80 kDa, even more preferably from 12
to 60, even
more preferably from 15 to 40 and most preferably -Z of formula (Ia) or (Ib)
has a molecular
weight of about 20 kDa. In another equally preferred embodiment -Z of formula
(Ia) or (Ib) has
a molecular weight of about 40 kDa.
The carrier -Z of formula (Ia) or (Ib) comprises a C8-24 alkyl or a polymer.
Preferably, -Z of
formula (Ia) or (lb) comprises a polymer, preferably a polymer selected from
the group
consisting of 2-methacryloyl-oxyethyl phosphoyl cholins, poly(acrylic acids),
poly(acrylates),
poly(acrylamides), poly(alkyloxy) polymers, poly(amides), poly(amidoamines),
poly(amino
acids), poly(anhydrides), poly(aspartamides), poly(butyric acids),
poly(glycolic acids),
NfAecue/Date Received 2023-02-08
polybutylene terephthalates, poly(caprolactones), poly(carbonates),
poly(cyanoacrylates),
poly (dimethy lacry lami des), poly (esters), poly (ethylenes), poly (ethy
lenegly c ol s), poly (ethylene
oxides), poly (ethyl phosphates), poly (ethyloxazolines),
poly(gly colic acids),
poly(hydroxyethyl acrylates), poly(hydroxyethyl-oxazolines),
poly(hydroxymethacrylates),
poly (hy droxypropy lmethacry lamides), poly (hy droxypropyl methacry
lates),
poly(hydroxypropyloxazolines), poly(iminocarbonates), poly(lactic acids),
poly(lactic-co-
glycolic acids), poly(methacrylamides), poly(methacrylates),
poly(methyloxazolines),
poly(organophosphazenes), poly(ortho esters), poly(oxazolines), poly(propylene
glycols),
poly(siloxanes), poly(urethanes), poly (vinyl
alcohols), poly(vinyl amines),
poly(vinylmethylethers), poly(vinylpyrrolidones), silicones, celluloses,
carbomethyl celluloses,
hydroxypropyl methylcelluloses, chitins, chitosans, dextrans, dextrins,
gelatins, hyaluronic
acids and derivatives, functionalized hyaluronic acids, mannans, pectins,
rhamnogalacturonans,
starches, hydroxyalkyl starches, hydroxyethyl starches and other carbohydrate-
based polymers,
xylans, and copolymers thereof.
In another preferred embodiment, -Z of formula (Ia) or (Ib) comprises a fatty
acid derivate.
Preferred fatty acid derivatives are those disclosed in WO 2005/027978 A2 and
WO
2014/060512 Al.
In one embodiment -Z of formula (Ia) or (Ib) comprises a protein. Preferred
proteins are selected
from the group consisting of carboxyl-terminal peptide of the chorionic
gonadotropin as
described in US 2012/0035101 Al; albumin; XTEN sequences as described in WO
2011123813 A2; proline/alanine random coil sequences as described in WO
2011/144756 Al;
proline/alanine/serine random coil sequences as described in WO 2008/155134 Al
and WO
2013/024049 Al; and Fc fusion proteins.
In one embodiment -Z of formula (Ia) or (Ib) is a polysarcosine.
In another preferred embodiment -Z of formula (Ia) or (lb) comprises a poly(N-
methylglycine).
In a particularly preferred embodiment -Z of formula (Ia) or (Ib) comprises a
random coil
protein moiety.
86
NfAecue/Date Received 2023-02-08
In one preferred embodiment -Z of formula (Ia) or (Ib) comprises one random
coil protein
moiety.
In another preferred embodiment -Z of formula (Ia) or (Ib) comprises two
random coil protein
moieties.
In another preferred embodiment -Z of formula (Ia) or (lb) comprises three
random coil protein
moieties.
In another preferred embodiment -Z of formula (Ia) or (lb) comprises four
random coil protein
moieties.
In another preferred embodiment -Z of formula (Ia) or (Ib) comprises five
random coil protein
moieties.
In another preferred embodiment -Z of formula (Ia) or (lb) comprises six
random coil protein
moieties.
In another preferred embodiment -Z of foimula (Ia) or (lb) comprises seven
random coil protein
moieties.
In another preferred embodiment -Z of formula (Ia) or (Ib) comprises eight
random coil proteins
moieties.
Preferably such random coil protein moiety comprises at least 25 amino acid
residues and at
most 2000 amino acids. Even more preferably such random coil protein moiety
comprises at
least 30 amino acid residues and at most 1500 amino acid residues. Even more
preferably such
random coil protein moiety comprises at least 50 amino acid residues and at
most 500 amino
acid residues.
In a preferred embodiment, -Z of formula (Ia) or (Ib) comprises a random coil
protein moiety
of which at least 80%, preferably at least 85%, even more preferably at least
90%, even more
preferably at least 95%, even more preferably at least 98% and most preferably
at least 99% of
the total number of amino acids forming said random coil protein moiety are
selected from
87
NfAecue/Date Received 2023-02-08
alanine and proline. Even more preferably, at least 10%, but less than 75%,
preferably less than
65%, of the total number of amino acid residues of such random coil protein
moiety are proline
residues. Preferably, such random coil protein moiety is as described in WO
2011/144756 Al.
Even more preferably -Z comprises at least one moiety selected from the group
consisting of
SEQ ID NO:!, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6,
SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID
NO:12,
SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID
NO:51 and SEQ ID NO:61 as disclosed in W02011/144756. A moiety comprising such
random
coil protein comprising alanine and proline will be referred to as "PA" or "PA
moiety".
Accordingly, -Z of foimula (Ia) or (Ib) comprises a PA moiety.
In an equally preferred embodiment, -Z of formula (Ta) or (Ib) comprises a
random coil protein
moiety of which at least 80%, preferably at least 85%, even more preferably at
least 90%, even
more preferably at least 95%, even more preferably at least 98% and most
preferably at least
99% of the total number of amino acids forming said random coil protein moiety
are selected
from alanine, serine and proline. Even more preferably, at least 4%, but less
than 40% of the
total number of amino acid residues of such random coil protein moiety are
proline residues.
Preferably, such random coil protein moiety is as described in WO 2008/155134
Al. Even more
preferably -Z of formula (Ia) or (Ib) comprises at least one moiety selected
from the group
consisting of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID
NO:10,
SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID
NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32,
SEQ
ID NO:34, SEQ ID NO:36, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID
NO:46,
SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54 and SEQ ID NO:56 as disclosed in WO
2008/155134 Al. A moiety comprising such random coil protein moiety comprising
alanine,
serine and proline will be referred to as "PAS" or "PAS moiety".
Accordingly, -Z of formula (Ia) or (Ib) comprises a PAS moiety.
In an equally preferred embodiment, -Z of formula (Ia) or (Ib) comprises a
random coil protein
moiety of which at least 80%, preferably at least 85%, even more preferably at
least 90%, even
more preferably at least 95%, even more preferably at least 98% and most
preferably at least
99% of the total number of amino acids forming said random coil protein moiety
are selected
88
NfAecue/Date Received 2023-02-08
from alanine, glycine and proline. A moiety comprising such random coil
protein moiety
comprising alanine, glycine and proline will be referred to as "PAG" or "PAG
moiety".
Accordingly, -Z of formula (Ia) or (Ib) comprises a PAG moiety.
In an equally preferred embodiment, -Z of formula (Ia) or (Ib) comprises a
random coil protein
moiety of which at least 80%, preferably at least 85%, even more preferably at
least 90%, even
more preferably at least 95%, even more preferably at least 98% and most
preferably at least
99% of the total number of amino acids forming said random coil protein moiety
are selected
from proline and glycine. A moiety comprising such random coil protein moiety
comprising
proline and glycine will be referred to as "PG" or "PG moiety".
Preferably, such PG moiety comprises a moiety of formula (a-0)
[(Gly)p-Pro-(Gly)dr (a-0);
wherein
p is selected from the group consisting of 0, 1, 2, 3, 4 and 5;
q is selected from the group consisting of 0, 1, 2, 3,4 and 5;
r is an integer ranging from and including 10 to 1000;
provided that at least one of p and q is at least 1;
Preferably, p of formula (a-0) is selected from the group consisting of 1, 2
and 3.
Preferably, q of formula (a-0) is selected from 0, 1 and 2.
Even more preferably the PG moiety comprises the sequence of SEQ ID NO:97:
GGPGGPGPGGPGGPGPGGPG
Even more preferably, the PG moiety comprises the sequence of formula (a-0-a)
(GGPGGPGPGGPGGPGPGGPG), (a-0-a),
wherein
v is an integer ranging from and including 1 to 50.
It is understood that the sequence of formula (a-0-a) comprises v replicates
of the
sequence of SEQ ID NO:97.
89
NfAecue/Date Received 2023-02-08
Accordingly, -Z of formula (Ia) or (Ib) comprises a PG moiety.
In an equally preferred embodiment, -Z of formula (Ia) or (Ib) comprises a
random coil protein
moiety of which at least 80%, preferably at least 85%, even more preferably at
least 90%, even
more preferably at least 95%, even more preferably at least 98% and most
preferably at least
99% of the total number of amino acids forming said random coil protein moiety
are selected
from alanine, glycine, serine, threonine, glutamate and prolific. Preferably,
such random coil
protein moiety is as described in WO 2010/091122 Al. Even more preferably -Z
of formula
(Ia) or (Ib) comprises at least one moiety selected from the group consisting
of SEQ ID NO:182,
SEQ ID NO:183, SEQ ID NO:184; SEQ ID NO:185, SEQ ID NO:186, SEQ ID NO:187, SEQ
ID NO:188, SEQ ID NO:189, SEQ ID NO:190, SEQ ID NO:191, SEQ ID NO:192, SEQ ID
NO:193, SEQ ID NO:194, SEQ ID NO:195, SEQ ID NO:196, SEQ ID NO:197, SEQ ID
NO:198, SEQ ID NO:199, SEQ ID NO:200, SEQ ID NO:201, SEQ ID NO:202, SEQ ID
NO:203, SEQ ID NO:204, SEQ ID NO:205, SEQ ID NO:206, SEQ ID NO:207, SEQ ID
NO:208, SEQ ID NO:209, SEQ ID NO:210, SEQ ID NO:211, SEQ ID NO:212, SEQ ID
NO:213, SEQ ID NO:214, SEQ ID NO:215, SEQ ID NO:216, SEQ ID NO:217, SEQ ID
NO:218, SEQ ID NO:219, SEQ ID NO:220, SEQ ID NO:221, SEQ ID NO:759, SEQ ID
NO:760, SEQ ID NO:761, SEQ ID NO:762, SEQ ID NO:763, SEQ ID NO:764, SEQ ID
NO:765, SEQ ID NO:766, SEQ ID NO:767, SEQ ID NO:768, SEQ ID NO:769, SEQ ID
NO:770, SEQ ID NO:771, SEQ ID NO:772, SEQ ID NO:773, SEQ ID NO:774, SEQ ID
NO:775, SEQ ID NO:776, SEQ ID NO:777, SEQ ID NO:778, SEQ ID NO:779, SEQ ID
NO:1715, SEQ ID NO:1716, SEQ ID NO:1718, SEQ ID NO:1719, SEQ ID NO:1720, SEQ
ID
NO:1721 and SEQ ID NO:1722 as disclosed in W02010/091122A1. A moiety
comprising such
random coil protein moiety comprising alanine, glycine, serine, threonine,
glutamate and
proline will be referred to as "XTEN" or "XTEN moiety" in line with its
designation in WO
2010/091122 Al.
Accordingly, -Z of formula (Ia) or (Ib) comprises an XTEN moiety.
In another preferred embodiment -Z of formula (Ia) or (lb) is a hyaluronic
acid-based polymer.
In one embodiment -Z of formula (Ia) or (Ib) is a carrier as disclosed in WO
2012/02047 Al.
NfAecue/Date Received 2023-02-08
In another embodiment -Z of formula (Ia) or (Ib) is a carrier as disclosed in
WO 2013/024048
Al.
In another preferred embodiment -Z of formula (Ia) or (Ib) is a PEG-based
polymer. Even more
preferably -Z is a branched or multi-arm PEG-based polymer.
In a preferred embodiment -Z of formula (Ia) or (Ib) is a branched polymer. In
one
embodiment -Z of formula (Ia) or (Ib) is a branched polymer having one, two,
three, four, five
or six branching points. Preferably, -Z of formula (Ia) or (Ib) is a branched
polymer having one,
two or three branching points. In one embodiment -Z of formula (Ia) or (Ib) is
a branched
polymer having one branching point. In another embodiment -Z of formula (Ia)
or (lb) is a
branched polymer having two branching points. In another embodiment -Z of
formula (Ia) or
(Ib) is a branched polymer having three branching points.
A branching point is preferably selected from the group consisting of -N<, -
CH< and >C<.
Preferably such branched moiety -Z of formula (Ia) or (Ib) is PEG-based.
In one embodiment such branched moiety -Z of formula (Ia) or (Ib) has a
molecular weight
ranging from and including 5 kDa to 500 kDa, more preferably ranging from and
including 10
kDa to 250 Da, even more preferably ranging from and including 10 kDa to 150
kDa, even
more preferably ranging from and including 12 kDa to 100 kDa and most
preferably ranging
from and including 15 kDa to 80 kDa.
Preferably, such branched moiety -Z of fonnula (Ia) or (Ib) has a molecular
weight ranging
from and including 10 kDa to 80 kDa. In one embodiment the molecular weight is
about 10
kDa. In another embodiment the molecular weight of such branched moiety -Z of
formula (Ia)
or (Ib) is about 20 kDa. In another embodiment the molecular weight of such
branched
moiety -Z of fonnula (Ia) or (Ib) is about 30 kDa. In another embodiment the
molecular weight
of such a branched moiety -Z of formula (Ia) or (lb) is about 40 kDa. In
another embodiment
.. the molecular weight of such a branched moiety -Z of formula (Ia) or (Ib)
is about 50 kDa. In
another embodiment the molecular weight of such a branched moiety -Z of
formula (Ia) or (lb)
is about 60 kDa. In another embodiment the molecular weight of such a branched
moiety -Z of
formula (Ia) or (Ib) is about 70 kDa. In another embodiment the molecular
weight of such a
91
NfAecue/Date Received 2023-02-08
branched moiety -Z of formula (Ia) or (Ib) is about 80 kDa. Most preferably,
such branched
moiety -Z of formula (Ia) or (Ib) has a molecular weight of about 40 kDa.
Applicants found that an N-terminal attachment of a moiety -L1-L2-Z is
significantly more
efficient with regard to NEP-stability than attachment at an internal site and
that the least
efficient attachment site with regard to NEP-stability is at the ring part of
a CNP moiety.
However, applicants surprisingly found that this disadvantage of attachment to
the ring with
regard to NEP-stability can be compensated by using a branched moiety -Z
having a molecular
weight of at least 10 kDa, such as at least 12 kDa, such as at least 15 kDa,
such as at least 18
kDa, such as at least 20 kDa, such as at least 24 kDa, such as at least 25
kDa, such as at least
27 kDa, such as at least 30 kDa. Preferably, such branched moiety -Z has a
molecular weight
of no more than 500 kDa, preferably of no more than 250 kDa, preferably of no
more than 200
Da, preferably of no more than 150 kDa and most preferably no more than 100
kDa. Most
preferably such branched moiety -Z has a molecular weight of about 40 kDa.
Consequently, the
use of such branched moiety -Z at the ring part of the CNP moiety does not
only lead to
increased NEP-stability, but combines increased NEP-stability with reduced NPR-
B binding
associated with attachment to the ring.
It was surprisingly found that even though the ring moiety is involved in NPR-
C binding,
attachment of a 5 kDa carrier to the ring moiety did not have a significant
effect on NPR-C
affinity. Furthermore, it was surprisingly found that a 4x 10 kDa carrier,
i.e. a branched carrier
having four 10 kDa arms, attached to the ring moiety is more efficient in
reducing NPR-C
affinity than a 2x 20 kDa carrier, i.e. a branched carrier having two 20 kDa
arms, even though
the total molecular weight was the same. It is thus not only the total
molecular weight of the
carrier attached to the ring moiety, but the particular branching pattern of
the carrier that
influences NPR-C binding affinity.
This finding is also supported by the NPR-C affinity measured with a 4-arm 40
kDa carrier
having a different branching pattern which still exhibited a high NPR-C
affinity.
In summary, it was surprisingly found that NPR-C affinity can be efficiently
reduced with a
multi-branched carrier attached to the ring moiety having a first branching
point close to the
CNP moiety, such as less than 300 atoms from the CNP moiety, preferably 200
atoms from the
CNP moiety, even more preferably 100 atoms from the CNP moiety, even more
preferably less
92
NfAecue/Date Received 2023-02-08
than 50 atoms from the CNP moiety, even more preferably less than 25 atoms
from the CNP
moiety and most preferably less than 10 atoms from the CNP moiety.
Even more preferably, one or more further branching point(s) is/are located
within less than
500 atoms from the CNP moiety, even more preferably 300 atoms from the CNP
moiety, even
more preferably less than 200 atoms from the CNP moiety, even more preferably
less than 100
atoms from the CNP moiety, even more preferably less than 75 atoms from the
CNP moiety,
even more preferably less than 50 atoms from the CNP moiety, even more
preferably less than
40 atoms from the CNP moiety and most preferably less than 35 atoms from the
CNP moiety.
It was in addition also found that such branching pattern is beneficial for in
vivo stability of the
CNP moiety, i.e. protection against proteolytic degradation. It was
surprisingly found that N-
teiminal degradation was stronger when using a 2x 20 kDa carrier compared to
4x 10 kDa
carrier. Likewise, using a 4-arm 40 kDa carrier having a different branching
pattern exhibited
even stronger N-terminal degradation.
Preferably, -Z or -Z' comprises a moiety
4N-L
= S
0
In an equally preferred embodiment -Z or -Z' comprises an amide bond.
In one embodiment ¨Z of foimula (Ia) or (Ib) comprises a moiety of foimula (a)
se¨?
- õ
j_sa_BPa¨Sa¨Pa
-I a
1. Ill , III
Sa¨Pa (a),
wherein
the dashed line indicates attachment to -L2- or to the remainder of -Z;
BP a is a branching point selected from the group consisting of -N<, -CR< and
>C<;
-R is selected from the group consisting of -H and C1.6 alkyl;
a is 0 if BPa is -N< or -CR< and n is 1 if BPa is >C<;
93
NfAecue/Date Received 2023-02-08
-Sa'-, -Sa"- and -Sa-- are independently of each other a chemical bond or are
selected from the group consisting of C1-50 alkyl, C2-50 alkenyl, and C2-50
alkynyl;
wherein C1_50 alkyl, C2_50 alkenyl, and C2_50 alkynyl are optionally
substituted with one
or more -R1, which are the same or different and wherein C1-50 alkyl, C2-50
alkenyl, and
C2-50 alkynyl are optionally interrupted by one or more groups selected from
the group
consisting of -T-, -C(0)0-, -0-, -C(0)-, -C(0)N(R2)-, -S(0)2N(R2)-, -S(0)N(R2)-
,
-S(0)2-, -S(0)-, -N(R2)S(0)2N(R2a)-, -S-,
-N(R2)-, -0C(OR2)(R2a)_,
-MR2)C(0)N(R2a)-, and -0C(0)N(R2)-;
each -T- is independently selected from the group consisting of phenyl,
naphthyl,
indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered
heterocyclyl, 8- to
11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-
membered heteropolycyclyl; wherein each -T- is independently optionally
substituted
with one or more -R1, which are the same or different;
each -RI is independently selected from the group consisting of halogen, -CN,
oxo
(=0), -COOR3, -0R3, -C(0)R3, -C(0)N(R3R3a), -S(0)2N(R3R3a), -S(0)N(R3R3a),
-S(0)2R3, -S(0)R3, -N(R3)S(0)2N(R3aR3b), -SR3, -N(R3R3a), -NO2, -0C(0)R3,
-N(R3)C(0)R3a, -N(R3)S(0)2R3a, -
N(R3)S(0)R3a, -N(R3)C(0)0R3a,
-N(R3)C(0)N(R3aR3b), -0C(0)N(R3R3a), and C1-6 alkyl; wherein C1-6 alkyl is
optionally
substituted with one or more halogen, which are the same or different;
each -R2, -RZa, _R3a and K _.,3b
is independently selected from the group consisting
of -H, and C1-6 alkyl, wherein C1-6 alkyl is optionally substituted with one
or more
halogen, which are the same or different; and
-Pa', -Pa" and -Pa- are independently a polymeric moiety.
Optionally, the moiety of fonaula (a) is substituted with one or more
substituents.
In one embodiment BP a of formula (a) is -N<.
In another embodiment BP a of formula (a) is -CR<. Preferably, -R is -H.
Accordingly, a of
foimula (a) is preferably 0.
In another embodiment BP a of formula (a) is >C<.
In one embodiment -Sa- of formula (a) is a chemical bond.
94
NfAecue/Date Received 2023-02-08
In another embodiment -Sa- of formula (a) is selected from the group
consisting of Ci-io alkyl,
C2-10 alkenyl and C2-10 alkynyl, which Ci_io alkyl, C2_10 alkenyl and C2_10
alkynyl are optionally
interrupted by one or more chemical groups selected from the group consisting
of
-C(0)0-, -0-, -C(0)-, -C(0)N(10-, -S(0)2N(R4)-, -S(0)N(R4)-, -S(0)2-, -S(0)-,
-N(R4)S(0)2N(R4a)-, -S-, -N(R4)-, -0C(0R4)(R4a)-, -N(R4)C(0)N(R4a)-, and -
0C(0)N(R4)-;
wherein -R4 and -R4a are independently selected from the group consisting of -
H, methyl, ethyl,
propyl and butyl. Preferably -Sa- of formula (a) is selected from the group
consisting of methyl,
ethyl, propyl, butyl, which are optionally interrupted by one or more chemical
groups selected
from the group consisting of -0-, -C(0)- and -C(0)N(R4)-.
In one embodiment -Sa'- of formula (a) is a chemical bond.
In another embodiment -Si"- of formula (a) is selected from the group
consisting of Ci_io alkyl,
C2-10 alkenyl and C2-10 alkynyl, which Ci-io alkyl, C2-10 alkenyl and C240
alkynyl are optionally
interrupted by one or more chemical groups selected from the group consisting
of
-C(0)0-, -0-, -C(0)-, -C(0)N(R4)-, -S(0)2N(R4)-, -S(0)N(R4)-, -S(0)2-, -S(0)-,
-N(R4)S(0)2N(R4a)-, -S-, -N(R4)-, -0C(OR4)(R4a)_, _N(R4)c(o)NqR4a) ,_,
and -0C(0)N(R4)-;
wherein -R4 and -R4a are independently selected from the group consisting of -
H, methyl, ethyl,
propyl and butyl. Preferably -Sa'- of formula (a) is selected from the group
consisting of
methyl, ethyl, propyl, butyl, which are optionally interrupted by one or more
chemical groups
selected from the group consisting of -0-, -C(0)- and -C(0)N(R4)-.
In one embodiment -Sa"- of formula (a) is a chemical bond.
In another embodiment -Sa"- of formula (a) is selected from the group
consisting of Ci-io alkyl,
C2_10 alkenyl and C2_10 alkynyl, which Ci_io alkyl, C2-10 alkenyl and C2_10
alkynyl are optionally
interrupted by one or more chemical groups selected from the group consisting
of
-C(0)0-, -0-, -C(0)-, -C(0)N(R4)-, -S(0)2N(R4)-, -S (0)N(R4)-,- S (0)2-, -S(0)-
,
-N(R4)S(0)2N(R4a)-, -S-, -N(R4)-, -0C(OR4)(R4a)-, -N(R4)C(0)N(R4a)-, and -
0C(0)N(R4)-;
wherein -R4 and -R4a are independently selected from the group consisting of -
H, methyl, ethyl,
propyl and butyl. Preferably -Sa"- of formula (a) is selected from the group
consisting of methyl,
ethyl, propyl, butyl, which are optionally interrupted by one or more chemical
groups selected
from the group consisting of -0-, -C(0)- and -C(0)N(R4)-.
NfAecue/Date Received 2023-02-08
In one embodiment -Sa-- of formula (a) is a chemical bond.
In another embodiment -Sa-- of formula (a) is selected from the group
consisting of Ci-u) alkyl,
C2-10 alkenyl and C2_10 alkynyl, which Ci_io alkyl, C2-10 alkenyl and C2_10
alkynyl are optionally
interrupted by one or more chemical groups selected from the group consisting
of
-C(0)0-, -0-, -C(0)-, -C(0)N(R4)-, -S(0)2N(R4)-, -S (0)N(R4)-,- S (0)2-, -S(0)-
,
-N(R4)S(0)2N(R4a)-, -S-, -N(R4)-, -0C(0R4)(R41_, _NR4)c(0)N(R4a)_, and -
0C(0)N(R4)-;
wherein -R4 and -R4a are independently selected from the group consisting of -
H, methyl, ethyl,
propyl and butyl. Preferably -Sa-- of formula (a) is selected from the group
consisting of
methyl, ethyl, propyl, butyl, which are optionally interrupted by one or more
chemical groups
selected from the group consisting of -0-, -C(0)- and -C(0)N(R4)-.
Preferably, -Pa', -Pa- and -Pa" of formula (a) independently comprise a
polymer selected from
the group consisting of 2-methacryloyl-oxyethyl phosphoyl cholins,
poly(acrylic acids),
poly(acrylates), poly (acry lami des), poly (alkyloxy )
polymers, po ly (am i des),
poly(arnidoarnines), poly(amino acids), poly(anhydrides), poly(aspartamides),
poly(butyric
acids), poly(glycolic acids), polybutylene terephthalates,
poly(caprolactones),
poly (carbonates), poly (cy anoacry late s), poly
(di methy lacrylamides), poly (esters),
poly(ethylenes), poly(ethyleneglycols), poly(ethylene oxides), poly(ethyl
phosphates),
poly(ethyloxazolines), poly(glycolic acids), poly (hydroxyethyl acrylates),
poly(hydroxyethyl-
oxazolines), poly (hy droxymethacrylates),
poly(hydroxypropylmethacrylamides),
poly(hydroxypropyl methacrylates), poly (hydroxypropyloxazolines),
poly(iminocarbonates),
poly(lactic acids), poly(lactic-co-glycolic acids), poly(methacrylamides),
poly(methacrylates),
poly(methyloxazolines), poly(organophosphazenes), poly(ortho esters),
poly(oxazolines),
poly(propylene glycols), poly(siloxanes), poly(urethanes), poly(vinyl
alcohols), poly(vinyl
amines), poly(vinylmethylethers), poly(vinylpyrrolidones), silicones,
celluloses, carbomethyl
celluloses, hydroxypropyl methylcelluloses, chitins, chitosans, dextrans,
dextrins, gelatins,
hyaluronic acids and derivatives, functionalized hyaluronic acids, mannans,
pectins,
rhamnogalacttu-onans, starches, hydroxyalkyl starches, hydroxyethyl starches
and other
carbohydrate-based polymers, xylans, and copolymers thereof.
Preferably, -Pa', -Pa- and -Pa" of formula (a) independently have a molecular
weight ranging
from and including 5 kDa to 50 kDa, more preferably have a molecular weight
ranging from
96
NfAecue/Date Received 2023-02-08
and including 5 kDa to 40 kDa, even more preferably ranging from and including
7.5 kDa to
35 kDa, even more preferably ranging from and 7.5 to 30 kDa, even more
preferably ranging
from and including 10 to 30 kDa.
In one embodiment -Pa', -Pa" and -Pa¨ of formula (a) have a molecular weight
of about 5 kDa.
In another embodiment -Pa', -Pa" and -Pa" of formula (a) have a molecular
weight of about 7.5
kDa.
In another embodiment -Pa', -Pa" and -Pa" of formula (a) have a molecular
weight of about 10
kDa.
In another embodiment -Pa', -Pa" and -.Pa" of formula (a) have a molecular
weight of about 12.5
kDa.
In another embodiment -Pa', -Pa" and -pa" of formula (a) have a molecular
weight of about 15
kDa.
In another embodiment -Pa', -Pa" and -Pa" of formula (a) have a molecular
weight of about 20
kDa.
More preferably, -Pa', -Pa" and -Pa" of folinula (a) independently comprise a
PEG-based
moiety. Even more preferably, -Pa', -Pa" and -Pa¨ of formula (a) independently
comprise a
PEG-based moiety comprising at least 20% PEG, even more preferably at least
30%, even more
preferably at least 40% PEG, even more preferably at least 50% PEG, even more
preferably at
least 60% PEG, even more preferably at least 70% PEG, even more preferably at
least 80%
PEG and most preferably at least 90% PEG.
In an equally preferred embodiment -Pa', -Pa" and -Pa" of formula (a)
independently comprise
a protein moiety, more preferably a random coil protein moiety and most
preferably a random
coil protein moiety selected from the group consisting of PA, PAS, PAG, PG and
XTEN
moieties.
In one embodiment -Pa', -Pa" and -Pa" of formula (a) area PA moiety.
97
NfAecue/Date Received 2023-02-08
In another embodiment -Pa', -Pa" and -Pa- of formula (a) are a PAS moiety.
In another embodiment -Pa', -Pa" and -Pa- of formula (a) are a PAG moiety.
In another embodiment -Pa', -Pa" and -Pa- of formula (a) are a PG moiety.
In another embodiment -Pa', -Pa" and -pa" of formula (a) are an XTEN moiety.
In one embodiment -Z comprises one moiety of formula (a).
In another embodiment -Z comprises two moieties of formula (a).
In another embodiment -Z comprises three moieties of formula (a).
In another embodiment -Z comprises four moieties of formula (a).
In another embodiment -Z comprises five moieties of foimula (a).
In another embodiment -Z comprises six moieties of formula (a).
In a preferred embodiment -Z comprises two moieties of foiinula (a).
In a preferred embodiment -Z comprises a moiety of formula (b)
CH 2-[0-C H2¨CH2-0¨CH3
0 CH-O-CH2-CH2]-0-CH3
- b4
[CH2]¨C¨NH¨CH2 1-0¨CH2
bl b2 (b),
wherein
the dashed line indicates attachment to -L2- or to the remainder of -Z;
bl is selected from the group consisting of 0, 1, 2, 3, 4, 5, 6, 7 and 8;
b2 is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7 and 8;
98
NfAecue/Date Received 2023-02-08
b3 is an integer ranging from and including 150 to 1000; preferably ranging
from and
including 150 to 500; and most preferably ranging from and including 200 to
460; and
b4 is an integer ranging from and including 150 to 1000; preferably ranging
from and
including 150 to 500; and most preferably ranging from and including 200 to
460.
Optionally, the moiety of formula (b) is substituted with one or more
substituents.
Preferably, b3 and b4 of formula (b) are the same integer.
In one preferred embodiment b3 and b4 both an integer ranging from 200 to 250
and most
preferably b3 and b4 of foimula (b) are about 225.
In another preferred embodiment b3 and b4 are both an integer ranging from 400
to 500 and
most preferably b3 and b4 of formula (b) are about 450.
Preferably, bl of foimula (b) is selected from the group consisting of 0, 1,
2, 3 and 4. More
preferably bl of formula (b) is selected from the group consisting of 1, 2 and
3. Most preferably
bl of formula (b) is 2.
Preferably, b2 of formula (b) is selected from the group consisting of 1, 2,
3, 4 and 5. More
preferably b2 of formula (b) is selected from the group consisting of 2, 3 and
4. Most preferably
b2 of foimula (b) is 3.
In one particularly preferred embodiment bl of foimula (b) is 2, b2 of formula
(b) is 3, and b3
and b4 are both about 450.
In another particularly preferred embodiment bl of formula (b) is 2, b2 of
foimula (b) is 3, and
b3 and b4 are both about 225.
In one embodiment -Z comprises one moiety of formula (b).
In another embodiment -Z comprises two moieties of foimula (b).
In another embodiment -Z comprises three moieties of formula (b).
99
NfAecue/Date Received 2023-02-08
In another embodiment -Z comprises four moieties of formula (b).
In another embodiment -Z comprises five moieties of formula (b).
In another embodiment -Z comprises six moieties of formula (b).
In a preferred embodiment -Z comprises two moieties of folinula (b).
In an even more preferred embodiment -Z comprises a moiety of formula (c)
CH20¨CH2¨CH 2-0¨C H3
_-cl
0 CH-EO¨CH2¨CH2-0¨CH3
-c2
--CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
(0,
wherein
the dashed line indicates attachment to -L2- or to the remainder of -Z;
cl and c2 are independently an integer ranging from and including 150 to 500;
preferably ranging from and including 200 to 460.
Optionally, the moiety of founula (c) is substituted with one or more
substituents.
Preferably both cl and c2 of formula (c) are the same integer.
In one preferred embodiment c 1 and c2 of formula (c) range from and include
200 to 250 and
most preferably are about 225. In another preferred embodiment cl and c2 of
formula (c) range
from and include 400 to 500 and most preferably are about 450.
In a preferred embodiment the moiety -Z is a branched PEG-based polymer
comprising at least
10% PEG, has one branching point and two PEG-based polymer arms and has a
molecular
weight of about 40 kDa. Accordingly, each of the two PEG-based polymer arms
has a molecular
weight of about 20 kDa. Preferably the branching point is -CH<.
100
NfAecue/Date Received 2023-02-08
In one embodiment -Z comprises one moiety of formula (c).
In another embodiment -Z comprises two moieties of formula (c).
In another embodiment -Z comprises three moieties of fonnula (c).
In another embodiment -Z comprises four moieties of foiniula (c).
In another embodiment -Z comprises five moieties of formula (c).
In another embodiment -Z comprises six moieties of formula (c).
In a preferred embodiment -Z comprises two moieties of formula (c).
In one preferred embodiment the moiety -Z is of formula (d)
,b r7a
(c),
wherein
the dashed line indicates attachment to -L2-;
-Zb- is selected from the group consisting of C1-50 alkyl, C2-50 alkenyl, and
C2-50 alkynyl;
wherein Ci-so alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally
substituted with one
or more -R1, which are the same or different and wherein C1_50 alkyl, C2_50
alkenyl, and
C2-50 alkynyl are optionally interrupted by one or more groups selected from
the group
consisting of -T-, -C(0)0-, -0-, -C(0)-, -C(0)N(R2)-, -S(0)2N(R2)-,
-S(0)N(R2)-, -S(0)2-, -S(0)-, -N(R2)S(0)2N(R2a)-, -S-, -N(R2)-, -
0C(0R2)(R2a)_,
-N(R2)C (0)N(R2a)-, and -0C(0)N(R2)-;
each ¨T- is independently selected from the group consisting of phenyl,
naphthyl,
indenyl, indanyl, tetralinyl, C340 cycloalkyl, 3- to 10-membered heterocyclyl,
8- to
11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-
membered heteropolycyclyl; wherein each -T- is independently optionally
substituted with one or more -RI, which are the same or different;
each -R1 is independently selected from the group consisting of halogen, -CN,
oxo
(=0), -COOR3, -0R3, -C(0)R3, -
C(0)N(R3R3 a), -S(0)2N(R3R3a),
-S(0)N(R3R3a), -S(0)2R3, -S(0)R3, -N(R3)S(0)2N(R3aR3b), - SR3, -N(R3R3a),
-NO2, -0C(0)R3, -MR3)C(0)R3 a, -
1\T(R3)S (0)2R3 a, -NR3)S(0)R3a,
101
NfAecue/Date Received 2023-02-08
-N(R3)C(0)0R3a, -N(R3)C(0)N(R3aR3b), -0C(0)N(R3R3a), and C1-6 alkyl; wherein
C1-6 alkyl is optionally substituted with one or more halogen, which are the
same or
different;
each -R2, -R
2a, _R3, _R3a and K313
is independently selected from the group
consisting of -H, and C1_6 alkyl, wherein C1_6 alkyl is optionally substituted
with
one or more halogen, which are the same or different;
and
-Za is
S¨ P'
__S_Bp4S_pai
a
Sa¨Pa
wherein
BPa, -Sa-, -Sa'-, -Sa"-, -Pa', -pa", -pa" and a are used as defined for
formula (a).
Optionally, the moiety of formula (d) is substituted with one or more
substituents.
Preferably, -Za of foimula (d) is of formula (b). Preferred embodiments of b
I, b2, b3 and b4 are
as described for formula (b).
Even more preferably, -Za of foimula (d) is of formula (c). Preferred
embodiments for c I and
c2 are as described for formula (c).
Preferred embodiments of BP, -Sa-, -Sa-, -Sa"-, -Sa'"-, -Pa', -Pa'', -pa" of
formula (d) are as
defined above for formula (a).
In an even more preferred embodiment the moiety -Z of formula (Ia) or (Ib) is
of formula (e)
0
4N¨Za
- e
0
(e),
wherein
the dashed line indicates attachment to -L2-;
102
NfAecue/Date Received 2023-02-08
e is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,
12, 13, 14 and
15; and
-Za is
CH2¨[0--CH2--CH2-0--CH3
b3
_
0 CH¨O¨CH2¨CH2-0¨CH3
[CH+C¨NH¨CH+O¨CH2 b4
bl b2
wherein
bl, b2, b3 and b4 are used as defined for formula (b).
Optionally, the moiety of formula (e) is substituted with one or more
substituents.
Preferred embodiments for bl, b2, b3 and b4 of formula (e) are as defined
above for formula
(b).
In one embodiment e of formula (e) is 1. In another embodiment e of formula
(e) is 2. In another
embodiment e of foimula (e) is 3. In another embodiment e of formula (e) is 4.
In another
embodiment e of foimula (e) is 5. In another embodiment e of formula (e) is 6.
In another
embodiment e of formula (e) is 7. In another embodiment e of formula (e) is 8.
In another
embodiment e of formula (e) is 9. In another embodiment e of formula (e) is
10. In another
embodiment e of formula (e) is 11. In another embodiment e of formula (e) is
12. In another
embodiment e of formula (e) is 13. In another embodiment e of formula (e) is
14. In another
embodiment e of formula (e) is 15.
Preferably e of formula (e) is selected from the group consisting of 2, 3,4,
5, 6, 7, 8 and 9. Even
more preferably, e of formula (e) is selected from 3, 4, 5 and 6. Most
preferably e of formula
(e) is 5.
Preferably e of formula (e) is 5, bl of formula (e) is 2, b2 of foimula (e) is
3 and b3 and b4 of
formula (e) are both about 450.
In an equally preferred embodiment the moiety -Z of formula (Ia) or (Ib) is of
formula (e-i) or
(e-i'):
103
NfAecue/Date Received 2023-02-08
- - e Tr
0
(e-i)
0
)=L a
N'Z
e H
(e-i`),
wherein
the dashed line indicates attachment to -L2-,
e is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,
12, 13, 14 and
15;
-Za is
CH2¨[0-CH2¨CH2-0¨C1-13
- b3
0 CH¨O¨C H2¨C H2-0¨C H3
I -
4fCH+C¨NH¨CH2 1-0¨CH2 b4
bl b2
wherein
bl, b2, b3 and b4 are used as defined for formula (b).
Preferred embodiments for bl, b2, b3 and b4 of folinula (e-i) and (e-i') are
as defined above
for formula (b).
Preferred embodiments fore of formula (e-i) and (e-i') are as described for
folinula (e).
Preferably, bl of formula (e-i) and (e-i') is 2, b2 of formula (e-i) and (e-
i') is 3 and b3 and b4
of formula (e-i) and (e-i') are both about 450.
In a preferred embodiment -Z of formula (Ia) or (Ib) is of formula (e-i).
In another preferred embodiment the moiety -Z is a branched PEG-based polymer
comprising
at least 10% PEG, has three branching points and four PEG-based polymer arms
and has a
molecular weight of about 40 kDa. Accordingly, each of the four PEG-based
polymer arms has
a molecular weight of about 10 kDa. Preferably each of the three branching
points is -CH<.
104
NfAecue/Date Received 2023-02-08
In a preferred embodiment the moiety -Z is of formula (f)
a'
S-f Z
I flf r aL if
S-Za
wherein
the dashed line indicates attachment to -L2-;
BP e is a branching point selected from the group consisting of -N<, -CR< and
>C<;
-R is selected from the group consisting of -H and C1_6 alkyl;
f is 0 if BP e is -N< or -CR< and f is 1 if BP e is >C<;
-Se-, -Sr-, -Sr- and -Sr-- are independently either a chemical bond or are
independently
selected from the group consisting of C1-50 alkyl, C2-50 alkenyl, and C2-50
alkynyl;
wherein C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally
substituted with one
or more -R1, which are the same or different and wherein C1-50 alkyl, C2-50
alkenyl, and
C2-50 alkynyl are optionally interrupted by one or more groups selected from
the group
consisting of -T-, -C(0)0-, -0-, -C(0)-, -C(0)N(R2)-, -S(0)2N(R2)-,
-S(0)N(R2)-, -S(0)2-, -S(0)-, -N(R2)S(0)2N(R2a)-, -S-,
-N(R2)-,
-0C(OR2)(R2a)_, _NR2)c(0)N(s
) and -0C(0)N(R2)-;
each -T- is independently selected from the group consisting of phenyl,
naphthyl,
indenyl, indanyl, tetralinyl, C3-10 cycloa1kyl, 3- to 10-membered
heterocyclyl, 8- to
11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-
membered heteropolycyclyl; wherein each -T- is independently optionally
substituted with one or more -RI, which are the same or different;
each R1 is independently selected from the group consisting of halogen, -CN,
oxo
(=0), -000R3, -0R3, -C(0)R3, -C(0)N(R3R3a), -S(0)2N(R3R3a), -S(0)N(R3R3a),
-S(0)2R3, -S(0)R3, -N(R3)S(0)2N(R3aR3b), -SR3, -N(R3R3a), -NO2, -0C(0)R3,
-N(R3)C(0)R3a, -N(R3)S(0)2R3a, -N(R3)S(0)R3a, -N(R3)C(0)0R3a,
-N(R3)C(0)N(R3aR3b), -0C(0)N(R3R3a), and C1-6 alkyl; wherein C1_6 alkyl is
optionally substituted with one or more halogen, which are the same or
different;
each -R2, -R
2a, _R3, _R3a and
_1( is independently selected from the group
consisting of -H, and C1_6 alkyl, wherein C1_6 alkyl is optionally substituted
with
one or more halogen, which are the same or different;
105
IllfAecue/Date Received 2023-02-08
and
-Za', -Za" and -Za¨ are independently
Sal Pa'
Sa¨ BPaL
ai S
a
Sa¨Pa
wherein
BPa, -Sa-, -Si"-, -Sa"-, -Sa'"-, -Pa', -Pa", -Pa'" and a are used as defined
for formula
(a).
Optionally, the moiety of formula (f) is substituted with one or more
substituents.
Preferred embodiments of BP', -Sa-, -Sa'-, -
Pa', -Pa" and -Pa" of formula (f) are as
.. defined above for formula (a).
Preferably BP f of foimula (f) is -CR< and r is 0. Preferably -R is -H.
Preferably -Se- of formula (f) is a chemical bond.
Preferably, -Za', -Za- and -Za¨ of formula (f) have the same structure.
Preferably, -Za',
and -Za¨ of foimula (f) are of formula (b).
Preferred embodiments of bl, b2, b3 and b4 are as described for formula (b).
Preferably -Se- of fotmula (f) is a chemical bond, BP of formula (f) is -CR<
with -R being -H.
Even more preferably -Se- of formula (f) is a chemical bond, BP' of formula
(f) is -CR< with -R
being -H and -Za', -Za- and -Za¨ of formula (f) are of formula (b).
Even more preferably -Z is of formula (g)
106
NfAecue/Date Received 2023-02-08
0
0
S- S
, 0
______________ , 0 s-cri
Sg-N H 'Za
Sg" 0
0
(g),
wherein
the dashed line indicates attachment to -L2-;
-Se-, -Se'- and -Se-- are independently selected from the group consisting of
C1-50 alkyl,
C2-50 alkenyl, and C2-so alkynyl; wherein C1-50 alkyl, C2-50 alkenyl, and C2-
50 alkynyl are
optionally substituted with one or more -RI, which are the same or different
and wherein
C1-50 alkyl, C2_50 alkenyl, and C2_50 alkynyl are optionally interrupted by
one or more
groups selected from the group consisting of -T-, -C(0)0-,
-0-, -C(0)-, -C(0)N(R2)-, -S(0)2N(R2)-, -S(0)N(R2)-, -S(0)2-, -S(0)-,
-N(R2)S(0)2N(R2a)-, -S-, -N(R2)-, -0C(0R2)(R21-, -N(R2)C(0)N(R2a)-,
and -0C(0)N(R2)-;
each -T- is independently selected from the group consisting of phenyl,
naphthyl,
indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered
heterocyclyl, 8- to
11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-
membered heteropolycyclyl; wherein each -T- is independently optionally
substituted with one or more -IV, which are the same or different;
each R1 is independently selected from the group consisting of halogen, -CN,
oxo
(=0), -COOR3, -0R3, -C(0)R3, -C(0)N(R3R3a), -S(0)2N(R3R3a),
-S(0)N(R3R3a), -S(0)2R3, -S(0)R3, -MR3)S(0)2N(R3aR3b), -SR3, -N(R3R3a),
-NO2, -0C(0)R3, -NR3)C(0)R3a, -MR3)S(0)2R3a, -MR3)S(0)R3a,
-MR3)C(0)0R3a, -N(R3)C(0)N(R3aR3b), -0C(0)N(R3R31, and C1-6 alkyl; wherein
C1-6 alkyl is optionally substituted with one or more halogen, which are the
same or
different;
each -R2, -R2a, -R3a and
X is independently selected from the group
consisting of -H, and Ci_6 alkyl, wherein C1-6 alkyl is optionally substituted
with
one or more halogen, which are the same or different;
and
107
NfAecue/Date Received 2023-02-08
-Za and -Za' are independently
SL Pa'
Sa¨ BP¨ Sa¨ Pa
a
Sa¨Pa
wherein
BPa, -Sa-, -Sa'-, -Sa"-, -
Pa', -Pa", -Pa¨ and a are used as defined for foimula
(a).
Optionally, the moiety of formula (g) is substituted with one or more
substituents.
Preferred embodiments of BPS, -Sa-, -Sa"-, -Pa%
-Pa" and -Pa" of formula (g) are as
defined above for formula (a).
Preferably, -Se- of formula (g) is selected from the group consisting of C1_6
alkyl, C2-6 alkenyl
and C2-6 alkynyl, which are optionally substituted with one or more -R1, which
is the same or
different,
wherein
-R1 is selected from the group consisting of halogen, oxo
(-0), -COOR3, -0R3, -C(0)R3, -C(0)N(R3R3a), -S(0)2N(R3R3a), -S(0)N(R3R3a),
-S(0)2R3, -S(0)R3, -N(R3)S(0)2N(R3aR3b), -SR3, -N(R3R3 a), -NO2, -0C(0)R3,
-N(R3)C(0)R3 -N(R3)S(0)2R3 a, -N(R3)S(0)lea, -
N(R3)C(0)0R3a,
-N(R3)C(0)N(R3aR3b), -0C(0)N(R3R3a), and C1-6 alkyl; wherein Ci_6 alkyl is
optionally
substituted with one or more halogen, which are the same or different; and
-R3, -R3a and -R31' are independently selected from -H, methyl, ethyl, propyl
and butyl.
Even more preferably -Se- of formula (g) is selected from C1_6 alkyl.
Preferably, -Se'- of formula (g) is selected from the group consisting of C1-6
alkyl, C2-6 alkenyl
and C2-6 alkynyl, which are optionally substituted with one or more -R1, which
is the same or
different,
wherein
108
NfAecue/Date Received 2023-02-08
-le is selected from the group consisting of halogen, oxo
(-0), -COOR3, -0R3, -C(0)R3, -C(0)N(R3R3a), -S(0)2N(R3R3a), -S(0)N(R3R3a),
-S(0)2R3, -S(0)R3, -N(R3)S(0)2N(R3aR3b), -SR3 , -N(R3R3 a), -NO2, -0C(0)R3,
-N(R3)C(0)R3a, -N(R3)S(0)2R3a, -N(R3)S(0)R3a, -
N(R3)C(0)0R3a,
-N(R3)C(0)N(R3qt3b), -0C(0)N(R3R3a), and C1_6 alkyl; wherein C1_6 alkyl is
optionally
substituted with one or more halogen, which are the same or different; and
-R3, -R3a and -R3b are independently selected from -H, methyl, ethyl, propyl
and butyl.
Even more preferably -Sc'- of formula (g) is selected from C1-6 alkyl.
Preferably, -Se-- of formula (g) is selected from the group consisting of C1_6
alkyl, C2-6 alkenyl
and C2-6 alkynyl, which are optionally substituted with one or more -R1, which
is the same or
different,
wherein
-R1 is selected from the group consisting of halogen, oxo
(=0), -COOR3, -0R3, -C(0)R3, -C(0)N(R3R3a), -S(0)2N(R3R3a), -S(0)N(R3R3a),
-S(0)2R3, -S(0)R3, -N(R3)S(0)2N(R3ae), -SR3 , -N(R3R3a), -NO2, -0C( 0)R3,
-N(R3)C(0)R3 -1\1(R3)S( 0)2R3 a, -
MR3)S(0)R3a, -N(R3)C(0)0R3a,
-MR3)C(0)N(R3aR3b), -0C(0)N(R3R3a), and Ci_6 alkyl; wherein C1-6 alkyl is
optionally
substituted with one or more halogen, which are the same or different; and
-R3, -R3a and -R3b are independently selected from -H, methyl, ethyl, propyl
and butyl.
Even more preferably -Sg-- of formula (g) is selected from C1-6 alkyl.
Preferably, -Za and -Za' of formula (g) have the same structure. Preferably, -
Za and -Za' of
formula (g) are of formula (b).
In an alternative even more preferred embodiment -Z of formula (Ia) or (Ib) is
of fonaula (g-i)
109
NfAecue/Date Received 2023-02-08
Za
g al
S-Y
N-(
(0 al' a'
g' Y-Z
' S' .INTH /
0
(g-i),
wherein
the dashed line indicates attachment to -L2-;
-58'- and -S8"- are independently selected from the group consisting of Ci-so
alkyl,
C2-50 alkenyl, and C2-50 alkynyl; wherein Ci-so alkyl, C2-so alkenyl, and C2-
50 alkynyl are
optionally substituted with one or more -1V, which are the same or different
and wherein
C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally interrupted by
one or more
groups selected from the group consisting of -T-, -C(0)0-, -0-, -C(0)-,
-C(0)N(R2)-, -S(0)2N(R2)-, -S(0)N(R2)-, -S(0)2-, -S(0)-, -N(R2)S(0)2N(R2a)-, -
S-,
-N(R2)-, -0C(OR2)(R2a)_, _N(R2)c (0)N(R
) and -0C(0)N(R2)-;
each -T- is independently selected from the group consisting of phenyl,
naphthyl,
indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered
heterocyclyl, 8- to
11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-
membered heteropolycyclyl; wherein each -T- is independently optionally
substituted with one or more -R1, which are the same or different;
each R1 is independently selected from the group consisting of halogen, -CN,
oxo
(=0), -000R3, -0R3, -C(0)R3, -C(0)N(R3R3a), -S(0)2N(R3R3a), -S(0)N(R3R3a),
-S(0)2R3, -S(0)R3, -N(R3)S(0)2N(R3aR3b), -
N(R3R3a), -NO2, -0C(0)R3,
-N(R3)C(0)R3a, -N(R3)S(0)2R3a, -MR3)S(0)R3a, -
NR3)C(0)0R3a,
-N(R3)C(0)MR3aR3b), -0C(0)N(R3R3a), and C1-6 alkyl; wherein C1_6 alkyl is
optionally substituted with one or more halogen, which are the same or
different;
each -R2, -R2a, -R3, -R3a and -R31 is independently selected from the group
consisting of -H, and C1-6 alkyl, wherein C1-6 alkyl is optionally substituted
with
one or more halogen, which are the same or different;
-Yal- and -Yar- are
0
' H =
and
110
NfAecue/Date Received 2023-02-08
-Za and -Za' are independently
SaL Pa'
- õ
a
SL Pa
wherein
BPa, -Sa-, -Sa'-, -Sa"-, -
Pa', -Pa", -Pa¨ and a are used as defined for fomiula
(a).
Optionally, the moiety of formula (g-i) is substituted with one or more
substituents.
0
H¨N11
Preferably, -Yal_ and _ yar_ of formula (g-i) are both ,
wherein the dashed line
marked with the asterisk is attached to -Za or -Za', respectively.
Preferred embodiments of BP, -Sa-, -Sa'-, -Sa"-, -Sa'"-, -Pa', -Pa" and -Pa."
of formula (g-i) are
as defined above for formula (a).
Preferred embodiments of -S5-, -Se'- and -Sg"- of formula (g-i) are as defined
for formula (g).
Preferably, -Za and -Za' of formula (g-i) have the same structure. Preferably,
-Za and -Za' of
formula (g-i) are of formula (b). Preferred embodiments for bl, b2, b3 and b4
are as described
for formula (b).
Even more preferably -Z is of fomiula (h)
111
NfAecue/Date Received 2023-02-08
....z-ze
, _______________________ rs 0 .
______________________________________________ ,.....z-zc
i ,F.14
, ______________ 0 \ ,
\I\14
H0
(h),
wherein
the dashed line indicates attachment to -L2-; and
each -Ze is a moiety
CH210¨CH2¨CH2-0¨C H3
0 CH-0¨CH2¨CH2]-0¨CH3
I ii 1 - ci
--CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
!
,
wherein
each cl is an integer independently ranging from about 200 to 250.
Optionally, the moiety of formula (h) is substituted with one or more
substituents.
Preferably both cl of formula (h) are the same.
Preferably both cl of formula (h) are about 225.
Even more preferably -Z of formula (Ia) or (Ib) is of formula (h-a)
a 1 Zc
0
.õõ.....,,,N,....,yai'...Ze
H - k
0
(h-a),
wherein
112
NfAecue/Date Received 2023-02-08
the dashed line indicates attachment to -12-;
each k is independently of each other selected from the group consisting of 1,
2, 3, 4, 5,
6, 7, 8, 9, 10, 11 and 12;
_ yai_ and _yar_ are
0
; II
' H
and
each -Zc is a moiety
CH210¨CH2¨CH2-0¨CH3
- -cl
o
CH¨O¨CH,¨CH2]-0¨CH3
¨Cf12¨CH2-C¨N H¨C H2¨CH2¨CH2-0¨CH2
wherein
each cl is an integer independently ranging from about 200 to 250.
Optionally, the moiety of formula (h-a) is substituted with one or more
substituents.
Preferably, each k of formula (h-a) is independently selected from the group
consisting of 2, 3,
4, 5, 6 and 7. Preferably, both k of formula (h-a) are identical.
Preferably both cl of formula (h-a) are the same.
Preferably both cl of formula (h-a) are about 225.
0
N ________________________________________________ II *
Preferably, -ya 1_ and y - ¨1µ_
of formula (h-a) are both ,
wherein the dashed line
marked with the asterisk is attached to -Ze.
In an even more preferred embodiment the moiety -Z is of formula (h-i)
113
NfAecue/Date Received 2023-02-08
0
, rs 0 0
/_.,4-zc
, ______________ 0 , __ rs 0
\ /
\I\T¨(
H0
(h-i),
wherein
the dashed line indicates attachment to -L2-; and
each -Ze is a moiety
CH210¨CH2¨CH2-0¨C H3
0 CH-0¨CH2¨CH2]-0¨CH3
I ii 1 - ci
!¨CI-12¨CH2-C¨NH¨C1-12¨CH2¨CH2-0¨CH2
,
each cl is an integer independently ranging from 200 to 250.
Optionally, the moiety of foimula (h-i) is substituted with one or more
substituents.
Preferably both cl of formula (h-i) are the same.
Preferably both cl of formula (h-i) are about 225.
In an alternative even more preferred embodiment the moiety -Z of formula (Ia)
or (Ib) is of
formula (h-ia)
a 1,-Zc
Nr-1(
0
0
(h-ia),
wherein
114
NfAecue/Date Received 2023-02-08
the dashed line indicates attachment to -I2-;
each k is independently of each other selected from the group consisting of 1,
2, 3, 4, 5,
6, 7, 8, 9, 10, 11 and 12;
_ yai_ and _ yap_ are
0
; II
' H
and
each -Zc is a moiety
CH210¨CH2¨CH2-0¨CH3
- -C1
o
C H¨O¨CH,¨CH2]-0¨CH3
¨CH2¨CH2-C¨NH¨C H2¨CH 2¨C H2-0¨C H2
each cl is an integer independently ranging from 200 to 250.
Preferably, each k of formula (h-ia) is independently selected from the group
consisting of 2,
3, 4, 5, 6 and 7. Preferably, both k of formula (h-ia) are identical.
Preferably both cl of formula (h-ia) are the same.
Preferably both cl of formula (h-ia) are about 225.
0
N ________________________________________________ II *
Preferably, -Yal_ and
Y of fonnula (h-ia) are both H
, wherein the dashed line
marked with the asterisk is attached to -Ze.
In an equally preferred the embodiment -Z of formula (Ia) or (Ib) comprises a
moiety selected
from the group consisting of
115
NfAecue/Date Received 2023-02-08
xf3
,e 1 I dl
-A- 0 N¨Z
Xdl
, Xf4
Xfi N CH2]-1\1/
\ Xf2 s1 \zd2
N
,
: c 0 d3 xf8
1 Z
t7 / X ¨N N¨Z
[CH21 I d4
Ns2 f5 t6 / ,
X \ CH213
N N
> / c_x 0
0 e2
Xd2
(j4),
fl
X \
N dl
N¨Z
[CH2]72_xdi
Xe i
f2
X \
\ d2
CH2iTIN/ NZ
CH2]7c
Xd2
1
i N e2
x
1
1
,[CH21s4 Xt3
/ e3 ¨N
X __________________ \d3
C Z
[CH2]55
f
(4 ----d4 /'\J4z
X 0-ii),
116
NfAecue/Date Received 2023-02-08
xe2
xf3
dl i 0 --Xd2
Z ¨N 0
,
Xdi _____--121¨N N¨Zd2
N A
s2 Ns,f4 I õ
1
Xexd X"
0
_.N
i CHasi µxf1
i 0
i N¨XF7 0
I 1
.l(' Xd3
fo N ___
e4 X
i ( 3
X f9
xd4 X . r 1
\ C H2 Xf8¨N 1 Xe
.r._..N ] s3 \Zd
fl 0 \\
X ¨N 0
\Zd4
(Off),
0 Xf2
1
0
)-1\1 Zd 1
0 Yd4C Hds3 k H2]¨?.¨
/ s4 d2
¨[CH 2] s2 N¨Z
xf3,
i CH217Nµxii
0
N¨Xf4 r
I_CH2]4
0 / s6 r 1
2-L yd2 )VICH2L7 zd3
CH
-Is5 X15 1\1
0 µXf6
Zd4
xf2
dl i d2
Z ¨N Z
) µ
0 /Yd4CH2] 0
s3
¨[
[CH21¨N ACH2] s2
s 1 VI X µ
\ f3 N¨Z
N¨X rcii,i__
0 Li z s 5 d4
Z
CH2]¨yd2
s4 0
(j-v),
117
NfAecue/Date Received 2023-02-08
Xt4
I dl
f1 f2 N-Z
X0 ox 13 )COI Xf5
II II I
CH-2-14--1--CH2--Yd-1-CH2---1V-- I I CH2] N-C-C-ECH2 - --Z
_ si _ -s2 - - s3 - s4 H -s5
1
1
i
i
0 0 0
II d2 ii Hi - d3
" iCH - N-C-ECH21-Y-CHd-C-N 2 -N-C-C CH2-
N-Z
I f6 I t c.t.10
X s6 - s7 x -s8
I d4 -s9
N-Z
kf9
Cl-
vi)
f2 f3
X 0 - 0 X Xf4
- I al
0 CH2-N-C-[CII2 ____________________________ Ycl-[CH2-C-N-k2H2-N-Z
-CH21_N II - s2 _ -s3 -s4 - s5
sl jcf1 . N-C-[-CH2-
Yd[CH21-C-N{CH21-N-Zd2
.xt5/ 41 : 1) -s6 s7 II
I) I f s8 I t-7
1 X
1
1 0 0
_
II - II
CH2] N-C-CH21-YdiCH2]-C-N-[CH2--N-Zd3
N-C s9 I f9 - slO sll I - s12 I fit
f8/ II X xf10 X
X 0
d4
N -C-EC H21-, Ydzi{C Hd-C-N4CHd-N-Z
xf12/ I I Jsi3 0411 1,.._ s15 I fl4
0 ox X
(j-vii)
wherein
the dashed line indicates attachment to -L2-;
sl, s2, s3, s4, s5, s6, s7, s8, s9, s10, sl 1, s12, s13, s14 and s15 are
independently of each other
selected from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10;
..-µAcl1, _ Xd2, -Xd3 and -Xd4 are independently of each other selected from
the group consisting
of -OH, -SH and -NR5lRg2; preferably -OH;
_xei, _-,-e2, _
A Xe3 and -Xe4 are independently of each other selected from the
group consisting
of -H, C1-6 alkyl, C2-6 alkenyl and C2-6 alkynyl;
-Rg1 and -Rg2 are independently of each other selected from the group
consisting of -H, C1-6
alkyl, C2-6 alkenyl and C2-6 alkynyl;
-Xf1, -xf2, _xf3, _xf4, _xf5, _xf6, _xf7, _xf8, _xf9, _xf10, _xf11, _xf12, -
xf13 and _xf14 are
independently of each other selected from the group consisting of -H, C1_6
alkyl, C2_6 alkenyl
and C2-6 alkynyl; preferably -H;
118
NfAecue/Date Received 2023-02-08
_yd1 _yd2_,
Y and -Yd4- are independently of each other selected from the
group consisting
of
0
0
= S ' II
0 H
and ;and
L _
E12, -Zd3 and -Zd4 are independently of each other a protein, more preferably
a random
coil protein and most preferably a random coil protein selected from the group
consisting of
PA, PAS, PAG, PG and XTEN.
In one preferred embodiment, -ydl_ and -Yd2- of formula (j-iv), (j-v) and (j-
vi)
and -Yd1-, -Yd2-, -Yd3- and -Yd4- of formula (j-vii) are
0
4N-1=
= S
0
In another preferred embodiment, -Ydl- and -Yd2- of formula (j-iv), (j-v) and
(j-vi)
and _yd1_, _yd2_,
Y and -Yd4- of formula (j-vu) are
0
N1.1¨L*
H
wherein the dashed line marked with the asterisk is oriented towards -Zdl, -
zd2, _zd3 and _zd4,
respectively, and the unmarked dashed line is oriented towards -L2-.
Preferably, -Xf1, -Xf2, -X13, -
Xf5, -Xf6, -Xf7 and -Xf8 of formula (j-i) are -H; -Xdi and -Xd2
of formula (i-i) are -OH; -Xel and -Xe2 of formula (j-i) are selected from the
group consisting
of -H and methyl; and sl, s2, s3 and s4 of formula (j-i) are selected from the
group consisting
of 2, 3,4, 5 and 6. Even more preferably -XII, -Xf2, -Xf3, -X", -Xf5, -Xf6, -
X17 and -Xf8 of follnula
(j-i) are -H; -Xd1 and -Xd2 of formula (j-i) are -OH; -Xel and -Xe2 of formula
(j-i) are -H; and
sl, s2, s3 and s4 of formula (j-i) are 4.
119
NfAecue/Date Received 2023-02-08
Preferably, -Xf1, -X , -Xf3 and -Xf4 of formula (j-ii) are -H; -Xd1, Ad2, _VB
and -Xd2 of formula
(j-ii) are -OH; Xel,-xe2,
xe3 and -X of formula (j-ii) are selected from the group consisting
of -H and methyl; sl, s2, s3, s4 and s5 of formula (j-ii) are selected from
the group consisting
of 1, 2, 3, 4, 5 and 6. Even more preferably -Xf1, -Xf2, -X and -X" of
formula (j-ii)
are -H; -Xd1, -xd2, _xd3 and _xd2 of formula
(j -ii) are -OH; _xe2,
A and -V4 of foimula
(j-ii) are -H; sl is 4 of formula (j-ii) and s2, s3, s4 and s5 of formula (j-
ii) are 1.
Preferably, -Xf1, -X , -X , -Xf4, -Xf6, -
X's, -Xf9 and -Xf1 of foimula (j-iii)
are _H; _xdi; _xd2; Ad3 and _xda of formula (j-iii) are -OH; _xei; _
A Xe3 and -Xe4 of formula
(j-iii) are selected from the group consisting of -H and methyl; and sl, s2
and s3 of formula (j-
iii) are selected from the group consisting of 2, 3, 4, 5 and 6. Even more
preferably -X , -X , -X , -Xf4, -X , -Xf6, -
Xf8, -X and -Xf1 of formula (j-iii)
are -H; -Xd1, A Xcl3 and -Xd4 of formula (j-iii) are -OH; -Xel, -xe2, _x,e3
A and -
Xe4 of foimula
(j-iii) are -H; and s I, s2 and s3 of formula (j-iii) are 4.
Preferably, -X , -X , -X , -Xf4, -Xf5 and -Xf6 of foimula (j-iv) are -H; sl,
s2, s3, s4, s5, s6 and
s7 of formula (j-iv) are selected from the group consisting of 1, 2, 3, 4, 5,
6 and
7; -Ydl- and -Yd2- are selected from the group consisting of
0
0
;1\12H
0 ' H
and In an even more
preferred
embodiment -Xf1, -X , -X , -Xf4, -Xf5 and -X16 of formula (j-iv) are -H; sl of
formula (j-iv) is
3, s2 of founula (j-iv) is 5, s3 of formula (j-iv) is 2, s4 of formula (j-iv)
is 4, s5 of formula (j-
iv) is 5, s6 of formula (j-iv) is 2 and s7 of formula (j-iv) is 4; and -Ydl-
and -Yd2- of formula (j-
iv) are
0
0
. In an equally preferred embodiment -Xf1, -Xf2, -X , -Xf4, -X and -Xf6 of
foimula (j-iv) are -H; sl of formula (j-iv) is 3, s2 of formula (j-iv) is 5,
s3 of formula (j-iv) is 2,
s4 of formula (j-iv) is 4, s5 of formula (j-iv) is 5, s6 of foimula (j-iv) is
2 and s7 of formula (j-
iv) is 4; and -Y(11- and -Yd2- of formula (j-iv) are
120
NfAecue/Date Received 2023-02-08
0
N II I *
,
wherein the dashed line marked with the asterisk is oriented towards -Zdl,
_zd2, _zd3 and _zdhl,
respectively, and the unmarked dashed line is oriented towards -L2-.
Preferably, -Xn, -Xf2, -X and -Xf4 of formula (j-v) are -H; sl, s2, s3, s4
and s5 of formula (j-
v) are selected from the group consisting of 1, 2, 3, 4, 5, 6 and 7; -Ydl_ and
..yd2 of formula (j-
v) are selected from the group consisting of
4N-:=
0
= S ' II '
N-H
0 ' H
and . In an even more preferred embodiment -Xn ,
-X
and -Xf4 of formula (j-v) are -H; sl of formula (j-v) is 3, s2 of formula (j-
v) is 2, s3 of formula
(j-v) is 1, s4 of formula (j-v) is 2 and s5 of formula (j-v) is 1; and _ ydr_
and -Yd2- of formula (j-
4N-11
= S
v) are 0.
In an equally preferred embodiment -Xn, -X , -X and -Xf4 of
formula (j-v) are -H; sl of formula (j-v) is 3, s2 of formula (j-v) is 2, s3
of formula (j-v) is 1, s4
of formula (j-v) is 2 and s5 of formula (j-v) is 1; and -Ydl- and -Yd2- of
formula (j-v) are
0
N II I *
,
wherein the dashed line marked with the asterisk is oriented towards -Zdi,
_zd2, _zd3 and _zdhl,
respectively, and the unmarked dashed line is oriented towards -L2-.
Preferably, -X
fl, _xf2, _x3, _xf4, _xf5, _xf6, _xf7,
A -X
and -Xn of formula (j-vi) are -H;
sl, s2, s3, s4, s5, s6, s7, s8 and s9 of formula (j-vi) are selected from the
group consisting of 1,
2, 3, 4, 5, 6 and 7; -Ydl- and -Yd2- of formula (j-vi) are selected from the
group consisting of
121
NfAecue/Date Received 2023-02-08
N-1= 0
II N2H.
0 ' H
and In an even more
preferred
embodiment -Xfl, _xf2, _xf3, _xf4, _xf3, _xf6, _xf7, _
A Xf9
and -Xn of formula (j-vi) are -H;
s I of formula (j-vi) is 4, s2 of formula (j-vi) is 5, s3 of formula (j-vi) is
2, s4 of formula (j-vi)
is 4, s5 of formula (j-vi) is 4, s6 of formula (j-vi) is 5, s7 of formula (j-
vi) is 2, s8 of formula (j-
_ _ _ _
vi) is 4 and s9 of fommla (j-vi) is 4; and ydi and yd2
of formula (j-v) are
0
0
In an equally
preferred
embodiment -Xfl, _xf2, _xf3, _xf4, _x13, _xf6, _xf7, _ A
Xf9 and -Xfl of fommla (j-vi) are -H;
sl of formula (j-vi) is 4, s2 of formula (j-vi) is 5, s3 of formula (j-vi) is
2, s4 of formula (j-vi)
is 4, s5 of formula (j-vi) is 4, s6 of formula (j-vi) is 5, s7 of formula (j-
vi) is 2, s8 of formula (j-
vi) is 4 and s9 of formula (j-vi) is 4; and -Ydl- and -1'12- of formula (j-v)
are
0
H
wherein the dashed line marked with the asterisk is oriented towards -Zdl,
_zd2, _zd3 and _zd4,
respectively, and the unmarked dashed line is oriented towards -L2-.
Preferably, -Xfl, _xf2, _xf3, _xf4, _xf5, _xf6, _xf7, _xf8, _xf9, _xf10,
_xfi1, ---fi2, _
X Xn3
and -Xf" of
formula (j-vii) are -H; sl, s2, s3, s4, s5, s6, s7, s8, s9, s I 0, sll, s12,
s13, s14 and s15 of formula
(j-vii) are selected from the group consisting of 1, 2, 3, 4, 5, 6 and
7; _ yd1 _yd2 _yd3_ and _yd4_ of formula (j-vii) are selected from the group
consisting of
0
2S 0
II N2H
0 ' H
and In an even more
preferred
embodiment -Xfl, _xf2, _xf3, _xf4, _xf5, _xf6, _xf7, _xf9, _xf10, _xf11,
_xf12, _xf13 and _xf14
of formula (j-vii) are -H; are -H; s I of formula (j-vii) is 4, s2 of foimula
(j-vii) is 4, s3 of founula
(j-vii) is 5, s4 of formula (j-vii) is 2, s5 of formula (j-vii) is 4, s6 of
formula (j-vii) is 5, s7 of
122
NfAecue/Date Received 2023-02-08
formula (j-vii) is 2, s8 of formula (j-vii) is 4, s9 of formula (j-vii) is 4,
slO of formula (j-vii) is
5, sit of formula (j-vii) is 2, s12 of formula (j-vii) is 4, s13 of formula (j-
vii) is 5, s14 of formula
(j-vii) 1s2 and s15 of formula (j-vii) 1s4; and -Ydr_, _ yd2_, _yd3_ and 2
Yrd4_
of formula (j-vii) are
0
4N-11=
0
In an equally
preferred
embodiment-Xf1, _xf2, _xf3, _xf4, _xf5, _xf6, _xf7, _xf8, _xf9, _xf10, _xf11, -
--X _f12, X" and -X"
of formula (j-vii) are -H; are -H; sl of formula (j-vii) is 4, s2 of formula
(j-vii) is 4, s3 of formula
(j-vii) is 5, s4 of formula (j-vii) is 2, s5 of fontrula (j-vii) is 4, s6 of
fonnula (j-vii) is 5, s7 of
formula (j-vii) is 2, s8 of formula (j-vii) is 4, s9 of formula (j-vii) is 4,
slO of formula (j-vii) is
5, sit of formula (j-vii) is 2, s12 of formula (j-vii) is 4, s13 of formula (j-
vii) is 5, s14 of formula
(j-vii) is 2 and s15 of formula (j-vii) is 4; and -Ydr_, _ yd2_, _yd3_ and Y
rc14_
of formula (j-vii) are
, 0
II *
,
wherein the dashed line marked with the asterisk is oriented towards -Zdi,
_zd2, _zd3 and _zdhl,
respectively, and the unmarked dashed line is oriented towards -L2-.
Preferably -Zdl, -Z
d2,
and -Zd4 of formula (j-i), (j-ii), (j-iii), (j-iv), (j-v), (j-vi) and (j-vii)
have the same structure.
In one embodiment -Zd1, -Zd2, -Zd3 and -Z`14 of formula (j-i), (j-ii), (j-
iii), (j-iv), (j-v), (j-vi) and
(j-vii) are a PA moiety.
In another embodiment -Zdl, -Zd2, -Zd3 and -Zd4 of formula (j-i), (j-ii), (j-
iii), (j-iv), (j-v), (j-vi)
and (j-vii) are a PAS moiety.
In another embodiment -Zdl, -Zd2, -Zd3 and -Zd4 of formula (j-i), (j-ii), (j-
iii), (j-iv), (j-v), (j-vi)
and (j-vii) are a PAG moiety.
In another embodiment -Z
d2, -Zd3 and -Zd4 of fontrula (j-i), (j-ii), (j-iii), (j-iv), (j-v), (j-vi)
and (j-vii) are a PG moiety.
123
NfAecue/Date Received 2023-02-08
In another embodiment -Zdl, -Z12, -Zd3 and -Zd4 of formula (j-i), (j-ii), (j-
iii), (j-iv), (j-v), (j-vi)
and (j-vii) are a XTEN moiety.
In a preferred embodiment the CNP agonist prodnig of the present invention is
of formula (He)
0
0 N 0
/11,1 0
0
(He),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to a moiety
CH20¨CH2¨CH2-0¨CH3
- -cl
0 CH-0¨CH2¨CH2]-0¨CH3
I II I - ci
¨CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
wherein
each cl is an integer independently ranging from 400 to 500.
Preferably, cl of formula (He) is about 450.
In an equally preferred embodiment the CNP agonist prodrug of the present
invention is of
formula (IIe-i)
124
NfAecue/Date Received 2023-02-08
0
0
0 N
===="
z H2 N
0
(lie-i),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to a moiety
CH210¨CH2--CH2-0--C H3
- -cl
CH¨O¨CH2¨CH7]-0¨CH3
¨:¨CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
wherein
each cl is an integer independently ranging from 400 to 500.
Preferably, cl of formula (He-i) is about 450.
In another equally preferred embodiment the CNP agonist prodrug of the present
invention is
of formula (he-ii)
125
NfAecue/Date Received 2023-02-08
0
N N
0
0 N
===-=."
S
0
0
(lie-ii),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to a moiety
CH2f0¨CH2¨CH2-0¨CH3
- -cl
o CH-0¨CH2¨CH2]-0¨CH3
II c
¨:¨CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
wherein
each cl is an integer independently ranging from 400 to 500.
Preferably, cl of formula (he-ii) is about 450.
Preferably -D of formula (He), (lie-i) and (11e-ii) is a CNP moiety, i.e. the
prodrug of formula
(lie), (lie-i) and (he-ii) is a CNP prodrug. Even more preferably -D of
formula (He), (lie-i) and
(he-ii) is a CNP moiety having the sequence of SEQ ID NO:24, SEQ ID NO:25 or
SEQ ID
NO:30. Most preferably -D of formula (He), (The-i) and (he-ii) is a CNP moiety
CNP having
the sequence of SEQ ID NO:24. It is also preferred that D of formula ((He),
(IIe-i) and (11e-ii)
is a CNP moiety CNP having the sequence of SEQ ID NO:20. D of formula ((lle),
(lie-i) and
(he-ii) is a CNP moiety CNP having the sequence of SEQ ID NO:21. D of formula
((Ile), (lie-
i) and (IIe-ii) is a CNP moiety CNP having the sequence of SEQ ID NO:22. D of
formula ((He),
126
NfAecue/Date Received 2023-02-08
(lie-i) and (he-ii) is a CNP moiety CNP having the sequence of SEQ ID NO:23. D
of formula
((lie), (lie-i) and (He-ii) is a CNP moiety CNP having the sequence of SEQ ID
NO:30.
In one embodiment -D of formula (He), (lie-i) and (he-ii) is a CNP moiety
which is attached
to -1)- through the nitrogen of the N-terminal amine functional group of CNP.
In a preferred embodiment -D of formula (He), (lie-i) and (he-ii) is a CNP
moiety which is
attached to -0- through a nitrogen provided by the amine functional group of a
lysine side
chain of the CNP moiety.
In one embodiment said lysine side chain is not part of the ring formed by the
disulfide bridge
between the cysteine residues at positions 22 and 38, if the CNP moiety is of
SEQ ID NO:24.
Accordingly, in one embodiment the CNP moiety is connected to -12- in the CNP
prodrug of
formula (lie), (lie-i) and (he-ii) through the amine functional group provided
by the side chain
of the lysine at position 9, if the CNP has the sequence of SEQ ID NO:24.
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of formula
(He), (lie-i) and (he-ii) through the amine functional group provided by the
side chain of the
lysine at position 11, if the CNP has the sequence of SEQ ID NO:24.
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of formula
(He), (IIe-i) and (he-ii) through the amine functional group provided by the
side chain of the
lysine at position 15, if the CNP has the sequence of SEQ ID NO:24.
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of formula
(He), (lie-i) and (he-ii) through the amine functional group provided by the
side chain of the
lysine at position 16, if the CNP has the sequence of SEQ ID NO:24.
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of formula
(lie), (lie-i) and (he-ii) through the amine functional group provided by the
side chain of the
lysine at position 20, if the CNP has the sequence of SEQ ID NO:24.
127
IllfAecue/Date Received 2023-02-08
In a preferred embodiment said lysine side chain is part of the ring formed by
the disulfide
bridge between the cysteine residues at positions 22 and 38, if the CNP moiety
is of SEQ ID
NO:24.
Accordingly, in one embodiment the CNP moiety is connected to -0- in the CNP
prodrug of
foimula (lie), (lie-i) and (Ile-ii) through the amine functional group
provided by the side chain
of the lysine at position 26, if the CNP has the sequence of SEQ ID NO:24.
It is understood that the positions of the cysteines and lysines mentioned
above vary depending
on the lengths of the CNP moiety and that the person skilled in the art will
have no difficulty
identifying the corresponding cysteines and lysines in longer or shorter
versions of the CNP
moiety and also understands that for example some lysines may not be present
in shorter CNP
moieties. It is further understood that as a result of for example site-
directed mutagenesis there
might be more lysine residues in the non-ring forming part and/or ring forming
part of the CNP
moiety.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (lie), wherein
cl is about 450, -D is a CNP moiety having the sequence of SEQ ID NO:24 and is
attached
to through the amine functional group provided by the side chain of the
lysine at position
26.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ile-
i), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:24
and is attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
26.
In another preferred embodiment the CNP prodrug of the present invention is of
folinula (Ile-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:24
and is attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
26.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (He),
wherein cl is about 450, -D is a CNP moiety having the sequence of SEQ ID
NO:20 and is
128
NfAecue/Date Received 2023-02-08
attached to -LI- through the amine functional group provided by the side chain
of the lysine at
position 30.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ile-
i), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:20
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
30.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (lie-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:20
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
30.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (lie), wherein
cl is about 450, -D is a CNP moiety having the sequence of SEQ ID NO:21 and is
attached
to -0- through the amine functional group provided by the side chain of the
lysine at position
29.
In another preferred embodiment the CNP prodrug of the present invention is of
foimula (Ile-
i), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:21
and is attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
29.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (lie-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:21
and is attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
29.
In a preferred embodiment the CNP prodrug of the present invention is of
foimula (lie), wherein
cl is about 450, -D is a CNP moiety having the sequence of SEQ ID NO:22 and is
attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
28.
129
NfAecue/Date Received 2023-02-08
In another preferred embodiment the CNP prodrug of the present invention is of
formula (lie-
1), wherein c I is about 450, the CNP moiety has the sequence of SEQ ID NO:22
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
28.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ile-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:22
and is attached
to
through the amine functional group provided by the side chain of the lysine at
position
28.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (Ile), wherein
cl is about 450, -D is a CNP moiety having the sequence of SEQ ID NO:23 and is
attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
27.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ile-
i), wherein c I is about 450, the CNP moiety has the sequence of SEQ ID NO:23
and is attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
27.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ile-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:23
and is attached
to -0- through the amine functional group provided by the side chain of the
lysine at position
27.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (Ile), wherein
cl is about 450, -D is a CNP moiety having the sequence of SEQ ID NO:30 and is
attached
to -0- through the amine functional group provided by the side chain of the
lysine at position
27.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ile-
i), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:30
and is attached
to 42- through the amine functional group provided by the side chain of the
lysine at position
27.
130
NfAecue/Date Received 2023-02-08
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ile-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:30
and is attached
to -I.,'- through the amine functional group provided by the side chain of the
lysine at position
27.
In another preferred embodiment the CNP agonist prodrug of the present
invention is of formula
MO
0
H
........N.,,......õ......õN)....,,,....õ,õ--,õ,i('
H
0
0 N
--...
*
(h0,
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
0
....14,Z3
0
/¨S 0
/ ...:41Za
, H4N
0 /¨S 0
\ /
\,4
H0
,
wherein
each -Za is
131
NfAecue/Date Received 2023-02-08
CH210-012-CH2-0-CH3
1 -cl
0 CH-E0¨CH2¨CH2]-0¨CH3
1 II I cl
'i¨CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, each c I of foimula MO is about 225.
In another preferred embodiment the CNP agonist prodrug of the present
invention is of formula
(llf-i)
0
' H2 NN ,
µ,
H
0
(IIf-i),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
0
0 0 / zZa
i 1=14
____________________________ 0 1 r S 0
\ /
\N4
H0
,
wherein
each -Za is
132
NfAecue/Date Received 2023-02-08
CH210-012-CH2-0-CH3
1 -cl
0 CH-E0¨CH2¨CH2]-0¨CH3
1 II I cl
'i¨CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, each cl of foimula (IIf-i) is about 225.
In another preferred embodiment the CNP agonist prodrug of the present
invention is of formula
(IIf-ii)
I 0
.......N,õ..............,õõN)-1.......õ.........I>,
H
0
0 N
===== \
(IIf-ii),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
0
0 0 /¨S
/ 14Za
i 1=14
____________________________ 0 1 r S 0
\ /
\N4
H0
,
wherein
each -Za is
133
NfAecue/Date Received 2023-02-08
C H210-012-C 142-0-C H3
-cl
o CH-E0¨CH2¨CH2]-0¨CH3
II I cl
,¨CH2¨CH2-C¨NH¨CH2¨C H2 ¨C H2-0¨C H2
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, each cl of fonnula (IIf-ii) is about 225.
Preferably -D of formula MO, (IIf-i) and (IIf-ii) is a CNP moiety, i.e. the
prodrug of fonnula
(llf), (IIf-i) and (IIf-ii) is a CNP prodrug. Even more preferably -D of
formula (II0, (IIf-i) and
(IIf-ii) is a CNP moiety having the sequence of SEQ ID NO:24, SEQ ID NO:25 or
SEQ ID
NO:30. Most preferably -D of fonnula (IIf), (IIf-i) and (IIf-ii) is a CNP
moiety CNP having the
sequence of SEQ ID NO:24. It is also preferred that -D of formula (LIT), (IIf-
i) and (IIf-ii) is a
CNP moiety CNP having the sequence of SEQ ID NO:20. -D of formula (h0, (IIf-i)
and (If-
ii) is a CNP moiety CNP having the sequence of SEQ ID NO:21. -D of formula
(h0, (IIf-i) and
(IIf-ii) is a CNP moiety CNP having the sequence of SEQ ID NO:22. -D of
formula MO, (If-
i) and (IIf-ii) is a CNP moiety CNP having the sequence of SEQ ID NO:23. -D of
formula (h0,
(IIf-i) and (IIf-ii) is a CNP moiety CNP having the sequence of SEQ ID NO:30.
In one embodiment -D of formula MO, (IIf-i) and (IIf-ii) is a CNP moiety which
is attached
to -12- through the nitrogen of the N-terminal amine functional group of CNP.
In a preferred embodiment -D of formula (III), (IIf-i) and (IIf-ii) is a CNP
moiety which is
attached to -L1- through a nitrogen provided by the amine functional group of
a lysine side
chain of the CNP moiety.
In one embodiment said lysine side chain is not part of the ring formed by the
disulfide bridge
between the cysteine residues at positions 22 and 38, if the CNP moiety is of
SEQ ID NO:24.
Accordingly, in one embodiment the CNP moiety is connected to -L1- in the CNP
prodrug of
fonnula (IIf-i) and (IIf-ii) through the amine functional group
provided by the side chain
of the lysine at position 9, if the CNP has the sequence of SEQ ID NO:24.
134
NfAecue/Date Received 2023-02-08
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of formula
(IIf-i) and (IIf-ii) through the amine functional group provided by the side
chain of the
lysine at position 11, if the CNP has the sequence of SEQ ID NO:24.
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of foimula
(IIf-i) and (IIf-ii) through the amine functional group provided by the side
chain of the
lysine at position 15, if the CNP has the sequence of SEQ ID NO:24.
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of formula
.. (h0, (IIf-i) and (IIf-ii) through the amine functional group provided by
the side chain of the
lysine at position 16, if the CNP has the sequence of SEQ ID NO:24.
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of foimula
(llf), (IIf-i) and (IIf-ii) through the amine functional group provided by the
side chain of the
.. lysine at position 20, if the CNP has the sequence of SEQ ID NO:24.
In a preferred embodiment said lysine side chain is part of the ring formed by
the disulfide
bridge between the cysteine residues at positions 22 and 38, if the CNP moiety
is of SEQ ID
NO:24.
Accordingly, in one embodiment the CNP moiety is connected to -L1- in the CNP
prodrug of
foimula (llf) through the amine functional group provided by the side chain of
the lysine at
position 26, if the CNP has the sequence of SEQ ID NO:24.
It is understood that the positions of the cysteines and lysines mentioned
above vary depending
on the lengths of the CNP moiety and that the person skilled in the art will
have no difficulty
identifying the corresponding cysteines and lysines in longer or shorter
versions of the CNP
moiety and also understands that for example some lysines may not be present
in shorter CNP
moieties. It is further understood that as a result of for example site-
directed mutagenesis there
might be more lysine residues in the non-ring forming part and/or ring forming
part of the CNP
moiety.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (IIf-
i), wherein c I is about 225, the CNP moiety has the sequence of SEQ ID NO:24
and is attached
135
NfAecue/Date Received 2023-02-08
to -12- through the amine functional group provided by the side chain of the
lysine at position
26.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (If-
ii), wherein cl is about 225, the CNP moiety has the sequence of SEQ ID NO:24
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
26.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (HO, wherein
cl is about 225, -D is a CNP moiety having the sequence of SEQ ID NO:24 and is
attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
26.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (llf), wherein
cl is about 225, -D is a CNP moiety having the sequence of SEQ ID NO:20 and is
attached
to -0- through the amine functional group provided by the side chain of the
lysine at position
30.
In another preferred embodiment the CNP prodrug of the present invention is of
foimula (If-
i), wherein cl is about 225, the CNP moiety has the sequence of SEQ ID NO:20
and is attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
30.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (1f-
ii), wherein cl is about 225, the CNP moiety has the sequence of SEQ ID NO:20
and is attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
30.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (h0, wherein
cl is about 225, -D is a CNP moiety having the sequence of SEQ ID NO:21 and is
attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
29.
136
NfAecue/Date Received 2023-02-08
In another preferred embodiment the CNP prodrug of the present invention is of
formula (M-
O, wherein cl is about 225, the CNP moiety has the sequence of SEQ ID NO:21
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
29.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (If-
ii), wherein cl is about 225, the CNP moiety has the sequence of SEQ ID NO:21
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
29.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (III), wherein
cl is about 225, -D is a CNP moiety having the sequence of SEQ ID NO:22 and is
attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
28.
In another preferred embodiment the CNP prodrug of the present invention is of
foimula (IIf-
i), wherein cl is about 225, the CNP moiety has the sequence of SEQ ID NO:22
and is attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
28.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (If-
ii), wherein cl is about 225, the CNP moiety has the sequence of SEQ ID NO:22
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
28.
In a preferred embodiment the CNP prodrug of the present invention is of
formula MO, wherein
cl is about 225, -D is a CNP moiety having the sequence of SEQ ID NO:23 and is
attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
27.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (IIf-
i), wherein cl is about 225, the CNP moiety has the sequence of SEQ ID NO:23
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
27.
137
NfAecue/Date Received 2023-02-08
In another preferred embodiment the CNP prodrug of the present invention is of
formula (If-
ii), wherein cl is about 225, the CNP moiety has the sequence of SEQ ID NO:23
and is attached
to -1}- through the amine functional group provided by the side chain of the
lysine at position
27.
In a preferred embodiment the CNP prodrug of the present invention is of
foimula (llf), wherein
cl is about 225, -D is a CNP moiety having the sequence of SEQ ID NO:30 and is
attached
to through the amine functional group provided by the side chain of the
lysine at position
27.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (IIf-
i), wherein c I is about 225, the CNP moiety has the sequence of SEQ ID NO:30
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
27.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (If-
ii), wherein cl is about 225, the CNP moiety has the sequence of SEQ ID NO:30
and is attached
to -0- through the amine functional group provided by the side chain of the
lysine at position
27.
In another preferred embodiment the CNP prodrug of the present invention is of
foimula Of')
0
0
0
(IIf '),
wherein
the unmarked dashed line indicates the attachment to a nitrogen provided by
the side
chain of the lysine at position 26 of the CNP moiety of SEQ ID NO:24 by
forming an
amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
138
NfAecue/Date Received 2023-02-08
0
....z,Za
/
1 _______________________ r S 0 0
a
ICz
, t\114
0
1 __ r S 0
\ /
\N¨(
H0
,
wherein
each Za is
CH210¨CH2¨CH2-0¨CH3
1 -cl
0 CH-E0¨CH2¨CH2]-0¨CH3
1 II I cl
, CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, each cl of formula (If') is about 225.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (IIf-
i')
0
H2NN)--,,I.s,,
H i
= 0
0 N
(IIf-i'),
wherein
the unmarked dashed line indicates the attachment to a nitrogen provided by
the side
chain of the lysine at position 26 of the CNP moiety of SEQ ID NO:24 by
forming an
amide bond; and
139
NfAecue/Date Received 2023-02-08
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
0
a
11\114
0 0
114
0
wherein
each Za is
CH210¨CH2¨CH2-0¨C H3
- -cl
CH-0¨CH2¨CH2]-0¨CH3
¨:¨CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, each cl of formula (IIf-i') is about 225.
In another preferred embodiment the CNP prodnig of the present invention is of
fonnula
ii')
0
H
(IIf-ii'),
wherein
140
NfAecue/Date Received 2023-02-08
the unmarked dashed line indicates the attachment to a nitrogen provided by
the side
chain of the lysine at position 26 of the CNP moiety of SEQ ID NO:24 by
forming an
amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
0
_.14'2a
1 /¨ S 0 0
/
, H4
N \
_______________________________ 0 r S 0
\ /
\N4
H
0
,
wherein
each Za is
CH210¨CH2--C112-0¨C113
0 CH¨O¨CH2¨C1-1+0¨CH3
I li I - ci
¨,CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
,
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, each cl of formula (If-u') is about 225.
In an equally preferred embodiment the CNP agonist prodrug of the present
invention is of
formula (Ilea)
141
NfAecue/Date Received 2023-02-08
0
0
N¨
_ kN r= =
0
(Ilea),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond;
k is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12; and
the dashed line marked with the asterisk indicates attachment to a moiety
CH2f0¨CH2¨CH2-0¨C H3
- -cl
0 CH-0¨CH2¨CH2]-0¨CH3
ci
,¨CH2¨CH2-C¨NH¨CH2¨CH2¨C H2-0¨C H2
wherein
each cl is an integer independently ranging from 400 to 500.
Preferably, cl of formula (Ilea) is about 450.
Preferably, k of formula (ilea) is selected from the group consisting of 2, 3,
4, 5, 6 and 7.
In an equally preferred embodiment the CNP agonist prodnig of the present
invention is of
formula (flea-i)
H2 N
N¨ 0
NY\ *
-k
0
(flea-i),
wherein
142
NfAecue/Date Received 2023-02-08
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond;
k is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12; and
the dashed line marked with the asterisk indicates attachment to a moiety
CH210¨CH2¨CH2-0¨C H3
- - cl
0 CH-0¨CH2¨CH2]-0¨CH3
- ci
, CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
wherein
each cl is an integer independently ranging from 400 to 500.
Preferably, k of formula (Hea-i) is selected from the group consisting of 2,
3, 4, 5, 6 and 7.
Preferably, cl of formula (llea-i) is about 450.
In another equally preferred embodiment the CNP agonist prodrug of the present
invention is
of formula (llea-ii)
0
N¨ 0
IY's*
- - k
0
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
agonist moiety by forming an amide bond;
k is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12; and
the dashed line marked with the asterisk indicates attachment to a moiety
CH210¨CH2¨C112-0¨CH3
-ci
0 CH-E0¨CH2¨CH2]-0¨CH3
¨CH2¨CH2-C¨NH¨C112¨CH2¨C H2-0¨C H2
143
NfAecue/Date Received 2023-02-08
wherein
each cl is an integer independently ranging from 400 to 500.
Preferably, k of formula (IIea-ii) is selected from the group consisting of 2,
3, 4, 5, 6 and 7.
Preferably, cl of formula (IIea-ii) is about 450.
Preferably -D of formula (ilea), (IIea-i) and (llea-ii) is a CNP moiety, i.e.
the prodrug of foimula
(ilea), (IIea-i) and (IIea-ii) is a CNP prodrug. Even more preferably -D of
formula (Ilea), (Ilea-
i) and (IIea-ii) is a CNP moiety having the sequence of SEQ ID NO:24, SEQ ID
NO:25 or SEQ
ID NO:30. Most preferably -D of formula (ilea), (IIea-i) and (llea-ii) is a
CNP moiety CNP
having the sequence of SEQ ID NO:24. It is also preferred that -D of formula
(ilea), (IIea-i)
and (IIea-ii) is a CNP moiety CNP having the sequence of SEQ ID NO:20. It is
also preferred
that -D of foimula (ilea), (IIea-i) and (Itea-ii) is a CNP moiety CNP having
the sequence of
SEQ ID NO:21. It is also preferred that -D of formula (Ilea), (Ilea-i) and
(Ilea-ii) is a CNP
moiety CNP having the sequence of SEQ ID NO:22. It is also preferred that -D
of fomiula
(Ma), (IIea-i) and (Itea-ii) is a CNP moiety CNP having the sequence of SEQ ID
NO:23. It is
also preferred that -D of formula (ilea), (IIea-i) and (flea-ii) is a CNP
moiety CNP having the
sequence of SEQ ID NO:30.
In one embodiment -D of formula (ilea), (IIea-i) and (flea-ii) is a CNP moiety
which is attached
to -L1- through the nitrogen of the N-temiinal amine functional group of CNP.
In a preferred embodiment -D of formula (ilea), (IIea-i) and (flea-ii) is a
CNP moiety which is
attached to -L1- through a nitrogen provided by the amine functional group of
a lysine side
chain of the CNP moiety.
In one embodiment said lysine side chain is not part of the ring formed by the
disulfide bridge
between the cysteine residues at positions 22 and 38, if the CNP moiety is of
SEQ ID NO:24.
Accordingly, in one embodiment the CNP moiety is connected to -L1- in the CNP
prodrug of
formula (fka), (IIea-i) and (flea-ii) through the amine functional group
provided by the side
chain of the lysine at position 9, if the CNP has the sequence of SEQ ID
NO:24.
144
NfAecue/Date Received 2023-02-08
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of formula
(Ika), (IIea-i) and (IIea-ii) through the amine functional group provided by
the side chain of
the lysine at position 11, if the CNP has the sequence of SEQ ID NO:24.
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of fonnula
(Ma), (IIea-i) and (IIea-ii) through the amine functional group provided by
the side chain of
the lysine at position 15, if the CNP has the sequence of SEQ ID NO:24.
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of formula
(ilea), (IIea-i) and (IIea-ii) through the amine functional group provided by
the side chain of
the lysine at position 16, if the CNP has the sequence of SEQ ID NO:24.
In another embodiment the CNP moiety is connected to -L1- in the CNP prodrug
of foimula
(Ma), (IIea-i) and (IIea-ii) through the amine functional group provided by
the side chain of
the lysine at position 20, if the CNP has the sequence of SEQ ID NO:24.
In a preferred embodiment said lysine side chain is part of the ring formed by
the disulfide
bridge between the cysteine residues at positions 22 and 38, if the CNP moiety
is of SEQ ID
NO:24.
Accordingly, in one embodiment the CNP moiety is connected to -L1- in the CNP
prodrug of
fonnula (Ilea), (IIea-i) and (Ilea-ii) through the amine functional group
provided by the side
chain of the lysine at position 26, if the CNP has the sequence of SEQ ID
NO:24.
It is understood that the positions of the cysteines and lysines mentioned
above vary depending
on the lengths of the CNP moiety and that the person skilled in the art will
have no difficulty
identifying the corresponding cysteines and lysines in longer or shorter
versions of the CNP
moiety and also understands that for example some lysines may not be present
in shorter CNP
moieties. It is further understood that as a result of for example site-
directed mutagenesis there
might be more lysine residues in the non-ring forming part and/or ring forming
part of the CNP
moiety.
In a preferred embodiment the CNP prodrug of the present invention is of
foimula (Ilea),
wherein cl is about 450, -D is a CNP moiety having the sequence of SEQ ID
NO:24 and is
145
NfAecue/Date Received 2023-02-08
attached to -LI- through the amine functional group provided by the side chain
of the lysine at
position 26.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea-
i), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:24
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
26.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:24
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
26.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea),
wherein cl is about 450, -D is a CNP moiety having the sequence of SEQ ID
NO:20 and is
attached to -1,1- through the amine functional group provided by the side
chain of the lysine at
position 30.
In another preferred embodiment the CNP prodrug of the present invention is of
follnula (Ilea-
i), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:20
and is attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
30.
In another preferred embodiment the CNP prodrug of the present invention is of
fonnula (Ilea-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:20
and is attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
30.
In a preferred embodiment the CNP prodrug of the present invention is of
follnula (ilea),
wherein cl is about 450, -D is a CNP moiety having the sequence of SEQ ID
NO:21 and is
attached to -LI- through the amine functional group provided by the side chain
of the lysine at
position 29.
146
NfAecue/Date Received 2023-02-08
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea-
1), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:21
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
29.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:21
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
29.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea),
wherein cl is about 450, -D is a CNP moiety having the sequence of SEQ ID
NO:22 and is
attached to 42- through the amine functional group provided by the side chain
of the lysine at
position 28.
In another preferred embodiment the CNP prodrug of the present invention is of
foimula (Ilea-
i), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:22
and is attached
to -L1- through the amine functional group provided by the side chain of the
lysine at position
28.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:22
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
28.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea),
wherein c 1 is about 450, -D is a CNP moiety having the sequence of SEQ ID
NO:23 and is
attached to -12- through the amine functional group provided by the side chain
of the lysine at
position 27.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea-
i), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:23
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
27.
147
NfAecue/Date Received 2023-02-08
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:23
and is attached
to through the amine functional group provided by the side chain of the
lysine at position
27.
In a preferred embodiment the CNP prodrug of the present invention is of
formula (ilea),
wherein c 1 is about 450, -D is a CNP moiety having the sequence of SEQ ID
NO:30 and is
attached to -1}- through the amine functional group provided by the side chain
of the lysine at
position 27.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea-
i), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:30
and is attached
to through the amine functional group provided by the side chain of the
lysine at position
27.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (Ilea-
ii), wherein cl is about 450, the CNP moiety has the sequence of SEQ ID NO:30
and is attached
to -12- through the amine functional group provided by the side chain of the
lysine at position
27.
Accordingly, in a preferred embodiment the CNP prodrug of the present
invention is of foimula
(flea)
0
0
y.
. _ k
0
wherein
the unmarked dashed line indicates the attachment to the nitrogen provided by
the side
chain of the lysine at position 26 of the CNP moiety of SEQ ID NO:24 by
forming an
amide bond;
k is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12; and
148
NfAecue/Date Received 2023-02-08
the dashed line marked with the asterisk indicates attachment to a moiety
CH210¨CH2¨CH210¨C H3
0 CH-
E0¨C I-12¨CH2-0¨C H3
cl
¨!CH,¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
-
wherein
each cl is an integer independently ranging from 400 to 500.
Preferably, k of formula (ilea') is selected from the group consisting of 2,
3, 4, 5, 6 and 7.
Preferably, each cl of formula (ilea') is about 450.
In another preferred embodiment the CNP prodrug of the present invention is of
fonnula (Ilea-
i')
0
H2N
H 7
0
0
*
- -k
0
wherein
the unmarked dashed line indicates the attachment to a nitrogen provided by
the side
chain of the lysine at position 26 of the CNP moiety of SEQ ID NO:24 by
forming an
amide bond;
k is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12; and
the dashed line marked with the asterisk indicates attachment to a moiety
CH210¨CH2--CH210¨C H3
cl
0 C H-
E0¨C1-12¨CH2-0¨C H3
cl
¨:¨CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨CH2
wherein
each cl is an integer independently ranging from 400 to 500.
149
NfAecue/Date Received 2023-02-08
Preferably, k of formula (llea-i') is selected from the group consisting of 2,
3, 4, 5, 6 and 7.
Preferably, each cl of formula (llea-ii) is about 450.
In another preferred embodiment the CNP prodrug of the present invention is of
fomiula (Ilea-
ii')
0
0
'
H
0
wherein
the unmarked dashed line indicates the attachment to a nitrogen provided by
the side
chain of the lysine at position 26 of the CNP moiety of SEQ ID NO:24 by
forming an
amide bond;
k is selected from the group consisting of 1,2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12; and
the dashed line marked with the asterisk indicates attachment to a moiety
CH210¨CH2¨CH2}0¨CH3
cl
CH-E0¨CH2¨CH2-0¨CH3
c1
¨:¨CH2¨CH,-C¨NH¨CH2¨CH2¨CH2-0¨CH2
wherein
each cl is an integer independently ranging from 400 to 500.
Preferably, k of formula (llea-ii') is selected from the group consisting of
2, 3, 4, 5, 6 and 7.
Preferably, each cl of formula (Hea-ii') is about 450.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (IIfa)
150
NfAecue/Date Received 2023-02-08
0
0 N 0
(IIfa),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
0
N
AZ a
0 0
NAza
k
0
wherein
k is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12;
each -Za is
CH210¨C H2¨C H2-0¨C H3
C H-0¨CH2¨CH2]-0¨CH3
¨CH2¨CH2-C¨NH¨C H2¨C H2¨C H2-0¨C H2
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, k of formula (IIfa) is selected from the group consisting of 2, 3,
4, 5, 6 and 7.
Preferably, each cl of foimula (IIfa) is about 225.
In another preferred embodiment the CNP pro drug of the present invention is
of foimula (IIfa-
i)
151
NfAecue/Date Received 2023-02-08
0
H
0
2 N
0 N
(IIfa-i),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
0
- N AZ a
0 0
N - a
z
wherein
k is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12;
each -Za is
CH210¨C H2¨C H2-0¨C H3
C H-0¨CH2¨CH2]-0¨CH3
¨CH2¨CH2-C¨NH¨C H2¨C H2¨C H2-0¨C H2
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, k of formula (IIfa-i) is selected from the group consisting of 2,
3, 4, 5, 6 and 7.
Preferably, each cl of folinula (IIfa-i) is about 225.
In another preferred embodiment the CNP pro drug of the present invention is
of foimula (IIfa-
ii)
152
NfAecue/Date Received 2023-02-08
0
0 N 0
(IIfa-ii),
wherein
the unmarked dashed line indicates the attachment to a nitrogen of -D which is
a CNP
moiety by forming an amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
0
' N
NAZaNNAZa
0
- k
0
wherein
k is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12;
each -Za is
CH210¨C H2--c H2¨o¨C H3
- - cl
o CH-0¨CH2¨CH2]-0¨CH3
I II I - ci
¨CH2¨CH2-C¨NH¨C H2¨C H2¨C H2-0¨C H2
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, each cl of formula (IIfa-ii) is about 225.
In one embodiment the CNP moiety of the CNP prodrug of formula (IIfa), (IIfa-
i) and (IIfa-ii)
has the sequence of SEQ ID NO:25.
In another embodiment the CNP moiety of the CNP prodrug of formula (IIfa),
(IIfa-i) and (IIfa-
ii) has the sequence of SEQ ID NO:30.
153
NfAecue/Date Received 2023-02-08
In another embodiment the CNP moiety of the CNP prodrug of formula (IIfa),
(IIfa-i) and (IIfa-
ii) has the sequence of SEQ ID NO:20.
In another embodiment the CNP moiety of the CNP prodrug of formula (IIfa),
(IIfa-i) and (IIfa-
ii) has the sequence of SEQ ID NO:2 L
In another embodiment the CNP moiety of the CNP prodrug of formula (IIfa),
(IIfa-i) and (IIfa-
ii) has the sequence of SEQ ID NO:22.
In another embodiment the CNP moiety of the CNP prodrug of formula (IIfa),
(IIfa-i) and (IIfa-
ii) has the sequence of SEQ ID NO:23.
In a preferred embodiment the CNP moiety of the CNP prodrug of fonnula (IIfa),
(IIfa-i) and
(IIfa-ii) has the sequence of SEQ ID NO:24.
In one embodiment the CNP moiety is attached to -L1- in the CNP prodrug of
foimula (IIfa),
(IIfa-i) and (IIfa-ii) through the nitrogen of the N-terminal amine functional
group of CNP.
In another preferred embodiment the CNP prodrug of the present invention is of
formula (IIf
a')
0
= 0
0 N
(IIfa'),
wherein
the unmarked dashed line indicates the attachment to the nitrogen provided by
the side
chain of the lysine at position 26 of the CNP moiety of SEQ ID NO:24 by
forming an
amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
154
NfAecue/Date Received 2023-02-08
0
N
NAZa
0 0
NAZa
- k
0
wherein
k is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12;
each Za is
CH210¨CH2¨C H2-0¨C H3
¨C1
0 C H-E0¨CH2¨CH2]-0¨CH3
ci
¨:¨CH2¨CH2-C¨NH¨CH2¨CH2¨CH2-0¨C H2
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, k of formula (IIfa') is selected from the group consisting of 2,
3, 4, 5, 6 and 7.
Preferably, each cl of formula (IIfa') is about 225.
In another preferred embodiment the CNP prodrug of the present invention is of
foimula (IIfa-
i')
H2 N
s,
H
= 0
0, _N
(IIfa-i'),
wherein
the unmarked dashed line indicates the attachment to a nitrogen provided by
the side
chain of the lysine at position 26 of the CNP moiety of SEQ ID NO:24 by
forming an
amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
155
NfAecue/Date Received 2023-02-08
0
______________ N
;Za
0 0
\/\N NAZa
r
0
wherein
k is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12;
each Za is
C H21 0¨C H2¨CH2-0¨C 113
-cl
C H-E0¨CH2¨CH2]-0¨CH3
ci
¨:¨CH2¨CH2-C¨NH¨CH2¨C H2¨CH2-0¨C H2
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, k of formula (IIfa-i') is selected from the group consisting of 2,
3, 4, 5, 6 and 7.
Preferably, each cl of formula (IIfa-i') is about 225.
In another preferred embodiment the CNP prodrug of the present invention is of
foimula (IIfa-
ii')
0
./NN)./\_.)=(
H E
z 0
0 N
(IIfa-ii'),
wherein
the unmarked dashed line indicates the attachment to a nitrogen provided by
the side
chain of the lysine at position 26 of the CNP moiety of SEQ ID NO:24 by
forming an
amide bond; and
the dashed line marked with the asterisk indicates attachment to -Z having the
structure
156
NfAecue/Date Received 2023-02-08
0
' N
Za
0 0
\/\N
'Ir-s-i'cNAZa
0
wherein
k is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
and 12;
each Za is
CH2f0-CH2-CH2-0-CH3
0 CH-E0-CH2-CH2]-0-CH3
II I ci
-:-CH2-CH2-C-NH-CH2-CH2-CH2-O¨C H2
wherein
each cl is an integer independently ranging from 200 to 250.
Preferably, k of formula (llfa-ii') is selected from the group consisting of
2, 3,4, 5, 6 and 7.
Preferably, each cl of formula (IIfa-ii') is about 225.
In a further aspect the present invention relates to a pharmaceutical
composition comprising at
least one controlled-release CNP agonist of the present invention or a
pharmaceutically
acceptable salt thereof, wherein the pharmaceutical composition comprises at
least one further
biologically active moiety or drug.
The at least one further biologically active moiety or drug may be in its free
form (i.e in the
folin of a free drug), may be in the form of a stable conjugate or may be in
the form of a
controlled-release compound.
In one embodiment, the at least one further biologically active moiety or drug
is a drug in its
free form, i.e. the pharmaceutical composition of the present invention
comprises at least one
controlled-release CNP agonist and at least one further drug.
Preferably, the at least one further drug is selected from the group
consisting of antihistamins;
human anti-FGFR3 antibodies; soluble forms of human fibroblast growth factor
receptor 3;
157
NfAecue/Date Received 2023-02-08
tyrosine kinase inhibitors; statins; CNP agonists; growth hormone; IGF-1; ANP;
BNP;
inhibitors of peptidases and proteases; and inhibitors of NPR-C.
A preferred antihistamin is meclozine.
A preferred tyrosine kinase inhibitor is NVP-BGJ398.
A preferred statin is rosuvastatin.
A preferred CNP agonist for the at least one further drug is vosoritide.
Preferred inhibitors of peptidases and proteases are NEP and furin inhibitors.
A preferred inhibitor for NEP are thiorphan and candoxatril.
Preferred inhibitors of NPR-C are the fragment of SEQ ID NO:98 (FGIPMDRIGRNPR)
and
antibody B701.
Preferred inhibitors of tyrosine kinases are as disclosed in U.S. patents
6329375 and 6344459.
In one embodiment the at least one further drug is an antihistamin.
In another embodiment the at least one further drug is a human anti-FGFR3
antibody.
In another embodiment the at least one further drug is a soluble forms of
human fibroblast
growth factor receptor 3 (sFGFR3).
In another embodiment the at least one further drug is a tyrosine kinase
inhibitor.
In another embodiment the at least one further drug is a statin.
In another embodiment the at least one further drug is a growth hormone.
In another embodiment the at least one further drug is a CNP agonist.
158
NfAecue/Date Received 2023-02-08
In another embodiment the at least one further drug is IGF-1.
In another embodiment the at least one further drug is ANP.
In another embodiment the at least one further is BNP.
In another embodiment the at least one further drug is an inhibitor of
peptidases and proteases.
In another embodiment the at least one further drug is an inhibitor of NPR-C.
In another embodiment, the at least one further biologically active moiety or
drug is in the form
of a stable conjugate.
In one embodiment the at least one further biologically active moiety in the
form of a stable
conjugate comprises at least one biologically active moiety covalently
conjugated through a
stable linkage to a polymeric moiety, preferably to a water-soluble polymeric
moiety, either
directly or through a spacer moiety.
Preferably, such polymeric moiety, even more preferably water-soluble
polymeric moiety,
comprises a polymer selected from the group consisting of 2-methacryloyl-
oxyethyl phosphoyl
cholins, poly(acrylic acids), poly(acrylates), poly(acrylamides),
poly(alkyloxy) polymers,
poly(amides), poly(amidoamines), poly(arnino acids), poly(anhydrides),
poly(aspartamides),
poly(butyric acids), poly(glycolic acids), polybutylene terephthalates,
poly(caprolactones),
poly(carbonates), poly(cyanoacrylates), poly(dimethylacrylamides),
poly(esters),
poly(ethylenes), poly(ethyleneglycols), poly(ethylene oxides), poly(ethyl
phosphates),
poly(ethy loxazolines), poly (gly colic acids), poly (hy droxy ethyl
acrylates), poly (hy droxy ethyl-
oxazolines), poly(hydroxymethacrylates), poly
(hy droxy propy lmethacrylamides),
poly(hydroxypropyl methacrylates), poly(hydroxypropyloxazolines), poly
(iminocarbonates),
poly (lactic acids), poly (lactic-co-glycolic acids), poly (methacrylamides),
poly (methacry lates),
poly(methyloxazolines), poly(organophosphazenes), poly(ortho esters),
poly(oxazolines),
poly(propylene glycols), poly(siloxanes), poly(urethanes), poly(vinyl
alcohols), poly(vinyl
amines), poly(vinylmethylethers), poly(vinylpyrrolidones), silicones,
celluloses, carbomethyl
celluloses, hydroxypropyl methylcelluloses, chitins, chitosans, dextrans,
dextrins, gelatins,
159
NfAecue/Date Received 2023-02-08
hyaluronic acids and derivatives, functionalized hyaluronic acids, mannans,
pectins,
rhamnogalacturonans, starches, hydroxyalkyl starches, hydroxy ethyl starches
and other
carbohydrate-based polymers, xylans, and copolymers thereof.
In another embodiment the at least one further biologically active moiety in
the form of a stable
conjugate is covalently conjugated through a stable linkage to an albumin-
binding moiety.
Preferably, said albumin-binding moiety is a C8-24 alkyl moiety or fatty acid
derivative.
Preferred fatty acid derivatives are those disclosed in WO 2005/027978 A2 and
WO
2014/060512 Al.
Preferably, the at least one further biologically active moiety in the foun of
a stable conjugate
comprises a biologically active moiety selected from the group consisting of
antihistamins;
human anti-FGFR3 antibodies; soluble forms of human fibroblast growth factor
receptor 3
(sFGFR3); tyrosine kinase inhibitors; statins; CNP agonists; growth hormone;
IGF-1; ANP;
BNP; inhibitors of peptidases and proteases; and inhibitors of NPR-C.
A preferred antihistamin is meclozine.
A preferred tyrosine kinase inhibitor is NVP-BGJ398.
A preferred statin is rosuvastatin.
A preferred CNP agonist for the at least one further biologically active
moiety is vosoritide.
Preferred inhibitors of peptidases and proteases are NEP and furin inhibitors.
A preferred inhibitor for NEP are thiorphan and candoxatril.
Preferred inhibitors of NPR-C are the fragment of SEQ ID NO:98 (FGIPMDRIGRNPR)
and
antibody B701.
Preferred inhibitors of tyrosine kinases are as disclosed in U.S. patents
6329375 and 6344459.
160
NfAecue/Date Received 2023-02-08
In one embodiment the at least one further biologically active moiety in the
form of a stable
conjugate comprises an antihistamin moiety.
In another embodiment the at least one further biologically active moiety in
the form of a stable
conjugate comprises a human anti -FGFR3 antibody moiety.
In another embodiment the at least one further biologically active moiety in
the form of a stable
conjugate comprises a soluble forms of human fibroblast growth factor receptor
3 (sFGFR3)
moiety.
In another embodiment the at least one further biologically active moiety in
the form of a stable
conjugate comprises a tyrosine kinase inhibitor moiety.
In another embodiment the at least one further biologically active moiety in
the form of a stable
conjugate comprises a statin moiety.
In another embodiment the at least one further biologically active moiety in
the form of a stable
conjugate comprises a growth hormone moiety.
In another embodiment the at least one further biologically active moiety in
the form of a stable
conjugate comprises a CNP agonist moiety.
In another embodiment the at least one further biologically active moiety in
the foim of a stable
conjugate comprises an IGF-1 moiety.
In another embodiment the at least one further biologically active moiety in
the form of a stable
conjugate comprises an ANP moiety.
In another embodiment the at least one further biologically active moiety in
the foim of a stable
conjugate comprises a BNP moiety.
In another embodiment the at least one further biologically active moiety in
the foun of a stable
conjugate comprises an inhibitor of peptidases and proteases moiety.
161
NfAecue/Date Received 2023-02-08
In another embodiment the at least one further biologically active moiety in
the form of a stable
conjugate comprises an inhibitor of NPR-C moiety.
In another embodiment the at least one further biologically active moiety or
drug is in the form
of a controlled-release compound.
Preferably, the at least one further biologically active moiety or drug in the
form of a controlled-
release compound comprises at least one biologically active moiety or drug
selected from the
group consisting of antihistamins; human anti-FGFR3 antibodies; soluble forms
of human
fibroblast growth factor receptor 3; statins; CNP agonists; growth hormone;
IGF-1; ANP; BNP;
inhibitors of peptidases and proteases; inhibitors of tyrosine kinases; and
inhibitors of NPR-C.
A preferred antihistamin is meclozine.
A preferred tyrosine kinase inhibitor is NVP-BG.J398.
A preferred statin is rosuvastatin.
A preferred CNP agonist for the at least one further drug is vosoritide.
Preferred inhibitors of peptidases and proteases are NEP and furin inhibitors.
A preferred inhibitor for NEP are thimphan and candoxatril.
Preferred inhibitors of NPR-C are the fragment of SEQ ID NO:98 (FGIPMDRIGRNPR)
and
antibody B701.
Preferred inhibitors of tyrosine kinases are as disclosed in U.S. patents
6329375 and 6344459.
.. In one embodiment the at least one further biologically active moiety or
drug in the form of a
controlled-release comprises an antihistamin moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a controlled-release comprises a human anti-FGFR3 antibody moiety or drug.
162
NfAecue/Date Received 2023-02-08
In another embodiment the at least one further biologically active moiety or
drug in the form of
a controlled-release comprises a soluble forms of human fibroblast growth
factor receptor 3
(sFGFR3) moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the foim of
a controlled-release comprises a tyrosine kinase inhibitor moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a controlled-release comprises a statin moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a controlled-release comprises a growth hormone moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a controlled-release comprises a CNP agonist moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a controlled-release comprises an IGF-1 moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a controlled-release comprises an ANP moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the folin of
a controlled-release comprises a BNP moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a controlled-release comprises an inhibitor of peptidases and proteases moiety
or drug.
In another embodiment the at least one further biologically active moiety or
drug in the foim of
a controlled-release comprises an inhibitor of NPR-C moiety or drug.
In one embodiment the at least one further biologically active moiety or drug
in the form of a
controlled-release compound is water-insoluble.
163
NfAecue/Date Received 2023-02-08
Preferably, such water-insoluble controlled-release compound is selected from
the group
consisting of crystals, nanoparticles, microparticles, nanospheres and
microspheres.
In one embodiment the at least one further biologically active moiety or drug
in the form of a
water-insoluble controlled-release compound is a crystal comprising at least
one drug or
biologically active moiety.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release compound is a nanoparticle comprising at
least one drug
or biologically active moiety.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release compound is a microparticle comprising at
least one drug
.. or biologically active moiety.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release compound is a nanosphere comprising at
least one drug or
biologically active moiety.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release compound is a microsphere comprising at
least one drug
or biologically active moiety.
In one embodiment the at least one further biologically active moiety or drug
in the form of a
water-insoluble controlled-release compound is a vesicle comprising at least
one drug or
biologically active moiety. Preferably, such vesicle comprising at least one
drug or biologically
active moiety is a micelle, liposome or polymersome.
In one embodiment the at least one further biologically active moiety or drug
in the form of a
water-insoluble controlled-release compound is a micelle comprising at least
one drug or
biologically active moiety.
164
NfAecue/Date Received 2023-02-08
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release compound is a liposome comprising at
least one drug or
biologically active moiety. Preferably, such liposome is selected from the
group consisting of
aquasomes; non-ionic surfactant vesicles, such as niosomes and proniosomes;
cationic
liposomes, such as LeciPlex; transfersomes; ethosomes; ufasomes; sphingosomes;
and
pharmacosomes.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release compound is a polymersome at least one
drug or
biologically active moiety.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release compound comprises at least one
biologically active
moiety or drug non-covalently embedded in a water-insoluble polymer.
Preferably, such water-
insoluble polymer comprises a polymer selected from the group consisting of 2-
methacryloyl-
oxy ethyl phosphoyl cholins, poly (acry lic acids), poly (acry lates), poly
(acry lam i des),
poly(alkyloxy) polymers, poly (amides), poly(amidoamines), poly (amino acids),
poly(anhydrides), poly(aspartamides), poly(butyric acids), poly(glycolic
acids), polybutylene
terephthalates, poly (caprolactones), poly (carbonates),
poly (cy anoacry lates),
poly (dimethy lacrylami des), poly (esters), poly (ethy lenes),
poly(ethyleneglycols), poly (ethy lene
oxides), poly (ethyl phosphates), poly(ethyloxazolines),
poly(glycolic acids),
poly(hy droxy ethyl acrylates), poly (hydroxyethyl-oxazolines), poly (hy
droxymethacry lates),
poly (hy droxypropy lmethacry lamides), poly (hy droxypropyl
methacry lates),
poly (hy droxypropy lox azolines), poly (imi noc arbonate s), poly (lactic
acids), poly (lacti c -co-
glycolic acids), poly(methacrylarnides), poly(methacrylates),
poly(methyloxazolines),
poly(organophosphazenes), poly(ortho esters), poly(oxazolines), poly(propylene
glycols),
poly (siloxanes), poly (urethanes), poly (vinyl
alcohols), poly (vinyl am i nes),
poly(vinylmethylethers), poly(vinylpyrrolidones), silicones, celluloses,
carbomethyl celluloses,
hydroxypropyl methylcelluloses, chitins, chitosans, dextrans, dextrins,
gelatins, hyaluronic
acids and derivatives, functionalized hyaluronic acids, mannans, pectins,
rhamnogalacturonans,
starches, hydroxyalkyl starches, hydroxyethyl starches and other carbohydrate-
based polymers,
xylans, and copolymers thereof.
165
NfAecue/Date Received 2023-02-08
In a preferred embodiment the at least one further biologically active moiety
or drug in the form
of a water-insoluble controlled-release compound comprises at least one drug
or biologically
active moiety non-covalently embedded in poly(lactic-co-glycolic acid) (PLGA).
In another embodiment the at least one further biologically active moiety or
drug in the feint of
a water-insoluble controlled-release compound comprises at least one
biologically active
moiety covalently and reversibly conjugated to a water-insoluble polymer.
Preferably such
water-insoluble polymer comprises a polymer selected from the group consisting
of 2-
methacry loyl-oxy ethyl phosphoyl cholins, poly (acry c
acids), poly (acry late s),
poly(acrylamides), poly(alkyloxy) polymers, poly(amides), poly(amidoamines),
poly(amino
acids), poly(anhydrides), poly(aspartamides), poly(butyric acids),
poly(glycolic acids),
polybutylene terephthalates, poly(caprolactones), poly(carbonates),
poly(cyanoacrylates),
poly(dimethylacrylamides), poly(esters), poly(ethylenes),
poly(ethyleneglycols), poly (ethylene
oxides), poly (ethyl phosphates), poly
(ethyloxazolines), poly(gly colic acids),
poly(hydroxyethyl acrylates), poly(hydroxyethyl-oxazolines),
poly(hydroxymethacrylates),
poly(hy droxypropy lmethacry lamides), poly (hy droxypropyl
methacrylates),
poly(hydroxypropyloxazolines), poly(iminocarbonates), poly(lactic acids),
poly(lactic-co-
glycolic acids), poly(methacrylamides), poly(methacrylates),
poly(methyloxazolines),
poly(organophosphazenes), poly(ortho esters), poly(oxazolines), poly
(propylene glycols),
poly(siloxanes), poly(urethanes), poly(vinyl alcohols), poly(vinyl amines),
poly(vinylmethylethers), poly(vinylpyrrolidones), silicones, celluloses,
carbomethyl celluloses,
hydroxypropyl methylcelluloses, chitins, chitosans, dextrans, dextrins,
gelatins, hyaluronic
acids and derivatives, functionalized hyaluronic acids, mannans, pectins,
rhamnogalacturonans,
starches, hydroxyalkyl starches, hydroxyethyl starches and other carbohydrate-
based polymers,
xylans, and copolymers thereof.
Preferably, the at least one further biologically active moiety or drug in the
form of a water-
insoluble controlled-release compound comprises at least one biologically
active moiety or drug
selected from the group consisting of antihistamins; human anti-FGFR3
antibodies; soluble
.. foiins of human fibroblast growth factor receptor 3; tyrosine kinase
inhibitors; statins; CNP
agonists; growth hormone; IGF-1; ANP; BNP; inhibitors of peptidases and
proteases; and
inhibitors of NPR-C.
A preferred antihistamin is meclozine.
166
NfAecue/Date Received 2023-02-08
A preferred tyrosine kinase inhibitor is NVP-BGJ398.
A preferred statin is rosuvastatin.
A preferred CNP agonist for the at least one further drug is vosoritide.
Preferred inhibitors of peptidases and proteases are NEP and furin inhibitors.
A preferred inhibitor for NEP are thiorphan and candoxatril.
Preferred inhibitors of NPR-C are the fragment of SEQ ID NO:98 (FGIPMDRIGRNPR)
and
antibody B701.
Preferred inhibitors of tyrosine kinases are as disclosed in U.S. patents
6329375 and 6344459.
In one embodiment the at least one further biologically active moiety or drug
in the form of a
water-insoluble controlled-release comprises an antihistamin moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release comprises a human anti-FGFR3 antibody
moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release comprises a soluble forms of human
fibroblast growth
factor receptor 3 (sFGFR3) moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release comprises a tyrosine kinase inhibitor
moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the foiin of
a water-insoluble controlled-release comprises a statin moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release comprises a growth hormone moiety or
drug.
167
NfAecue/Date Received 2023-02-08
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release comprises a CNP agonist moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the folin of
a water-insoluble controlled-release comprises an IGF-1 moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release comprises an ANP moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the folln of
a water-insoluble controlled-release comprises a BNP moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
.. a water-insoluble controlled-release comprises an inhibitor of peptidases
and proteases moiety
or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-insoluble controlled-release comprises an inhibitor of NPR-C moiety or
drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a controlled-release compound is water-soluble.
In one embodiment the at least one further biologically active moiety or drug
in the form of a
.. water-soluble controlled-release compound comprises at least one
biologically active moiety
covalently conjugated through a reversible linkage to a water-soluble
polymeric moiety, either
directly or through a spacer moiety.
Preferably, such water-soluble polymeric moiety comprises a polymer selected
from the group
.. consisting of 2-methacryloyl-oxyethyl phosphoyl cholins, poly(acrylic
acids), poly(acrylates),
poly(acrylamides), poly(alkyloxy) polymers, poly(amides), poly(amidoamines),
poly(amino
acids), poly(anhydrides), poly(aspartamides), poly(butyric acids),
poly(glycolic acids),
polybutylene terephthalates, poly(caprolactones), poly(carbonates),
poly(cyanoacrylates),
poly(dimethylacrylamides), poly(esters), poly (ethylenes),
poly(ethyleneglycols), poly (ethyl ene
168
NfAecue/Date Received 2023-02-08
oxides), poly (ethyl phosphates), poly(ethyloxazolines),
poly(glycolic acids),
poly(hydroxyethyl acrylates), poly(hydroxyethyl-oxazolines),
poly(hydroxymethacrylates),
poly (hy droxypropy lmethacry lami des), poly (hydroxypropyl
methacry lates),
poly(hydroxypropyloxazolines), poly(iminocarbonates), poly(lactic acids),
poly(lactic-co-
glycolic acids), poly(methacrylamides), poly(methacrylates),
poly(methyloxazolines),
poly(organophosphazenes), poly(ortho esters), poly(oxazolines), poly(propylene
glycols),
poly(siloxanes), poly(urethanes), poly(vinyl
alcohols), poly(vinyl amines),
poly(vinylmethylethers), poly(vinylpyrrolidones), silicones, celluloses,
carbomethyl celluloses,
hydroxypropyl methylcelluloses, chitins, chitosans, dextrans, dextrins,
gelatins, hyaluronic
acids and derivatives, functionalized hyaluronic acids, mannans, pectins,
rhamnogalacturonans,
starches, hydroxy alkyl starches, hy droxy ethyl starches and other
carbohydrate-based polymers,
xylans, and copolymers thereof.
In another embodiment the at least one further biologically active moiety in
the form of a water-
soluble controlled-release compound is covalently conjugated through a stable
linkage to an
albumin-binding moiety. Preferably, said albumin-binding moiety is a C8-24
alkyl moiety or
fatty acid derivative. Preferred fatty acid derivatives are those disclosed in
WO 2005/027978
A2 and WO 2014/060512 Al.
Preferably, the at least one further biologically active moiety in the form of
a water-soluble
controlled-release comprises a biologically active moiety selected from the
group consisting of
antihistamins; human anti-FGFR3 antibodies; soluble forms of human fibroblast
growth factor
receptor 3; tyrosine kinase inhibitors; statins; CNP agonists; growth hormone;
IGF -1; ANP;
BNP; inhibitors of peptidases and proteases; and inhibitors of NPR-C.
A preferred antihistamin is meclozine.
A preferred tyrosine kinase inhibitor is NVP-BGJ398.
A preferred statin is rosuvastatin.
A preferred CNP agonist for the at least one further drug is vosoritide.
Preferred inhibitors of peptidases and proteases are NEP and fiirin
inhibitors.
169
NfAecue/Date Received 2023-02-08
A preferred inhibitor for NEP are thiorphan and candoxatril.
Preferred inhibitors of NPR-C are the fragment of SEQ ID NO:98 (FGIPMDRIGRNPR)
and
antibody B701.
Preferred inhibitors of tyrosine kinases are as disclosed in U.S. patents
6329375 and 6344459.
In one embodiment the at least one further biologically active moiety or drug
in the form of a
water-soluble controlled-release comprises an antihistamin moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-soluble controlled-release comprises a human anti-FGFR3 antibody
moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-soluble controlled-release comprises a soluble founs of human
fibroblast growth factor
receptor 3 (sFGFR3) moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the foiiii of
a water-soluble controlled-release comprises a tyrosine kinase inhibitor
moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the foiin of
a water-soluble controlled-release comprises a statin moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-soluble controlled-release comprises a growth hormone moiety or drug.
A preferred
water-soluble controlled-release growth hormone compound is compound 2 of
example 2 of
W02016/079114A1. Accordingly, a preferred water-soluble controlled-release
growth
hormone compound has the following structure:
170
NfAecue/Date Received 2023-02-08
0
0
0 0
hGH)0 0 0
0 0
n=200 - 250
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-soluble controlled-release comprises a CNP agonist moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the folln of
a water-soluble controlled-release comprises an IGF-1 moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-soluble controlled-release comprises an ANP moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the Timm of
a water-soluble controlled-release comprises a BNP moiety or drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-soluble controlled-release comprises an inhibitor of peptidases and
proteases moiety or
drug.
In another embodiment the at least one further biologically active moiety or
drug in the form of
a water-soluble controlled-release comprises an inhibitor of NPR-C moiety or
drug.
Another aspect of the present invention is the pharmaceutical composition of
the present
invention for use as a medicament.
171
NfAecue/Date Received 2023-02-08
Preferably, said medicament is used in the treatment of a disease selected
from the group
consisting of achondroplasia, hypochondroplasi a,
short stature, dwarfism,
osteochondrodysplasias, thanatophoric dysplasia, osteogenesis imperfecta,
achondrogenesis,
chondrodysplasia punctata, homozygous achondroplasia, camptomelic dysplasia,
congenital
lethal hypophosphatasia, perinatal lethal type of osteogenesis imperfecta,
short-rib polydactyly
syndromes, rhizomelic type of chondrodysplasia punctata, Jansen-type
metaphyseal dysplasia,
spondyloepiphyseal dysplasia congenita, atelosteogenesis, diastrophic
dysplasia, congenital
short femur, Langer-type mesomelic dysplasia, Nievergelt-type mesomelic
dysplasia, Robinow
syndrome, Reinhardt syndrome, acrodysostosis, peripheral dysostosis, Kniest
dysplasia,
fibrochondrogenesis, Roberts syndrome, acromesomelic dysplasia, micromelia,
Morquio
syndrome, Kniest syndrome, metatrophic dysplasia, spondyloepimetaphy seal
dysplasia,
neurofibromatosis, Legius syndrome, LEOPARD syndrome, Noonan syndrome,
hereditary
gingival fibromatosis, neurofibromatosis type 1, Legius syndrome,
cardiofaciocutaneous
syndrome, Costello syndrome, SHOX deficiency, idiopathic short stature, growth
hormone
deficiency, osteoarthritis, cleidocranial dysostosis, craniosynostosis (e.g.,
Muenke syndrome,
Crouzon syndrome, Apert syndrome, Jackson-Weiss syndrome, Pfeiffer syndrome,
or
Crouzonodermoskeletal syndrome), dactyly, brachydactyly, camptodactyly,
polydactyly,
syndactyly, dyssegmental dysplasia, enchondromatosis, fibrous dysplasia,
hereditary multiple
exostoses, hypophosphatemic rickets, Jaffe-Lichtenstein syndrome, Marfan
syndrome,
McCune-Albright syndrome, osteopetrosis and osteopoikilosis.
In another embodiment said medicament is used in the treatment of an
ophthalmic disorder,
such as glaucoma and/or elevated intraocular pressure.
In another embodiment said medicament is used in the treatment of a cancer
disease associated
with overactivation of FGFR3, e.g., multiple myeloma, myeloproliferative
syndrome,
leukemia, plasma cell leukemia, lymphoma, glioblastoma, prostate cancer,
bladder cancer, or
mammary cancer.
In another embodiment said medicament is used in the treatment of a vascular
smooth muscle
disorder, preferably selected from the group consisting of hypertension,
restenosis,
arteriosclerosis, acute decompensated heart failure, congestive heart failure,
cardiac edema,
nephredema, hepatic edema, acute renal insufficiency, and chronic renal
insufficiency.
172
NfAecue/Date Received 2023-02-08
In another embodiment said medicament is used in the treatment of hemorrhagic
shock.
Preferably said medicament is used in the treatment of an achondroplasia
phenotype selected
from the group consisting of growth retardation, skull deformities,
orthodontic defects, cervical
cord compression, spinal stenosis, hydrocephalus, hearing loss due to chronic
otitis,
cardiovascular disease, neurological disease, and obesity.
Most preferably said medicament is used in the treatment of achondroplasia.
Another aspect of the present invention is the pharmaceutical composition of
the present
invention for use in the treatment of a patient suffering from a disorder that
benefits from
stimulating growth.
Preferably, the patient is a mammalian patient, more preferably a human
patient.
Preferably, such disorders that benefit from stimulating growth are selected
from the group
comprising achondroplasia, hypochondroplasia, short
stature, dwarfism,
osteochondrodysplasias, thanatophoric dysplasia, osteogenesis imperfecta,
achondrogenesis,
chondrodysplasia punctata, homozygous achondroplasia, camptomelic dysplasia,
congenital
lethal hypophosphatasia, perinatal lethal type of osteogenesis imperfecta,
short-rib polydactyly
syndromes, rhizomelic type of chondrodysplasia punctata, Jansen-type metaphy
seal dysplasia,
spondyloepiphyseal dysplasia congenita, atelosteogenesis, diastrophic
dysplasia, congenital
short femur, Langer-type mesomelic dysplasia, Nievergelt-type mesomelic
dysplasia, Robinow
syndrome, Reinhardt syndrome, acrodysostosis, peripheral dysostosis, Kniest
dysplasia,
fibrochondrogenesis, Roberts syndrome, acromesomelic dysplasia, micromelia,
Morquio
syndrome, ICniest syndrome, metatrophic dysplasia, and spondyloepimetaphyseal
dysplasia.
Most preferably, the disorder that benefits from stimulating growth is
achondroplasia.
Another aspect of the present invention is a method of treating a patient
suffering from a
disorder that benefits from stimulating growth by administering the
pharmaceutical
composition of the present invention.
Preferably, the patient is a mammalian patient, more preferably a human
patient.
173
NfAecue/Date Received 2023-02-08
Preferably, such disorders that benefit from stimulating growth are selected
from the group
comprising achondroplasia, hypochondroplasia, short
stature, dwarfism,
osteochondrodysplasias, thanatophoric dysplasia, osteogenesis imperfecta,
achondrogenesis,
chondrodysplasia punctata, homozygous achondroplasia, camptomelic dysplasia,
congenital
lethal hypophosphatasia, perinatal lethal type of osteogenesis imperfecta,
short-rib polydactyly
syndromes, rhizomelic type of chondrodysplasia punctata, Jansen-type
metaphyseal dysplasia,
spondyloepiphyseal dysplasia congenita, atelosteogenesis, diastrophic
dysplasia, congenital
short femur, Langer-type mesomelic dysplasia, Nievergelt-type mesomelic
dysplasia, Robinow
syndrome, Reinhardt syndrome, acrodysostosis, peripheral dysostosis, Kniest
dysplasia,
fibrochondrogenesis, Roberts syndrome, acromesomelic dysplasia, micromelia,
Morquio
syndrome, Kniest syndrome, metatrophic dysplasia, and spondyloepimetaphyseal
dysplasia.
Most preferably, the disorder that benefits from stimulating growth is
achondroplasia.
If the CNP agonist is a polypeptide, such polypeptide may be prepared by
standard solid-phase
peptide synthesis methods, e.g. by Boc chemistry (R. B. Merrifield, J. Am.
Chem. Soc., 85(14):
2149-2154 (1963)). Alternatively, Fmoc (fluorenylmethoxycarbonyl) chemistry
may be
employed.
Methods known in the art can be employed to improve purity and/or yield,
including the use of
pseudoproline or other dipeptide building blocks, fragment coupling and others
(Made et al.,
Lett. Pept. Sci., 7(2):107- 112 (2000); Y.Fujiwara et al., Chem. Pharm.Bull.,
44(7):1326-1331
(1996); P. Cherkupally et al., Eur. J. Org. Chem., 6372-6378 (2013)).
Alternatively, if the CNP agonist is a polypeptide, such polypeptide may be
produced by
recombinant synthesis processes.
Fig. 1: Structure of CNP according to SEQ ID NO:l.
Examples
Materials and Methods
CNP SEQ ID No:1 was obtained from Bachem AG, Bubendorf, Switzerland (CNP-22,
human,
catalogue no. H-1296). CNP-34 SEQ ID No:40 and CNP-38 SEQ ID No:24 were
obtained from
CASLO ApS, Kongens Lyngby, Denmark.
174
NfAecue/Date Received 2023-02-08
Side chain protected CNP-38 on CTC resin having Boc protected N-terminus and
ivDde
protected side chain of Lys26 (synthesized by Fmoc-strategy) was obtained from
CASLO ApS,
Kongens Lyngby, Denmark.
Side chain protected CNP-34 on TCP Tentagel resin having Boc protected N-
terminus and
ivDde protected side chain of either Lys12, Lys16 or Lys22 (synthesized by
Fmoc-strategy)
was obtained from Peptide Specialty Laboratories GmbH, Heidelberg, Gennany.
Side chain
protected CNP-38 on TCP tentagel resin having free N-terminus (synthesized by
Fmoc-
strategy) was obtained from Peptide Specialty Laboratories GmbH, Heidelberg,
Germany.
Methoxy PEG amine 5 kDa was obtained from Rapp Polymere GmbH, Tuebingen,
Germany.
All other PEGs used in this work were acquired from NOF Europe N.Y.,
Grobbendonk,
Belgium.
Fmoc-N-Me-Asp(OtBu)-OH was obtained from Bachem AG, Bubendorf, Switzerland. S-
Trity1-6-mercaptohexanoic acid was purchased from Polypeptide, Strasbourg,
France. HATU
was obtained from Merck Biosciences GmbH, Schwalbach/Ts, Germany.
2,4-Dimethylbenzyl alcohol was obtained from abcr GmbH, Karlsruhe, Germany.
Fmoc-N-Me-Asp(OBn)-OH was obtained from Peptide International Inc.,
Louisville, KY,
USA.
Neutral Endopeptidase (NEP) was obtained from Enzo Life Sciences GmbH,
Lorrach,
Germany.
All other chemicals and reagents were purchased from Sigma Aldrich GmbH,
Taufkirchen,
Germany.
Syringes equipped with polyethylene frits (Multi SynTech GmbH, Witten,
Germany) were used
as reaction vessels or for washing steps for peptide resins.
175
NfAecue/Date Received 2023-02-08
General procedure for the removal of ivDde protecting group from side chain
protected
CNPs on resin
The resin was pre-swollen in DMF for 30 min and the solvent was discarded. The
ivDde group
was removed by incubating the resin with DMF/hydrazine hydrate 4/1 (v/v, 2.5
mL/g resin) for
8 x 15 min. For each step fresh DMF/hydrazine hydrate solution was used.
Finally, the resin
was washed with DMF (10 x), DCM (10 x) and dried in vacuo.
RP-HPLC purification
For preparative RP-HPLC a Waters 600 controller and a 2487 Dual Absorbance
Detector was
used, equipped with the following columns: Waters XBridgeTm BEH300 Prep C18 5
pm, 150
x 10 mm, flow rate 6 mL/min, or Waters XBridgeTM BEH300 Prep C18 10 pm, 150 x
30 mm,
flow rate 40 mL/min. Linear gradients of solvent system A (water containing
0.1 % T F A v/v or
0.01 % conc. HC1 v/v) and solvent system B (acetonitrile containing 0.1 % 'It
A v/v or 0.01 %
conc. HC1 v/v) were used.
HPLC fractions containing product were pooled and lyophilized if not stated
otherwise.
Flash Chromatography
Flash chromatography purifications were performed on an Isolera One system
from Biotage
AB, Sweden, using Biotage ICP-Sil silica cartridges and n-heptane and ethyl
acetate as eluents.
Products were detected at 254 nm.
Analytical methods
Analytical ultra-performance LC (UPLC)-MS was perfonned on a Waters Acquity
system
equipped with a Waters BEH300 C18 column (2.1 x 50 mm, 1.7 gm particle size,
flow: 0.25
mL/min; solvent A: water containing 0.04% TFA (v/v), solvent B: acetonitrile
containing
0.05% TFA (v/v)) coupled to a LTQ Orbitrap Discovery mass spectrometer from
Theinio
Scientific or coupled to a Waters Micromass ZQ.
Size exclusion chromatography (SEC) was performed using an Amersham Bioscience
AEKTAbasic system equipped with a Superdex 200 5/150 GL column (Amersham
Bioscience/GE Healthcare) equipped with a 0.45 gm inlet filter, if not stated
otherwise. 20 mM
sodium phosphate, 140 mM NaC1, pH 7.4, was used as mobile phase.
176
NfAecue/Date Received 2023-02-08
Due to the reversible nature of the attachment of -LI- to -D measurements for
NEP-stability and
receptor affinity were made using stable analogs of the CNP prodrugs of the
present invention,
i.e. they were made using similar structures to those of the CNP prodrugs of
the present
invention which instead of a reversible attachment of -Z to -D have a stable
attachment.
This was necessary, because the CNP prodrugs of the present invention would
release CNP in
the course of the experiment and said released CNP would have influenced the
result.
Quantification of plasma total CNP-38 concentrations
Plasma total CNP-38 concentrations (conjugated and released CNP-38) were
determined by
quantification of the N-teiininal signature peptide (sequence: LQEHPNAR) and C-
terminal
signature peptide (sequence: IGSMSGLGC) after tryptic digestion.
LC-MS analysis was carried out by using an Agilent 1290 UPLC coupled to an
Agilent 6550
iFunnel Q-TOF mass spectrometer via an ESI probe. Chromatography was performed
on a
Waters Acquity BEH300 C18 analytical column (50 x 2.1 mm I.D., 1.7 gm particle
size) with
pre-filter at a flow rate of 0.25 mL/min (T = 25 C). Water (UPLC grade)
containing 0.2 %
formic acid (v/v) was used as mobile phase A and acetonitrile (UPLC grade)
with 0.2 % formic
acid as mobile phase B. The gradient system comprised a short isocratic step
at the initial
parameters of 0.1 % B for 3.0 min followed by a linear increase from 0.1 % B
to 16 % B in 17
min. Mass analysis was performed in the single ion monitoring (SIM) mode,
monitoring the
ions m/z 482.75 [M+21-1]2+ (N-terminal) and m/z 824.36 [M+Hr (C-terminal). As
internal
standard deuterated CNP-38 peptide was used.
Calibration standards of CNP-38 conjugate in blank plasma were prepared as
follows: The
thawed Li-heparin cynomolgous plasma was first homogenized, then centrifuged
for 5 minutes.
The CNP-38 conjugate formulation was diluted to a working solution of 10 gg/mL
(conjugate
CNP-38 eq.) in DMSO and spiked into blank plasma at concentrations between 9.3
ng/100 gL
(conjugate CNP-38 eq.) and 139.5 ng/100 tiL (conjugate CNP-38 eq.). These
solutions were
used for the generation of a calibration curve. Calibration curves were
weighted 1/x2 for both
signature peptides (N- and C-Terminal). For quality control, three quality
control samples were
prepared accordingly with contents of 116.2 ng/100 gL (high QC, conjugate CNP-
38 eq.), 69.75
ng/100 j.tL (mid QC, conjugate CNP-38 eq.) and 23.25 ng /100 IA., (low QC,
conjugate CNP-
38 eq.).
177
NfAecue/Date Received 2023-02-08
For sample preparation, protein precipitation was carried out by addition of
300 jiL of pre-
cooled (0 C) methanol to 100 jiL of the plasma sample. 200 1. of the
supernatant were
transferred into a new well-plate and evaporated to dryness (under a gentle
nitrogen stream at
35 C). 100 jiL of reconstitution solvent (Thermo digestion buffer, order
number 60109-101,
Thermo Fisher Scientific GmbH, Dreieich, Germany) were used to dissolve the
residue. 20 jig
of trypsin (order number V5111, Promega GmbH, Mannheim, Germany) were
dissolved in 20
111., of 10 mM acetic acid. 2 mi of the trypsin solution were added to each
cavity.
After 4 hours incubation at 37 C (water bath), 5 jiL of a 0.5 M TCEP solution
were added to
each cavity and incubated again for 5 min at 96 C. After the samples had
cooled to room
temperature, 3 mi acetonitrile were added. The eluates were transferred into
vials. 10 pi were
injected into the UPLC-MS system.
Example 1
Synthesis of linker reagent if
Linker reagent if was synthesized according to the following scheme:
Tmob 0 0
COMU, collidine
HO
Boo'OBn
BI oc Fmoc,N'= 0 TmobFmoc,N 0
1a 1 b
0 DBU1
Boo'NOBn
0
Tmobo N o 6-(Trt-mercapto)-
hexanoic acid, COMU OBn
collidine 1d Tmob HN 0
1c
Trt
LiOH
178
NfAecue/Date Received 2023-02-08
0
0 0
BoeNN-r 0 H
B oc'N
Tmob70 N 0 Tm 13/0 N 0
0
DCC, NHS
le f
Trt
Trt'S
To a solution of N-methyl-N-Boc-ethylenediarnine (2 g, 11.48 mmol) and NaCNBH3
(819 mg,
12.63 mmol) in Me0H (20 mL) was added 2,4,6-trimethoxybenzaldehyde (2.08 g,
10.61 mmol)
portion wise. The mixture was stirred at rt for 90 min, acidified with 3 M HC1
(4 mL) and stirred
further 15 min. The reaction mixture was added to saturated NaHCO3 solution
(200 mL) and
extracted 5 x with CH2C12. The combined organic phases were dried over Na2SO4
and the
solvents were evaporated under reduced pressure. The resulting N-methyl-N-Boc-
N'-Tmob-
ethylenediamine la was dried in vacuo and used in the next reaction step
without further
purification.
Yield: 3.76 g (11.48 mmol, 89 % purity, la: double Tmob protected product =
8 :1)
MS: m/z 355.22 = [M+H], (calculated monoisotopic mass = 354.21).
To a solution of la (2 g, 5.65 mmol) in CH2C12 (24 mL) COMU (4.84 g, 11.3
mmol), N-Fmoc-
N-Me-Asp(OBn)-OH (2.08 g, 4.52 mmol) and 2,4,6-collidine (2.65 mL, 20.34 mmol)
were
added. The reaction mixture was stirred for 3 h at rt, diluted with CH2C12
(250 mL) and washed
3 x with 0.1 M H2SO4 (100 mL) and 3 x with brine (100 mL). The aqueous phases
were re-
extracted with CH2C12 (100 mL). The combined organic phases were dried over
Na2SO4,
filtrated and the residue concentrated to a volume of 24 mL. lb was purified
using flash
chromatography.
Yield: 5.31 g (148 %, 6.66 mmol)
MS: m/z 796.38 = [M+Hr, (calculated monoisotopic mass = 795.37).
To a solution of lb (5.31 g, max. 4.52 mmol ref. to N-Fmoc-N-Me-Asp(OBn)-0H)
in THF (60
mL) DBU (1.8 mL, 3 % v/v) was added. The solution was stirred for 12 min at
rt, diluted with
CH2C12 (400 mL) and washed 3 x with 0.1 M H2SO4 (150 mL) and 3 x with brine
(150 mL).
The aqueous phases were re-extracted with CH2C12 (100 mL). The combined
organic phases
were dried over Na2SO4 and filtrated. lc was isolated upon evaporation of the
solvent and used
in the next reaction without further purification.
179
NfAecue/Date Received 2023-02-08
MS: m/z 574.31 = [M+Hr, (calculated monoisotopic mass = 573.30).
lc (5.31 g, 4.52 mmol, crude) was dissolved in acetonitrile (26 mL) and COMU
(3.87 g, 9.04
mmol), 6-tritylmercaptohexanoic acid (2.12 g, 5.42 mmol) and 2,4,6-collidine
(2.35 mL, 18.08
mmol) were added. The reaction mixture was stirred for 4 h at rt, diluted with
CH2C12 (400 mL)
and washed 3 x with 0.1 M H2SO4 (100 mL) and 3 x with brine (100 mL). The
aqueous phases
were re-extracted with CH2C12 (100 mL). The combined organic phases were dried
over
Na2SO4, filtrated and id was isolated upon evaporation of the solvent. Product
id was purified
using flash chromatography.
Yield: 2.63 g (62 %, 94 % purity)
MS: m/z 856.41 = [M+H1+, (calculated monoisotopic mass = 855.41).
To a solution of Id (2.63 g, 2.78 mmol) in i-PrOH (33 mL) and H20 (11 mL) was
added LiOH
(267 mg, 11.12 mmol) and the reaction mixture was stirred for 70 min at it The
mixture was
diluted with CH2C12 (200 mL) and washed 3 x with 0.1 M H2SO4 (50 mL) and 3 x
with brine
(50 mL). The aqueous phases were re-extracted with CH2C12 (100 mL). The
combined organic
phases were dried over Na2SO4, filtrated and le was isolated upon evaporation
of the solvent.
le was purified using flash chromatography.
Yield: 2.1 g (88 %)
MS: m/z 878.4 = [M+Nar, (calculated monoisotopic mass = 855.40).
To a solution of le (170 mg, 0.198 mmol) in anhydrous DCM (4 mL) were added
DCC
(123 mg, 0.59 mmol), and a catalytic amount of DMAP. After 5 mm N-hydroxy-
succinimide
(114 mg, 0.99 mmol) was added and the reaction mixture was stirred at rt for 1
h. The reaction
mixture was filtered, the solvent was removed in vacuo and the residue was
taken up in 90 %
acetonitrile plus 0.1 % '11-A (3.4 mL). The crude mixture was purified by RP-
HPLC. Product
fractions were neutralized with 0.5 M pH 7.4 phosphate buffer and
concentrated. The remaining
aqueous phase was extracted with DCM and if was isolated upon evaporation of
the solvent.
Yield: 154 mg (81%)
MS: m/z 953.4 = [M+Hr, (calculated monoisotopic mass = 952.43).
Example 2
Synthesis of NEK4/EKIO_CNP mono-linker thiol 2, NEK4-CNP mono-linker thiol 2c
and NEKm-
CNP mono-linker thiol 2d
180
NfAecue/Date Received 2023-02-08
0
H N NEK4/1lo_c Np
H
NM e0
2
H S
N4'0-CNP mono-linker thiol (mixture of regioisomers with linker conjugated at
side chain
amino group of Lys4 or Lys10) 2 is prepared by dissolving CNP-22 (5.2 mop in
0.6 mL
DMSO. 0.15 mL 0.375 M borate buffer, adjusted to pH 8.5 with tetrabutyl-
ammoniumhydroxide hydrate, 60 [IL DIPEA and lf (6.1 mg, 7.1 mop in 0.34 mL of
DMSO
are added and the mixture is stirred for 30 mm at rt. Reaction mixture is
diluted with 2 mL
acetonitrile/ water 1/1 (v/v) and 200 111, AcOH and the protected Nalc4sK10-
CNP mono-linker
conjugate is isolated from the reaction mixture by RP-HPLC.
Optimized RP-HPLC gradients can be used for isolation of Nc"-CNP mono-linker
thiol 2a and
N' -CNP mono-linker thiol 2b.
Removal of protecting groups is affected by treatment of lyophilized product
fractions with
0.6 mL of 90/10/2/2 (v/v/v/v) HFIP/TFA/TES/water for lh at rt. The deprotected
N4' -CNP
mono-linker thiol 2 is purified by RP-HPLC. Identity and purity of the product
is determined
by ESI-LCMS.
Deprotected N4-CNP mono-linker thiol 2c and N -CNP mono-linker thiol 2d can be
obtained likewise from 2a and 2b, respectively.
Example 3
Synthesis of N1-CNP mono-linker thiol 3
181
NfAecue/Date Received 2023-02-08
0
HNN)(z7.y NaDip
H '
NMe0
3
HS
NaGl-CNP mono-linker thiol 3 is prepared by dissolving CNP-22 (5.2 mop in 0.6
mL DMSO.
0.25 mL 0.5 M phosphate buffer pH 7.4 and lf (6.1 mg, 7.1 Limo!) in 0.34 mL of
DMSO are
added and the mixture is stirred for several hours at rt. Reaction mixture is
diluted with 2 mL
acetonitrile/ water 1/1 (v/v) and 200 pt AcOH and the protected N'-CNP mono-
linker thiol
is isolated from the reaction mixture by RP-HPLC.
Removal of protecting groups is affected by treatment of lyophilized product
fractions with
0.6 mL of 90/10/2/2 (v/v/v/v) HFIPM-A/TES/water for lh at rt. The deprotected
N'-CNP
mono-linker thiol 3 is purified by RP-HPLC. Identity and purity of the product
is determined
by ESI-LCMS.
Example 4
PEGylation of CNP mono-linker thiols 2c, 2d and 3
0 0
H N NtL1NEKa_c Np HN NEtoo_cNp
H ' H
o7NMeo oNMeo
4 5
Cl 0
PEG s PEG S
0
182
NfAecue/Date Received 2023-02-08
H NI 0
N" 1-CNP
H
NM e0
6
O
PEG ¨NiN S
0
1 mol CNP mono-linker thiol 2c is dissolved in 0.5 mL acetonitrile / 0.2 M
succinate buffer
pH 3.8 1/1 (v/v) 1.2 mot of linear 40 kDa PEG-maleimide is added and the
mixture is stirred
at rt. The reaction is quenched by addition of 20 pt AcOH and CNP conjugate 4
is purified by
preparative RP-HPLC.
CNP conjugates 5 and 6 are prepared likewise from 1 pmol CNP mono-linker
thiols 2d and 3.
CNP content is determined by quantitative amino acid analysis after total
hydrolysis under
acidic conditions.
Example 5
Release kinetics in vitro
CNP conjugates 4, 5 and 6 are dissolved in 60 mM sodium phosphate, 3 mM EDTA,
0.01%
Tween-20, pH 7.4 at a concentration of approximately 2 mg/mL and filtered
sterile. Mixtures
are incubated at 37 C. At time points aliquots are withdrawn and analysed by
RP-HPLC and
ESI-MS. UV-signals correlating to liberated CNP are integrated and plotted
against incubation
time.
Curve-fitting software is applied to estimate the corresponding halftime of
release.
Example 6
Pharmacokinetics and cGMP production in rats
Equimolar doses of CNP-22, CNP conjugates 4, 5 or 6 are injected iv and sc in
normal rats.
Plasma CNP and cGMP levels over time are determined as described in the
literature (US patent
8,377,884 B2).
183
NfAecue/Date Received 2023-02-08
Example 7
Synthesis of Dmb protected 6-mercaptohexanoic acid 7
Compound 7 was synthesized according to the following scheme:
HO 1) TFA
0 2) LiOH aq. / THF 0
S H -I- _________________ N.
HO S-Drrib
HO
7
To a solution of 6-mercaptohexanoic acid (7.10 g, 47.90 mmol) in
trifluoroacetic acid (20 mL),
2,4-dimethylbenzyl alcohol (13.5 g, 95.80 mmol) was added. The mixture was
stirred at rt for
60 min and then the trifluoroacetic acid was removed in vacuo. The residue was
dissolved in a
mixture of 95.8 mL LiOH (3 M) and THF (81 mL) and stirred at rt for 60 min.
The solvent was
removed in vacuo and the aqueous residue was extracted 3x with Et0Ac (200 mL).
The
combined organic phases were dried over MgSO4, and the solvent was removed in
vacuo. 7
was purified by RP-HPLC.
Yield: 2.27 g (8.52 mmol, 18 %)
MS: m/z 267.01 = [M+Hr, (calculated monoisotopic mass = 266.13).
Example 8
Synthesis of linker reagent 8c
Linker reagent 8c was synthesized according to the following scheme:
I 0 0
LiOH I
Boc-i\iN )'lf0Bn
Tmob ,N 0 isopropanol Tmob HN 0
Fmoc
lb 8b
7J3)(130P/DIPEA
/
THF
I 0
Boc'N'--NOH
Tmol c)
0
/
Dmb
'S
8c
To a solution of lb (21.6 g, 27.18 mmol) in isopropanol (401 mL) were added
water (130 mL)
and LiOH (3.90 g, 163.06 mmol). The reaction mixture was stirred for 3 h at
rt, then it was
184
NfAecue/Date Received 2023-02-08
diluted with toluene (300 mL) and washed 3 x with 0.1 M HC1 (200 mL). The
combined
aqueous phases were washed 3 x with toluene (100 mL). The aqueous phase was
basified with
4 M NaOH (4 mL) to a pH of 8.5 and extracted 8 x with CH2C12 (200 mL). The
combined
CH2C12 phases were washed with brine (50 mL), dried over Na2SO4. 8b was
isolated upon
evaporation of the solvent and used in the next reaction without further
purification.
Yield: 11.89 g (24.59 mmol, 90 %)
MS: m/z 484.16 = [M+Hr, (calculated monoisotopic mass = 483.26).
To a solution of 7 (293 mg, 1.10 mmol) and PyBOP (572 mg, 1.10 mmol) in THF
(10 mL) was
added DIEA (0.52 mL, 3.00 mmol) under a N2-atmosphere. The reaction mixture
was stirred
for 60 min at rt. A solution of 8b (484 mg, 1.00 mmol) in THF (2 mL) was added
and the
reaction was stirred for a further 60 min. The reaction was quenched with 2 M
citric acid
solution (10 mL) and the THF was removed in vacuo. The resulting aqueous phase
was then
extracted 2 x with Et0Ac (15 mL) and the combined organic layers were washed
with water
(10 mL) and brine (10 mL), and dried over MgSO4. The solvent was removed in
vacuo and 8c
was purified by RP HPLC.
Yield: 330 mg (0.451 mmol, 45 %)
MS: miz 732.34 = [M+Hr, (calculated monoisotopic mass = 731.38).
Example 9
Synthesis of linker reagent 9
Linker reagent 9 was synthesized according to the following scheme:
0 Fmoc-CI / Na2CO3 aq' 0
Bob' OH dioxane
_______________________________________ 311 b c
Tmob HN o Tmob N
Fmoc-
8b
9
To a solution of 8b (2.00 g, 4.14 mmol) and Fmoc-Cl (1.07 g, 4.14 mmol) in
dioxane (20 mL)
was added 1 M Na2CO3 solution (20 mL). The reaction mixture was stirred for 40
min at rt.
Water (100 mL) and diethyl ether (100 mL) were added and the aqueous phase was
extracted 2
x with diethyl ether (100 mL). The aqueous phase was acidified with conc. HC1
until pH 1 and
again extracted 3 x with diethyl ether. The combined organic phases were dried
over Na2SO4
and the solvent was removed in vacuo. 9 was used in the next step without
further purification.
Yield: 2.63 g (3.73 mmol, 90 %)
MS: m/z 728.32 = [M+Na], (calculated monoisotopic mass = 705.33).
185
W ecWecue/Date Received 2023-02-08
Example 10
Synthesis of reversible Lys26 CNP-38 PEG2x20 kDa conjugate 10f
Conjugate 10f was synthesized according to the following scheme:
N H 2 0 8c, PyBOP, DIEA
H 1 I DMF
N¨I CNP o¨ resin >
Boc I I -
STrt STrt
10a
0
Tmob S" TFA, DTT, thioanisole, phenol,
Dmb
\Nyk water, TIPS
Boc (68.5/10/10/5/3.5/1)
'N
I 0 0.,.NH ____________________________ 1.
H 1 1 0
,NI CNP 0_[. resin
Boc I I
10b STrt STrt
0
H
N 2,2'-Dithiobis(pyridine-N-oxide)
rµI')--.
H _________________________________________________________ A..
0 0N H
1 0
I
10c H2N¨ CNP OH
I I
S H S H
0
S'Dmb N
H
NNI'l-rC
H 0 0NH
I 0
H2N-1 CNP (DH
10d
I I
S ___________________ S
186
NfAecue/Date Received 2023-02-08
0
'Dmb
TFA, MSA, DU, water, thioanisole
(100/5/3/2/1)
0 0NH
0
H2N¨F CNP OH/
I I
10d S __ S
0
S H
PEG2x20kDa-
N
maleimide
0 NH
0
H2N CNP
I I
10e S __ S
0
s'PEG2x20kDa
0 0NH
0
H2N-1 CNP OH
I 1
10f S ___ S
2.00 g (0.21 mmol) of side chain protected CNP-38 on CTC resin having Boc
protected N-
terminus and ivDde protected side chain of Lys26 was ivDde deprotectal
according to the
procedure given in Materials and Methods to obtain 10a. A solution of linker
reagent 8c (336
mg, 0.46 mmol), PyBOP (239 mg, 0.46 mmol) and DIEA (182 L, 1.04 mmol) in DMF
(5 mL)
was incubated for 10 min at rt, then added to the resin 10a. The suspension
was shaken for 2 h
at rt. The resin was washed 10 x with DMF (10 mL) and 10 x with DCM (10 mL)
and dried in
vacuo for 15 min. Cleavage of the peptide from resin and removal of protecting
groups was
achieved by treatment of the resin with 15 mL pre-cooled (-18 C) cleavage
cocktail
68.5/10/10/5/3.5/1 (v/w/v/v/v/v) TFA/DTT/thioanisole/phenoVwater/TIPS. The
mixture was
allowed to warm to rt and was agitated for 60 min. The resin was filtered off
and crude 10c was
187
NfAecue/Date Received 2023-02-08
precipitated in pre-cooled diethyl ether (-18 C). The precipitate was
dissolved in ACN/water
and purified by RP-HPLC. The combined HPLC fractions were used directly in the
next step.
MS: m/z 1124.60 = [M+41-114+, (calculated monoisotopic mass for
[M+41-114+ =
1124.59).
To the combined HPLC fractions of 10c (250 mL) 40 mL of 0.5 M citric acid
buffer (pH =
5.00) and 7 mL of a 0.01 M solution of 2,2'-dithiobis(pyridine-N-oxide)
solution in 1/1 (v/v)
acetonitrile/water were added. After incubation for 5 min at rt the reaction
was complete. The
mixture was diluted with 500 mL water containing 0.1 % '11-A (v/v) and
acidified with AcOH
(20 mL) to a pH of approx. 2. 10d was purified by RP-HPLC.
Yield: 101 mg (17.3 mol, 9 % ) CNP-38-linker-Dmb * 10 TFA
MS: m/z 1124.10 = [M-F4H]4+, (calculated monoisotopic mass for
[M+4Hr =
1124.09).
Cleavage of the Dmb protecting group was achieved by adding 30 mL pre-cooled (-
18 C)
cleavage cocktail 100/5/3/2/1 (v/v/w/v/v) TFA/MSA/DTT/water/thioanisole to 10d
(101 mg,
17.3 mop and stirring for 3 h at 0 C. Crude 10e was precipitated in pre-
cooled (-18 C) diethyl
ether. The precipitate was dissolved in water containing 0.1 % TFA (v/v) and
incubated for 10
min in order to hydrolyze any TFA esters. 10e was purified by RP-HPLC. Product
fractions
were combined and freeze dried.
Yield: 46 mg (8.34 mot, 48 %) CNP-38-linker-thiol * 10 TFA
MS: m/z 1094.58 = [M+41-114+, (calculated monoisotopic mass for
[M+41-114+ =
1094.57).
To a solution of 10e (46 mg, 8.43 mop in 1.15 mL water containing 0.1 % TFA
(v/v) was
added a solution of PEG 2x20 kDa maleimide (Sunbright GL2-400MA, 870 mg, 21.75
mol)
in 4.35 mL water containing 0.1 % a A (v/v), followed by 0.5 M lactic acid
buffer (1.07 mL,
pH = 4.20). The mixture was stirred at rt for 4 h. Conjugate 10f was purified
by RP-HPLC.
Yield: 233 mg (5.21 mot, 62 %) conjugate 10f* 10 HC1
Example 11
Synthesis of reversible Lys26 CNP-38 PEG4x10 kDa conjugate conjugate lli
Conjugate 111 was synthesized according to the following scheme:
188
NfAecue/Date Received 2023-02-08
NH 2 0
I
H N¨ CNP Ao¨ resin 9, PyBOP, DIEA, DMF
._õ..
Boc I I , _
STrt STrt
10a
Tmob --,N-
Fmoc
\
Boc
1. Piperazine, HOBt, DMF
'N-'-.NYC- 2. Fmoc-Lys(Fmoc)-0H,
I 0 0...--,õ NH COMU, DIEA, DMF
I 0 __________________________ a
H
N¨ CNP ).0¨[ resin '
Boc I I
STrt STrt
ha
o
H
1. Piperazine, HOBt, DMF
BocN \NI HNFmoc õ
- 2. 7, PyBOP, DIEA DMF
I
0 0-.,NH ______________________________________________ a
I 0
H
N¨ CNP )L04. resin '
ilc Boc I I
STrt STrt
0y\/\/ s-Drnb
o
Tmob =NA)..s`N H
\
Boc,N,,,_,,NHNyws,Dmb
I 0 0NEF)
0
I
H ____________________ ,
N¨ CNP A04 resin
lie Boc' I I -
STrt STrt
TFA, DTT, thioanisole, phenol, water, TIPS
(68.5/10/10/5/3.5/1)
lie _____________________________________________________ b
o 05,Dmb
H i.,,,,õõ.õ,....-.N H
HNNHN.yws,Dmb 2,2-Dithiobis(pyridine-N-oxide)
I a
0 0N FP
I 0
H 2N ¨ CNP /1.L 0 H
lit
I I
SH SH
189
Nf
e21ecue/Date Received 2023-02-08
o 0 Dmb
H
D mb TFA, MSA, DTT, water, thioanisole
(100/5/3/2/1)
0 c)..,N
0
11g H2N¨ CNP )OH
I I
S¨S
H
H
PEG2x10kDa-
HNNycHNywSH maleimide
1
0
tin H2N¨ CNP )01-1
I I
S¨S
0 PEG2x10kDa
0
H N H
H N PEG2x10k Da
0 cyp,N4)
1 0
11i H2N¨ CNP
I I
S¨S
To a solution of 9 (353 mg, 0.50 mmol) and PyBOP (260 mg, 0.50 mmol) in DMF (9
mL) was
added DIEA (105 LiL, 0.60 mmol).This mixture was drawn onto Lys26-side-chain
deprotected
CNP-38 resin 10a (2.00 g, 0.21 mmol) and the suspension was shaken for 2 h at
rt in order to
afford resin ha. The resin was washed 10 x with DMF (7 mL). Cleavage of the
Fmoc protecting
group in ha was carried out with a solution of HOBt (0.68 g, 5.03 mmol) and
piperazine (3.00
g, 34.83 mmol) in DMF (47 mL). Therefore, the resin was incubated 5 x with 10
mL of the
cleavage mixture for 15 min at rt each time. Then, the resin was washed 7 x
with DMF (7 mL).
A solution of Fmoc-Lys(Fmoc)-OH (449 mg, 0.76 mmol), COMU (325 mg, 0.76 mmol)
and
DIEA (165 pL, 0.95 mmol) in DMF (9 mL) was prepared and drawn onto the resin.
The mixture
was shaken for 2 h at rt. The procedure was repeated twice, each for 1 h with
freshly prepared
coupling mixture. The resin was washed 10 x with DMF (7 mL) and the remaining
free amino
groups were capped with 8 mL 1/1/2 (v/v/v) Ac20/pyridine/DMF.
190
NfAecue/Date Received 2023-02-08
Cleavage of the Fmoc protecting groups in 11c was carried out with a solution
of HOBt (0.68
g, 5.03 mmol), piperazine (3.00 g, 34.83 mmol) in DMF (47 mL). Therefore, the
resin was
incubated 5 x with 10 mL of the cleavage mixture for 15 min at rt each time.
The resin was
washed 7 x with DMF (7 mL)
To a solution of 7 (266 mg, 1.00 mmol) and PyBOP (520 mg, 1.00 mmol) in DMF (9
mL) was
added DIEA (209 L, 1.20 mmol). This mixture was drawn onto the resin and was
shaken for
2 h at rt. The resin was washed 7 x with DMF (7 mL) affording resin lie.
Cleavage of the
peptide from resin and removal of protecting groups was achieved by treatment
of the resin
with 15 mL pre-cooled (-18 C) cleavage cocktail 68.5/10/10/5/3.5/1
(v/w/v/v/v/v)
TFA/DTT/thioanisole/phenol/water/TIPS. The mixture was allowed to warm to rt
and was
agitated for 3 h at rt. The resin was filtered off and crude llf was
precipitated in pre-cooled (-
18 C) diethyl ether and purified by RP-HPLC. The combined HPLC fractions were
used
directly in the next step.
MS: m/z 1218.66 = [M+41114+, (calculated monoisotopic mass for [M+41-114
=
1218.65).
To the combined HPLC product fractions of llf (1 L) 160 mL of 0.5 M citric
acid buffer (pH
= 5.00) and 100 mL of a 50 mM 2,2'-dithiobis(pyridine-N-oxide) solution in 9/1
(v/v)
acetonitrile/water were added. The mixture was stirred for 4 h at rt and then
diluted with 1 L of
water containing 0.1 % TFA (v/v). hg was purified by RP-HPLC. Product
fractions were
combined and freeze dried.
Yield: 64.3 mg (10.7 mol, 6 % ) CNP-38-linker-DMB * 10 TFA
MS: m/z 1218.15 = [M+41114+, (calculated monoisotopic mass for
[M+41114+ =
1218.14).
Cleavage of the Dmb protecting group was achieved by adding 45 mi. of pre-
cooled (-18 C)
cleavage cocktail 100/5/3/2/1 (v/v/w/v/v)11-A/MSA/DTT/water/thioanisole to hg
(61.8 mg,
10.3 mop, and then stiffing for 4 h at 0 C. Crude llh was precipitated in
pre-cooled (-18 C)
ether. The precipitate was dissolved in a solution of 1/1 (v/v)
acetonitrile/water containing 0.1
% '11-A (v/v) and incubated for 4 h at rt in order to hydrolyze any TFA
esters. 11h was purified
by RP-HPLC.
Yield: 38.4 mg (6.65 mol, 65 %) CNP-38-linker-thiol * 10 TFA
191
NfAecue/Date Received 2023-02-08
MS: m/z 1159.11 = [M+411]4+, (calculated monoisotopic mass for
[M+411]4+ =
1159.10).
To a solution of 11h (34.6 mg, 5.99 pmol) in 1 mL water containing 0.1 % TFA
(v/v) was
added a solution of PEG 2x10 kDa maleimide (Sunbright GL2-200MA, 1.12 g, 56.03
mop in
6.1 mL water containing 0.1 % __ (v/v), followed by 0.5 M lactic acid buffer
(1.46 mL, pH
= 4.00). The mixture was stirred at rt for 4 h. Conjugate lli was purified by
RP-HPLC.
Yield: 227 mg (4.96 mol, 83 %) conjugate lli * 10 HC1
Example 12
Synthesis of permanent Lys26 CNP-38 PEG4x10 kDa conjugate 12g
Conjugate 12g was synthesized according to the following scheme:
N H 2 0
Fmoc-Lys(Fmoc)-0H,
CNP resin
PyBOP, DIEA, DMF
)c:1¨
Boc I
STrt STrt
10a
Fmoc
1. HOBt, piperazine, DMF
HFmoc 2. 7, PyBOP, DIEA, DMF
H
11 CNP (20¨[ resin
Boc' I
STrt STrt
12a
SDm b
"
0) s-Dmb TFA DTT' thioanisole phenol,
water, TIPS (68.5/10/10/5/3.5/1)
H
0 H
0
H _________________
N¨[ CNP )(04 resin
Boc I
STrt STrt
12c
192
NfAecue/Date Received 2023-02-08
SDmb
'
s,Dmb
H
0
H
1 0
H 2N ¨[ CNP H
1 1
SH SH
12d
Dmb
S'
S'Dmb
y)
0 N H 0
0 2, 2'-Dithiobis(pyridine-N-oxide)
H2N¨I CNP
12d I I
SH SH
S'Dmb
s ,Dm b
H TFA, MSA, DTT, water, thioanisole
(100/5/3/2/1)
0NH 0
0
12eH2N CNP -"AO H
I I
0NH
S __________ S
S H
S H
H NH PEG2x10kDa-
maleimide
0
0
H2N ¨ CNP 0H
1 1
12f S __ S
193
NfAecue/Date Received 2023-02-08
s" PEG2x 10kDa
PEG2x10kHNNJ
Da
H
N H 0
0
H2N ¨ CNP OH
12g I I
S ________________ S
To a solution of Fmoc-Lys(Fmoc)-OH (365 mg, 0.62 mmol) and PyBOP (322 mg, 0.62
mmol)
in DMF (4.6 mL) was added DIEA (0.11 mL, 0.62 mmol).The mixture was drawn onto
resin
10a (2.0 g, 0.21 mmol). The suspension was shaken for 2 h at rt. The resin was
washed 10 x
with DMF (7 mL). Cleavage of the Fmoc protecting groups in 12a was carried out
with a
solution of HOBt (1.35 g, 9.99 mmol), piperazine (6.00 g, 69.66 mmol) in DMF
(94 mL).
Therefore, the resin was incubated 5 x with the cleavage mixture for 15 min at
rt each time,
affording resin 12b. Then the resin was washed 7 x with DMF (7 mL).
To a solution of 7 (283 mg, 1.06 mmol) and PyBOP (552 mg, 1.06 mmol) in DMF
(6.5 mL),
DIEA (185 RL, 1.06 mmol) was added and the mixture was drawn onto resin 12b
(2.07 g,
0.10 mmol/g, 0.21 mmol). The mixture was shaken for 2 h at rt. Then, the resin
was washed 10
x each with DMF (7 mL) and CH2C12 (7 mL) and dried in vacua.
Cleavage of the peptide from resin and removal of protecting groups was
achieved by treatment
of the resin with 15 mL pre-cooled (-18 C) cleavage cocktail
68.5/10/10/5/3.5/1 (v/w/v/v/v/v)
II-A/DTT/thioanisole/phenol/water/TIPS. The mixture was allowed to warm to rt
and was
agitated for 2.5 h. The resin was filtered off and crude 12d was precipitated
in pre-cooled
diethyl ether (-18 C) and purified by RP-HPLC. The combined HPLC fractions
were used
directly in the next step.
MS: m/z 1172.37 = [M+41-114+, (calculated monoisotopic mass for
[M+41-114+ =
1172.37).
To the combined HPLC product fractions of 12d (390 mL) 58.5 mL of 0.5 M citric
acid buffer
(pH = 5.00) and 8.9 mL of a 10 mM 2,2'-dithiobis(pyiidine-N-oxide) solution in
1/1 (v/v)
acetonitrile/water were added. The mixture was stirred for 10 min at rt then
diluted with 400
mL of water containing 0.1 % '11-A (v/v). 12e was purified by RP-HPLC.
Yield: 100 mg (17.5 mot, 8 % over 6 steps) CNP-38-linker-Dmb * 9 TFA
194
WAecue/Date Received 2023-02-08
MS: m/z 1171.87 = [M-F4H]4+, (calculated monoisotopic mass for [M-
F4H]4+ =
1171.86).
Cleavage of the Dmb protecting group was achieved by adding 65 mL pre-cooled (-
18 C)
cleavage cocktail 100/5/3/2/1 (v/v/w/v/v) TFA/MSA/DTT/water/thioanisole to 12e
(100 mg,
17.5 mop and stirring for 3.5 h at 0 C. Crude 12f was precipitated in pre-
cooled (- 18 C)
diethyl ether. The precipitate was dissolved in water containing 0.1 % TFA
(v/v) and incubated
for 2 h at rt in order to hydrolyze any TFA esters. 12f was purified by RP-
HPLC.
Yield: 43.4 mg (7.92 gmol, 45 %) CNP-38-linker-thiol * 911A
MS: in/z 1112.83 = [M+41-114+, (calculated monoisotopic mass for [M+41-114+
=
1112.82).
To a solution of 12f (39.6 mg, 7.22 timol) in 1 mL water containing 0.1 % TFA
(v/v) was added
a solution of PEG 2x10 kDa maleimide (Sunbright GL2-200MA, 1.22 g, 59.94 mop
in 6.16
mL water containing 0.1 % '11A (v/v), followed by 0.5 M lactic acid buffer
(1.41 mL, pH =
4.20). The mixture was stirred at rt for 4 h. Conjugate 12g was purified by RP-
HPLC.
Yield: 204 mg (4.48 p.mol, 57 %) conjugate 12g * 9 HC1
Example 13
Synthesis of PEG5kDa thiol 13c
PEG5kDa thiol 13c was synthesized according to the following scheme:
1. HOBt, collidine,
EDC hydrochloride,
DCM
0
PEG 5kDa ¨N H 2 + S
HO 'Trt 2. TFA, TES, DCM
13a 13b
0
PEG 5kDa.,õ H
13c
To a solution of 13b (58.6 mg, 0.15 mmol), HOBt (22.9 mg, 0.15 mmol) and EDC
hydrochloride (28.8 mg, 0.15 mmol) in DCM (1.00 mL) 2,4,6-collidine (121 mg,
1.00 mmol)
was added. Then, a solution of methoxy PEG amine 5 kDa 13a (500 mg, 0.10 mmol)
in DCM
(4.00 mL) was added and the mixture was stirred for 16 h at rt. The solvent
was evaporated and
195
NfAecue/Date Received 2023-02-08
the mixture was dissolved in ACN/water and purified by RP-HPLC. The amount of
solvent was
reduced in vacuo and the aqueous residue was extracted with DCM (1 x 100 mL, 2
x 50 mL).
The combined organic layers were reduced in vacua to 20 mL. 11A (1.6 mL) and
TES (3.5
mL) were added and the mixture was stirred at rt for 4.5 h. 13c was
precipitated in diethyl ether,
stored over night at - 20 C, filtered and dried in vacuo.
Yield: 372 mg (72 iimol, 72 %)
Example 14
Synthesis of permanent N-terminal CNP-34 PEG 5 kDa conjugate 14e
Conjugate 14e was synthesized according to the following scheme:
0 maleimido hexanoic acid
0 DIC/Oxyma
- CNP-34 AO- resin DMF
I.
El*" STrt SIVImt
14a
a ______
0 1. TFA/TES/water/thioanisole
0 _____________________ - (100/3/2/1)
______________________ CNP-34
11.13 STrt SIVImt
/ A04 resin
___________________________________________________________ r
2. Diphenylsulphoxide,
anisole, TFA,
0 N CI3SiMe' NH4F
-.,-- ,
....z.j. =0
14b
o
o ________________________________________ 0 PEG 5kDa thiol 13c
0
_____________________ CNP-34 A OH
N $4.
',----N/
.......,.....0
0
14d 0 0
N,.. __________________________________ ?s NP-3: )OH
/14
0..,N
/...._..0
14e
Hs...c..../_,....7¨S
N
/
PEG 5kDa 0
Side chain protected CNP-34 on TCP tentagel resin having free N-terminus 14a
(0.78 g, 70
mop was pre-swollen in DMF for 30 min. A solution of maleimido hexanoic acid
(85.3 mg,
196
NfAecue/Date Received 2023-02-08
0.40 mmol), DIC (50.9 mg, 0.40 mmol) and Oxyma (57.4 mL, 0.40 mmol) in DMF (6
mL) was
drawn onto the resin and the mixture was shaken for 30 min at rt. The coupling
then was
repeated once with freshly prepared coupling solution. The resin was washed 10
x each with
DMF and CH2C12 and dried in vacuo affording 14b.
Cleavage of the peptide from resin and removal of protecting groups was
achieved by treatment
of the resin with 6 mL cleavage cocktail 100/3/2/1 (v/v/v/v)
TFA/TES/water/thioanisole for
1.5 h at rt. The crude peptide was precipitated in pre-cooled (-18 C) diethyl
ether.
MS: m/z 937.77 = [M+4Hr, (calculated monoisotopic mass for [M+411]4+ =
937.74).
The precipitate was dissolved in 15 mL 11-A. A solution of diphenylsulfoxide
(68.06 mg, 0.34
mmol) and anisole (0.18 mL, 1.68 mmol) in 5 mL TFA was added.
Trichloromethylsilane (0.47
mL, 4.17 mmol) was added and the mixture was stirred for 15 min at rt.
Ammonium fluoride
(0.38 g, 10.3 mmol) was added and the solution was agitated for a further 2
min. The crude
material was precipitated in pre-cooled (-18 C) diethyl ether and purified by
RP-HPLC
affording 14d.
Yield: 8.30 mg (1.78 gnol, 82 % purity, 1.4 % over 3 steps) CNP-34-
Malhx * 8 TI-A
MS: m/z 937.26 = [M+41-1]4+, (calculated monoisotopic mass for
[M+41114 =
937.23).
To a solution of 14d (7.34 mg, 1.57 mop in 200 tiL 1/1 (v/v)
acetonitrile/water containing 0.1
% 11-A (v/v) was added a solution of 13c (20 mg, 3.90 mop in 200 !IL water
containing 0.1
% '11-A (v/v), followed by 200 pt 0.5 M acetate buffer (pH = 5.00). The
mixture was incubated
at rt for 30 min. Conjugate 14e was purified by RP-HPLC.
Yield: 9.92 mg (1.01 pinol, 57 %) conjugate 14e * 8 IF A
Example 15
Synthesis of permanent N-terminal CNP-38 PEG 5kDa conjugate 15e
Conjugate 15e was synthesized according to the following scheme:
0
H2N¨ CNP-38 )==0¨[ resin
I I
sTrt SMmt
15a
197
NfAecue/Date Received 2023-02-08
o 0 PEG 5kDa thiol 13c
N¨f CNP-38 ACM
/ _______
H
I ______________________ I
S S Ii.
0 N
0
15d
0 _________________________________________________ 0
N¨I CNP-38 OH
/
H I I
S¨S
0 N
T......../0
N
/
PEG 5kDa 0
15e
Compound 15d was synthesized as described for 14d, except that side chain
protected CNP-38
on TCP tentagel resin having free N-terminus 15a (1.34 g, 0.12 mmol) was used
as starting
material.
Yield: 15.6 mg (2.94 mol, 6.6 %) CNP-38-Malhx * 9 '11-A
MS: m/z 1064.05 = [M+41-114+, (calculated monoisotopic mass for
[M+41-114+ =
1064.04).
Conjugate 15e was synthesized as described for 14e, except that 15d (8.34 g,
1.58 mmol) was
used as starting material.
Yield: 9.47 mg (0.91 mol, 31 %) conjugate 15e * 9 '11-A
Example 16
Synthesis of permanent Lys12 CNP-34 PEG 5 kDa conjugate 16e
Conjugate 16e was synthesized according to the following scheme:
NH 2
1 0
H 1 _______________________________ .
,N11 CNP-34 c)¨[. resin
Boc I I _______________ -
__________________________________________________ ,
STrt SMmt VP
16a
198
NfAecue/Date Received 2023-02-08
0
H
0
H2N CNP-34 -)o¨ resin PEG 5 kDa thiol 13c
_________________________________________________ r
I I
S __ S
16d
0
N¨ PEG 5kDa
0
H NJOLf=X¨S
0
0
H2N CNP-34 )'(:)-- resin
1 1
s¨S
16e
1.00 g (0.10 mmol) of side chain protected CNP-34 on TCP tentagel resin having
Boc protected
N-terminus and ivDde protected side chain of Lys12 was ivDde deprotected
according to the
procedure given in Materials and Methods to obtain 16a.
Compound 16d was synthesized as described for 14d, except that resin 16a (1.00
g, 0.10 mmol)
was used as starting material.
Yield: 17.0 mg (3.65 mol, 3.7 %) CNP-34-Lys12-Malhx * 8 '1} A
MS: m/z 937.25 = [M+41-1]4+, (calculated monoisotopic mass for [M+41-1]4+ =
937.23).
Conjugate 16e was synthesized as described for 14e, except that 16d (17 mg,
3.65 mop was
used as starting material.
Yield: 12.2 mg (1.25 mol, 34 %) conjugate 16e * 8 TFA
Example 17
Synthesis of permanent Lys16 CNP-34 PEG 5 kDa conjugate 17e
Conjugate 17e was synthesized according to the following scheme:
199
NfAecue/Date Received 2023-02-08
0 N H2 0
1
Boc
_____________ CNP-34 )-Lo¨L resin - ___________ 3...
13
=Ni.. I I _______________ - a.
STrt SMmt
17a
0
\
0
HN)L, PEG 5 kDa thiol 13c
o
o b.
1
H... ________ CI NIP-314 o¨[. resin .1
tis _______________ S
17d
0
0
N¨ PEG 5kDa
H
N
HN 0 0
0 I
i_i __________ CNP-34 )Lo-- resin '
S __________________ S
17e
0.78 g (0.07 mmol) of side chain protected CNP- 34 on TCP tentagel resin
having Boc protected
N-terminus and ivDde protected side chain of Lys16 was ivDde deprotected
according to the
procedure given in Materials and Methods to obtain 17a.
Compound 17d was synthesized as described for 14d, except that resin 17a (0.78
g, 0.13 mmol)
was used as starting material.
Yield: 5.39 mg (1.16 pmol, 1.7 %) CNP-34-Lys16-Malhx * 8 11-A
MS: m/z 937.26 = [M+41-114+, (calculated monoisotopic mass for
[M+41114+ =
937.23).
Conjugate 17e was synthesized as described for 14e, except that 17d (5.39 mg,
1.16 mop was
used as starting material.
Yield: 10.7 mg (1.09 mol, 94 %) conjugate 17e * 8 '11A
200
NfAecue/Date Received 2023-02-08
Example 18
Synthesis of permanent Lys22 CNP-34 PEG 5 kDa conjugate 18e
Conjugate 18e was synthesized according to the following scheme:
N H2 0
I _____________________
Os ________________________________ ,
Boc \ __ CNP-34 .$0¨[ resin _____________ 1.
STrt SMmt
18a
0
N
HN )R\ PEG 5 kDa thio113c
0 I 0 IN.
H \ 3CNP-34 )L04 resin -
Ni.= I I
S _________________ S -
18d
0
0
N¨ PEG 5kDa
H
0 HN
ipLf....--S
N
0
I 0
H ___________ CNP-34 /'04 resin :
NI..
1.3
I I
S _________________ S
18e
1.07 g (0.11 mmol) of side chain protected CNP- 34 on TCP tentagel resin
having Boc protected
N-terminus and ivDde protected side chain of Lys22 was ivDde deprotected
according to the
procedure given in Materials and Methods to obtain 18a.
Compound 18d was synthesized as described for 14d, except that resin 18a (1.07
g, 0.11 mmol)
was used as starting material.
Yield: 5.20 mg (1.12 mot, 1.0 % ) CNP-34-Lys22-Malhx * 8 '11-A
MS: m/z 937.26 = [M+41114+, (calculated monoisotopic mass for [M+41-
114+ =
937.23).
201
NfAecue/Date Received 2023-02-08
Conjugate 18e was synthesized as described for 14e, except that 18d (5.2 mg,
1.12 mol) was
used as starting material.
Yield: 4.20 mg (0.43 pmol, 38 %) conjugate 18e * 8 TFA
Example 19
Synthesis of permanent Lys26 CNP-38 PEG 5 kDa conjugate 19e
Conjugate 19e was synthesized according to the following scheme:
N H2 0
I
H 1
CNP-38 Ao¨Lr resin Boc I _____________ I _ s
STrt SMmt ________________________________________ I.
19a
0
0 =)1
0
HN)t-''''
1 0
H2N4 CNP-38 Ao¨{ resin ' PEG 5 kDa thiol 13c
_________________________________________________ 11
I I ,
S - S
19d
0
0
N¨ PEG 5kDa
H
HNi:)----¨S
N
0
1 0
H2N¨ CNP-38 -c:14 resin
I I ,
s ____________ s
(0.865 g, 0.10 mmol) of side chain protected CNP-38 on TCP tentagel resin
having Boc
protected N-teuninus and ivDde protected side chain of Lys26 was ivDde
deprotected
according to the procedure given in Materials and Methods to obtain 19a.
Compound 19d was synthesized as described for 14d, except that resin 19a
(0.865 g, 0.10
mmol) was used as starting material.
Yield: 10.3 mg (1.95 pmol, 2.0 %) CNP-38-Lys26-Malhx * 9 11-A
MS: m/z 1064.05 = [M-F4H]4+, (calculated monoisotopic mass for [M-
F4H]4+ =
1064.04).
202
NfAecue/Date Received 2023-02-08
Conjugate 19e was synthesized as described for 14e, except that 19d (4.70 mg,
1.10 mop
was used as starting material.
Yield: 3.20 mg (0.31 gnol, 28 %) conjugate 19e * 9 TFA
Example 20
Release kinetics in vitro
CNP conjugates 10f and lli were dissolved in a PBS buffer containing 3 mM EDTA
and 10
mM methionine, pH 7.4 at a concentration of approximately 1 mg conjugate/mL.
The solutions
was filtered sterile and were incubated at 37 C. At time points aliquots were
withdrawn and
analysed by RP-HPLC and ESI-MS. UV-signals correlating to liberated CNP were
integrated
and plotted against incubation time.
Curve-fitting software was applied to estimate the corresponding halftime of
release.
Results:
For conjugate 10f a release half life time of 8.5 d ( 1 d) was obtained.
For conjugate lli a release half life time of 9.5 d ( 1.5 d) was obtained.
Example 21
Functional cGMP stimulation in NIFI-3T3 cells with CNP variants
Functional activity of CNP variants were determined in a cell-based assay with
NIH-3T3 cells
(Murine Embryo Fibroblast cell line). These cells express endogenously the NPR-
B receptor
on the cell surface. Stimulation of the NPR-B receptor with CNP leads to
intracellular
production of the second messenger cGMP which is detected with a commercially
available
cGMP assay. N1H-3T3 cells were routinely cultured in DMEM F-12 medium with 5 %
FBS
and 5 mM glutamine at 37 C and 5 % CO2. For each assay, 50,000 cells were
resuspended in
stimulation buffer (Dulbecco's PBS with IBMX) and incubated with the CNP
variants in
different concentrations. CNP (dilutions were made in PBS with 0.2 % BSA).
After incubation
of 30 min at 37 C and 5 % CO2, the cells were lyzed and cGMP levels were
determined with a
commercially available cGMP TR-FRET assay (Cisbio, cGMP kit, Cat. No.
62GM2PEB).
PEGylated CNP variants were always characterized in comparison with the non-
PEGylated
version in the same experiment batch. If possible, evaluation of the residual
activity was done
203
NfAecue/Date Received 2023-02-08
via the relative EC50- parameter of the resulting dose-response curve
(restricted model with
common slope).
Table 1: Residual NPR-B activity of PEGylated CNP variants in a cell-based
assay as
determined against the non-PEGylated CNP variant
Compound CNP Variant PEGylation EC50
compound/ECso
CNP-38
15e CNP-38 5 kDa PEG, N-Terminus >5
19e CNP-38 5 kDa PEG, Lys26 >100
12g CNP-38 4x10 kDa PEG, Lys26 >>100
111 CNP-38 4x10 kDa PEG, Lys26 >>100
10f CNP-38 2x20 kDa PEG, Lys26 >>100
Comparing the tested PEG attachment sites, the attachment at the Lys26 (ring-
lysine) showed
the highest functional activity reduction, whereas the N-terminal attachment
showed relatively
high residual functional activity values. Increasing the PEG size resulted in
a better shielding
of the CNP molecule and a lower residual functional activity.
Example 22
Growth study in FVB mice after 5 weeks treatment with CNP-38 by daily
subcutaneous
bolus injection or by continuous subcutaneous infusion
This study was performed in order to test the effect of daily subcutaneous
bolus injection vs.
continuous subcutaneous infusion of CNP-38 on animal growth. 21- to 22-days-
old wild-type
FVB male mice (n = 9/group) were given 50 nmol/kg/d CNP-38 or vehicle (30 mM
acetate pH
4 containing 5 % sucrose and 1 % benzylic alcohol) either by daily
subcutaneous bolus injection
or by continuous subcutaneous infusion in the scapular region over 35 days.
Continuous
infusion was applied by Alzet osmotic pumps model 1002 for week 1-2, followed
by model
1004 for week 3-5. CNP-38 concentrations in the pumps were adjusted for the
mean animal
weight at study day 7 (pump model 1002) or study day 25 (pump model 1004).
Growth was
determined at d 35 by total body length measurement and X-ray measurements of
the right
femur and tibia.
204
NfAecue/Date Received 2023-02-08
Results of animals treated by daily subcutaneous bolus injection: At d 35,
total body len length
ght of CNP-38 treated animals was 110.2 %, right femur length was 105.6 % and
right tibia
length was 104.0 % compared to vehicle treated animals.
Results of animals treated by continuous subcutaneous infusion: At d 35, total
body length of
CNP-38 treated animals was 121.7 %, right femur length was 107.5 % and right
tibia length
was 112.2 % compared to vehicle treated animals.
It was concluded that continuous subcutaneous infusion or related slow release
formulations of
CNP-38 (e.g. a slow releasing CNP-38 prodrug) are at least as effective as
daily subcutaneous
bolus injection in eliciting growth in the appendicular and axial skeleton.
Example 23
Pharmacokinetic study of permanent Lys26 CNP-38 PEG4x10 kDa conjugate 12g in
cynomolgus monkeys
This study was perforated in order to show the suitability of 12g as a model
compound for a
slow release CNP-38 prodrug in cynomolgus monkeys. Male cynomolgus monkeys (2-
4 years
old, 3.5-4.1 kg) received either a single intravenous (n = 3 animals) or a
single subcutaneous (n
= 2 animals) administration of 12g at a dose of 0.146 mg CNP-38 eq/kg. Blood
samples were
collected up to 168 h post dose, and plasma was generated. Plasma total CNP-38
concentrations
were determined by quantification of the N-terminal signature peptide
(sequence:
LQEHPNAR) and C-terminal signature peptide (sequence: IGSMSGLGC) after tryptic
digestion as described in Materials and Methods.
Results: Dose administrations were well tolerated with no visible signs of
discomfort during
administration and following administration. No dose site reactions were
observed any time
throughout the study. After intraveneous injection the CNP-38 tm. was observed
at 15 min
(earliest time point analyzed), followed by a slow decay in CNP-38 content
with a half life time
of approx. 24 h. After subcutaneous injection the CNP-38 concentration peaked
at a tm. of 48
h. At 168 h the CNP-38 concentration was still as high as ca. 50 % of cm.. The
bioavailability
was ca. 50 %.
Similar PK curves were obtained for the N- and the C-teiminal signature
peptide up to 168 h
post dose, indicating the presence of intact CNP-38 in the conjugate.
205
NfAecue/Date Received 2023-02-08
The favourable long lasting PK over several days and the stability of CNP-38
in the conjugate
indicates the suitability of the permanent model compound Lys26 CNP-38 PEG
4x10 kDa
conjugate 12g as a slow releasing CNP-38 prodrug after subcutaneous injection.
It can be
concluded that similar conjugates having a transiently Lys26 linked CNP-38
(like e.g. 11i) are
suitable CNP-38 prodrugs providing long lasting levels of released bioactive
CNP-38 over
several days.
Example 24
Pharmacokinetic study of transient conjugates 10f and lli in cynomolgus
monkeys
This study was performed in order to show the suitability of 10f and lli as
slow release CNP-
38 prodrugs in cynomolgus monkeys. Male cynomolgus monkeys (2-4 years old, 3-5
kg)
received either a single subcutaneous administration (n = 3 animals) of
compound 10f or a
single subcutaneous (n = 3 animals) administration of 111 at a dose of 0.146
mg CNP-38 eq/kg.
Blood samples were collected up to 168 h post dose, and plasma was generated.
Plasma levels
of total CNP-38 content were analyzed as described in example 24. In order to
analyze the
plasma content of free CNP-38, the blood samples were acidified after
withdrawal by adding
vol% of 0.5 M sodium citrate buffer pH 4 to stop further CNP-38 release from
the conjugate.
Free CNP-38 levels in plasma can e.g. be determined by ELISA using a CNP
antibody that
20 binds to the ring region of CNP, as described in the literature (US
patent 8,377,884 B2), or by
LC-MS/MS.
Results: Dose administrations were well tolerated with no visible signs of
discomfort during
administration and following administration. No dose site reactions were
observed any time
throughout the study. After dose administration the total CNP-38 tm was
observed at 12 h for
compound 10f and 24 h for compound lli. Total CNP-38 plasma levels were below
LOQ (100
ng/mL, C-terminal peptide) after 120 h for compound 10f, while the plasma
level was still as
high as ca. 30 % of c.. for compound lli after 168 h (C-terminal peptide). For
compound lli
similar terminal half life of 3-4 d was found for the C-terminal and the N-
terminal peptide,
indicating the presence of intact CNP-38 in the conjugate.
Conclusion: The favourable long lasting PK over several days and the stability
of CNP-38 in
the conjugate lli indicates its suitability as CNP-38 prodrug for providing
long lasting levels
of released bioactive CNP-38 over several days.
206
NfAecue/Date Received 2023-02-08
Example 25
Digest of CNP variants by Neutral Endopeptidase In Vitro
In order to determine the in vitro stability of various CNP variants including
different peptide
chain lengths and PEGylations using different PEGylation sites and PEG
molecules in the
presence of Neutral Endopeptidase (NEP), a NEP digest assay was established.
This assay
monitored the decrease of the non-digested CNP variant (normalized with the
internal standard
PFP) over time in reference to the to-time point.
In detail, recombinant human NEP (2.5 gg/mL final concentration) and the
standard
pentafluorophenol (PFP; 40 pz/mL final concentration) were added to the CNP
variant (100 fig
CNP equivalents/mL) in digest buffer (50 mM Tris-HCl, pH 7.4, 10 mM NaCl). The
solution
was incubated at 37 C and 500 rpm for up to 4 days. Samples were taken at
different time
intervals. The reaction was stopped by a combined reduction and heat
denaturation adding
TCEP (tris(2-carboxyethyl)phosphine; 25 mM final concentration) and incubating
the mixture
at 95 C, 500 rpm for 5 minutes. The resulting reaction products were assigned
using HPLC-
MS. The half life of each CNP variant was calculated via the ratio change in
the HPLC-UV
peak areas of CNP and PFP over time. To compensate for variations in the
protease activity, a
CNP-38 or CNP-34 digest was carried out in every batch measurement as
reference.
Table 3 lists the half-lives, based on the in vitro NEP cleavage assay, of
various CNP variants
of different lengths and having various PEG molecules attached to different
side chains.
Compound CNP-variant PEGylation half life norm. [h]
CNP-221 CNP-22 0.32
CNP-34' CNP-34 4.15
14e1 CNP-34 5 kDa PEG, N-Terminus Almost no proteolysis
after 4 days.
17e1 CNP 34 5 kDa PEG, Lys16 54.23
18e1 CNP-34 5 kDa PEG, Lys22 38.87
16e1 CNP-34 5 kDa PEG, Lys12 No evaluation possible.
CNP-382 CNP-38 12.10
19e2 CNP-38 5 kDa PEG, Lys26 62.76
207
NfAecue/Date Received 2023-02-08
15e2 CNP-38 5 kDa PEG, N-Terminus Almost no proteolysis
after 4 days.
12g2 CNP-38 4x10 kDa PEG, -Lys26 Almost no proteolysis
after 4 days.
1) Due to variations in NEP catalytic activity between experiments, a mean was
formed of all
CNP-34 half life measurements (4.15h) and the CNP-34 conjugates' half life
measurements
were normalized to this mean using a coefficient to calculate the adjusted
ti/2.
2) Due to variations in NEP catalytic activity between experiments, a mean was
formed of all
CNP-38 half life measurements (12.10h) and the CNP-38 conjugates' half life
measurements
were normalized to this mean using a coefficient to calculate the adjusted
t112.
The rank order of resistance towards NEP is as follows: The longer CNP -
variant (CNP-38) is
more stable than the shorter CNP variant (CNP-34), which in turn is more
stable than the shorter
CNP-22. The order of the PEG-attachment sites is as follows: N-terminal > next-
to-ring > ring.
Therefore, an N-terminal PEG attachment confers the highest stability towards
the proteolytic
digest with NEP for the tested conjugates. The stability of CNP-38 PEGylated
at Lys26 can be
increased with increasing PEG size.
Example 27
Synthesis of fluorescein labelled CNP-38 27d and NPR-C affinity assay
Compound 27d was synthesized according to the following scheme:
0 5(6)-carboxyfluorescein-N-succini midyl
ester
H2N¨ CNP-38 )1'0¨ resin DIEA
DMF
I
STrt SMmt
27a
TFA/DTT/TES/water/thioanisole
0 0 0 H (100/3/3/2/1)
0
HO2C
N¨ CNP-38 -)0¨[ resin
I
27b 0 STrt SMmt
208
NfAecue/Date Received 2023-02-08
0 0 0 H
2,2.-Dithiobispyridine-N-oxide
0
HO2C H _________ II
N¨ CNP-38 -'OH
I I
27c 0 SH SH
0 0 0 H
0
HO2C H II
N¨ CNP-38 H
I I
27d 0 S ___ S
Side chain protected CNP-38 on TCP tentagel resin having free N-terminus 27a
(0.50 g, 35.4
pmol) was pre-swollen in DMF for 30 min. A solution of 5(6)-carboxyfluorescein-
N-
succinimidyl ester (41.9 mg, 88.5 mop and DIEA (30.9 L, 177 mop in DMF (1.6
mL) was
drawn onto the resin and the mixture was shaken over night at rt. The resin
was washed 10 x
each with DMF and CH2C12 and dried in vacuo affording 27b.
Cleavage of the peptide from resin and removal of protecting groups was
achieved by treatment
of the resin with 7 mL cleavage cocktail 100/3/3/2/1 (v/w/v/v/v)
nA/DTT/TES/water/thioanisole for 1 h at rt. The resin was filtered off and
crude 27c was
precipitated in pre-cooled (-18 C) diethyl ether and purified by RP-HPLC
affording 27c. The
combined HPLC fractions were used directly in the next step.
MS: trilz 1105.80 = [M+41-114+, (calculated monoisotopic mass for [M+4H]4+ =
1105.81).
To the combined HPLC product fractions of 27c (115 mL), 30 mL of 0.5 M citric
acid buffer
(pH = 5.00) and 8 mL of a 10 mM 2,2'-dithiobis(pyridine-N-oxide) solution in
1/1 (v/v)
acetonitrile/water were added. The mixture was stirred for 60 min at rt and
then diluted with
350 mL of water containing 0.1 % (v/v). 27d was purified by RP-HPLC.
Yield: 16.1 mg (2.90 pmol, 8.2 % over 3 steps) labelled CNP-38 * 10 11-
.A
MS: m/z 1105.30 = [M+4H]4 , (calculated monoisotopic mass for
[M+4H]4 =
1105.30).
For the NPR-C affinity assay, a NPR-C expressing Hek293 cell line was
developed. The coding
region of the NPR-C sequence (BC131540) was cloned into a lentiviral vector
under CMV
209
WAecue/Date Received 2023-02-08
promoter for constitutive receptor expression. A bicistronic element located
on the vector for
puromycin resistence was used as eukaryotic selection marker. After
transduction, stably
growing cell pools were subjected to qRT-PCR for confirmation of receptor mRNA-
expression
compared to parental Hek293 cells. An NPR-C-expressing cell pool was expanded
and frozen
as master cell bank for CNP sample testing.
For the assay, growing cells were trypsinized from the cell flask bottom,
counted, and seeded
in a 96-well plate (1.5 x 105/well) and centrifuged. Supernatants were
discarded. CNP standard
and sample were serially diluted over 9 steps in PBS 0.2% BSA and transferred
to the micro
plate in duplicates and mixed with cells. After 30 min incubation at room
temperature,
fluorescein-labelled CNP 27d was added to each well with a constant
concentration and cells
were incubated for additional 45 min at room temperature. Subsequently, cells
were analyzed
by flow cytometry using mean fluorescence intensity of the FITC channel (FL1,
Beckman
Coulter FC500MPL) as read out.
Standard curve and sample curve were generated in an analysis software (PLA
2.0) using a 4PL
fit for potency and/or IC50 calculation.
Table 3: Residual NPR-C affinity of PEGylated CNP-38 variants in a cell-based
assay versus
CNP-38
Compound PEGylati on IC50 of PEGylated
CNP-38/IC50 CNP-38
15e 5 kDa PEG, N-Terminus 0.53
19e 5 kDa PEG, Lys26 1.1
10f 2x20 kDa PEG, Lys26 12
(reversible conjugate, first carrier branching point
close to CNP moiety)
12g 4x10 kDa PEG, Lys26 143
(permanent conjugate, first carrier branching point
close to the CNP moiety)
lii 4x10 kDa PEG, Lys26 91
(reversible conjugate, first carrier branching point
close to the CNP moiety)
31d 4-arm PEG 40 kDa, Lys26 1.7
(reversible conjugate, first carrier branching point
not close to the CNP moiety)
Example 29
Synthesis of Asn-linker reagent 29b
210
NfAecue/Date Received 2023-02-08
Asn-linker reagent 29b was synthesized according to the following scheme:
0
LION
Boc"OBn
Tmob N 0
Fmocr lb
0 6-maleimidohexanoic
H acid, PyBOP, DIEA
Boc'N0
Tmob H N 0
29a
0
Boo'NN-r 0 H
Tmob o N 0
29b
0
0
To a solution of lb (12.85 g, 16.14 mmol) in isopropanol (238 mL), H20 (77.5
mL) and LiOH
(2.32 g, 96.87 mmol) were added. The reaction mixture was stirred for 4 h at
rt. Afterwards, the
reaction mixture was diluted with toluene (300 mL). The phases were separated
and the organic
phase was washed 3 x with 0.1 M HC1 (200 mL). The phases were separated again.
The aqueous
phase was extracted 3 x with toluene (100 mL). The product was found in the
acidic aqueous
phase and the pH value of this phase was adjusted to pH 8.5 by the addition of
4 N NaOH.
Then, the aqueous phase was extracted 3 x with CH2C12 (200 mL). The organic
phase was
washed with brine (50 mL), dried over Na2SO4 and filtrated. 29a was isolated
upon evaporation
of the solvent and used in the next reaction without further purification.
Yield: 6.46 g (13.36 mmol, 83%)
MS: in/z 484.06 = [M+H1+, (calculated monoisotopic mass =483.26).
To a solution of 6-maleimidohexanoic acid (1.73 g, 8.19 mmol) in THF (70 mL),
PyBOP
(4.26 g, 8.19 mmol) and D1EA (3.89 mL, 22.33 mmol) were added. Then, the
reaction mixture
was stirred for 2 h at rt. Afterwards, 29a (3.60 g, 7.44 mmol) was dissolved
in THF (10 mL)
and added to the reaction mixture. The reaction was stirred at rt overnight.
Then, methyl-tert-
211
NfAecue/Date Received 2023-02-08
butylether (300 mL) was added. The organic phase was washed 2 x with 0.1 M HC1
solution
(200 mL). The combined aqueous phases were extracted 2 x with methyl-tert-
butylether
(200 mL). The combined organic phases were washed with brine (150 mL), dried
over Na2SO4
and filtrated. The solvent was evaporated in vacuo. 29b was purified using
flash
chromatography.
Yield: 3.34 g (4.94 mmol, 66%)
MS: m/z 677.34 = [M+Hr, (calculated monoisotopic mass =676.33).
Example 30
Synthesis of 4-arm-thiol-PEG 40kDa 30c
4-arm-thiol PEG 30c was synthesized according to the following scheme:
N H 2
EDC*HCI, HOBt,
0
PEG OkDa 2,4,6-collidine
H 2N N H2 H
NH 2 30a
0
HNS'Trt TFA/DTT/H20/HFIP/TES
0
H pEG OkDa ,J=S
TaN N 'Ta
0
TftNH
30b
0
0
HNSH
0
H PEG OkDa ),SH
N
H NH
0
HSõ...wirNH
30c
0
To a solution of 6-tritylmercapto-hexanoic acid (111.72 mg, 286.02 mop, HOBt
(43.81 mg,
286.06 mol) and EDC*HC1 (54.84 mg, 286.06 mol) in CH2C12 (5 mL) was added
2,4,6-
collidine (251 L, 1.91 mmol). Then, this solution was added to a solution of
4-arm amino PEG
40 kDa (NOF, Sunbright PTE-400PA, 1.30 g, 31.78 mop in CH2C12 (10 mL). The
reaction
212
NfAecue/Date Received 2023-02-08
mixture was stirred over night at P. Afterwards, the solvent was evaporated
(water bath 30 C).
30b was purified by RP-HPLC.
Yield: 650.5 mg (48%).
Cleavage of the Trt protecting group was achieved by adding the cleavage
cocktail (DTT
500 mg/TFA 500 LtUwater 500 L, TES 2.5 mL/HFIP 5.0 mUCH2C12 25.0 mL) to 30b
(500
mg, 11.79 mop and incubating for 30 min at rt. 30c was obtained after
precipitation in pre-
cooled (-18 C) diethyl ether.
Yield: 401.3 mg (82%; 93.3% purity).
Example 31
Synthesis of conjugate 31d
Conjugate 31d was synthesized according to the following scheme:
NH2 0
N¨[ CNP-38 resin 29b, DIC, Oxyma
Boc I I
STrt STrt
10a
0
0
Tmob TFATTES/water/thioanisol
Boc ,N 0
____________________________________________________ D.
o
0 N H
1 0
r ____
CNP-38 -0-[. resin
Boc I
STrt STrt 31a
diphenyl sulfoxide
HNN 0
0 0N H
1 0
H2N ¨ CNP-38
I I
SH SH 31b
213
NfAecue/Date Received 2023-02-08
0
0
H
0
HNNyi''"-
I0 0.=-=,NH
I 0
H2N-[ CNP-38 )OH
I __ I
S S 31c
0
HN,J.L..,......,...,.....,, SH
0
H N pEG OkDaN )SH
HS-r*" H
0
HSõ Ir
.............,,,,NH
30c
0
0
0 H
31c 1"? HN----N)./K
R/N I 0 0
NH
0 R= I 0
H2N ___________________________________________ CNP-38 AOH
I I
S¨S
V
0
0
HNS-cf\I R
0 0
0 0
H ).-
R PEG OkDa N )- S¨crl
H R
0 0 0 0
õ..,...,../....õ....,,y N H
N1.-¨ s
R 0
0
31d
214
Nniecue/Date Received 2023-02-08
A solution of linker reagent 29b (3.82 g, 5.64 mmol), OxymaPure (802 mg, 5.64
mmol) and
DIC (868 L, 5.64 mmol) in DMF (42.5 mL) was added to the resin 10a (18 g,
1.85 mmol).
The suspension was shaken for 100 min at rt to afford resin 31a. The resin was
washed 10 x
with DMF (10 mL) and 10 x with DCM (10 mL) and dried in vacuo for 15 min.
Cleavage of
the peptide from resin and removal of protecting groups was achieved by
treatment of the resin
with 135 mL cleavage cocktail 100/3/2/1 (v/v/v/v) ________________________
A/TES/water/thioanisol. The mixture was
agitated for 60 min at rt. Crude 31b was precipitated in pre-cooled diethyl
ether (-18 C).
The precipitate was dissolved in '11.A (423 mL). To this solution, a solution
of diphenyl
sulfoxide (1.87 g, 9.25 mmol) and anisole (5.05 mL, 46.25 mmol) in TFA (40 mL)
was added.
Afterwards, trichloromethylsilane (13.3 mL, 114.7 mmol) was added and the
reaction mixture
was stirred for 15 min at rt. Then, ammonium fluoride (10.96 g, 296 mmol) was
added and the
solution was stirred for 2 min in a water bath at rt. Crude 31c was
precipitated in pre-cooled
diethyl ether (-18 C) and purified by RP-HPLC.
Yield: 187 mg (34.2 mol, 16%) CNP-38-linker * 9 TFA
MS: m/z 1110.33 = [M+41-114+, (calculated monoisotopic mass for
[M+41-114+ =
1110.33).
To a solution of 31c (88.0 mg, 16.1 mop in 4.40 mL MeCN/H20 (1:1) containing
___________________________________________________________________ 0.1 %
(v/v) was added a solution of 4-arm-thiol-PEG 40kDa 30c (107.35 mg, 2.59 mop
in 1.45 mL water containing 0.1% TFA and 1 mM EDTA, followed by 0.5 M
phosphate buffer
containing 3 mM EDTA (1.46 mL, pH 6.0). The mixture was incubated for 2 h at
rt.
Conjugate 31d was purified by RP-HPLC.
Yield: 129 mg (2.09 mol, 80 %) conjugate 16d * 36 '1'1,A
Example 32
Alternative synthesis of Dmb protected 6-mercaptohexanoic acid 7
Dmb-protected mercapto hexanoic acid 7 was synthesized according to the
following scheme:
0 0
thiourea
HO H
HOõJ-Br
Et0H, NaOH, H20
215
W ecWecue/Date Received 2023-02-08
CI
NaH, rY
THF
0
S'Dmb
HO
7
To a solution of 6-bromohexanoic acid (100 g, 0.513 mmol) in Et0H (1.0 L) was
added thiourea
(47 g, 0.615 mmol) in one portion at 20 C. Then, the suspension was heated up
to 78 C (a
clear solution was formed) and stirred for 12 h. A solution of NaOH (62 g,
1.54 mol) in H20
(1.0 L) was added dropwise with a constant pressure funnel. Afterwards,
refluxing was
continued for additional 2 h. The reaction mixture was poured into H20 (1 L)
and extracted
with Et0Ac (1 L). The aqueous phase was acidified with con. HC1 towards pH =2
and then
extracted 3 x with Et0Ac (500 mL). The combined organic phases were washed
with brine
(400 mL). Afterwards, the combined organic phases were dried over Na2SO4,
filtrated and the
solvent was evaporated under reduced pressure at 45 C. The 6-mercaptohexanoic
acid was
used in the next reaction without further purification.
Yield: 62 g (crude)
1H-NMR (400 MHz, CDC13):
= 2.50 ¨2.55 (q, J = 7.2 Hz, 2H), 2.36 (t, J= 7.6 Hz, 2H), 1.66 ¨ 1.61 (m,
4H), 1.41 ¨ 1.49
(m, 2H), 1.34 (t, .1= 7.6 Hz, 1H) ppm.
6-mercaptohexanoic acid (27.0 g, 0.182 mmol) was charged in a 1 L three-necked
bottom flask
with anhydrous THF (540 mL). The solution was degassed by freeze-pump-thaw
technique and
the cooled to 0 C with an external ice bath. NaH (18.2,455.4 mmol, 4.16 mL,
60% purity) was
added with spoon horns over 30 min at 0 C. Then, 2,6-dimethylbenzylchloride
(28.2 g,
0.182 mol) was added in one portion. The reaction mixture was warmed up to 20
C and stirred
for 12 h. The reaction mixture was poured into H20 (540 mL) and extracted 2 x
with MTBE
(540 mL). Afterwards, the aqueous phase was acidified with conc. HCl towards
pH = 2 and
then extracted 3 x with M'IBE (500 mL). The combined organic phases were
washed with brine
(500 mL), dried over Na2SO4 and filtrated. 7 was isolated upon evaporation of
the solvent under
reduced pressure at 45 C as a yellow oil.
216
W ecWecue/Date Received 2023-02-08
Yield: 41.5 g (0.16 mol, 85%)
1H-NMR (400 MHz, DMSO-d6):
= 11.99 (s, 1 H), 7.05 ¨7.07 (d, J = 6.8 Hz, 1H), 6.97 (s, 1H), 6.91 ¨ 6.92
(d, J= 6.8 Hz, 1H),
3.66 (s, 2H), 2.38 ¨2.39 (m, 2H), 2.29 (s, 3H), 2.23 (s, 3H), 2.16 ¨ 2.19 (m,
2H), 1.40 ¨ 1.55
(m, 4H), 1.22¨ 1.38 (m, 2H) ppm
MS (neg. mode): m/z 265.0 = [M-11]-, (calculated monoisotopic mass
=265.13).
Example 33
Synthesis of linker reagent 33c
Linker reagent 33c was synthesized according to the following scheme:
Tmob\ N.FrrIcic piperidine Tmob NH
cH2.2
CO2Bn
) 0 CO2Bn
Bl oc Boo
lb 33a
Tmob
\ IN
Fmoc-L-Lys(Fmoc)-OH
r,11\1,11 NHFmoc
T3P/MeCN10 CO2Bn
Boo
33b
0
Tmob
Pd/C
o coRI2HHFmc
Me0H
Boc
33c
Four reactions were carried out in parallel. To a solution of compound lb (60
g, 75 mmol) in
CH2C12 (300 mL) was added piperidine (58 g, 0.68 mol, 67 ml.). The reaction
mixture was
stirred at rt for 4 h. The four reactions which were performed in parallel
were combined for
work-up. The reaction mixture was diluted with H20 (500 mL) and adjusted with
a 0.5 N HCl
solution towards pH = 3 ¨ 4. The organic phase was separated and the aqueous
phase was
extracted with CH2C12 (800 mL). The combined organic phases were washed with
brine (400
mL) and 5% saturated NaHCO3 solution (400 mL) in turn. Then, the combined
organic phases
217
NfAecue/Date Received 2023-02-08
were dried over Na2SO4, filtered and the solvent was evaporated in vacuo. 33a
was purified by
chromatography on silica (100-200 mesh) with DCM/Me0H (20/1 to 4/1).
Yield: 150 g (87%)
11-1-NMR (400 MHz, DMSO-d6):
5 = 7.34 -7.38 (m, 4H), 6.25 -7.29 (m, 2H), 5.08 - 5.19 (m, 2H), 4.60 - 4.68
(m, 1H), 4.32 -
4.40 (m, 2H), 3.73 -3.79 (m, 9H), 3.10 -3.27 (m, 3H), 2.65 -3.05 (m, 8H), 1.36
(s, 9H) ppm.
Two reactions were carried out in parallel. To a solution of Fmoc-L-Lys(Fmoc)-
OH (79 g, 0.13
mol), 33a (70 g, 0.12 mol), 4-ethyl-morpholine (70 g, 0.61 mol, 77 mL) in MeCN
(850 mL)
was added dropwise T3P (50% in Et0Ac; 140 g, 0.22 mol) over a period of 30
min. After
addition, the reaction mixture was stirred at rt for 18 h. The two reactions
which were performed
in parallel were combined for work-up. The reaction mixture was diluted with
H20/CH2C12
(1:1, 2 L) and then adjusted with 0.5 N HCl solution towards pH = 3 - 4. The
organic phase
was separated and the aqueous phase was extracted with CH2C12 (1 L). The
combined organic
phases were washed with brine (800 mL) and 5% NaHCO3 solution (800 mL) in
turn. Then,
the combined organic phases were dried over Na2SO4, filtered and the solvent
was evaporated
in vacuo. 33b was purified by chromatography on silica (100-200 mesh) with
petroleum
ether/ethyl acetate (5/1 to 1/1).
Yield: 160 g (57%)
111-NMR (400 MHz, DMSO-d6):
5 = 7.80 - 7.90 (m, 4H), 7.61 -7.68 (m, 5H), 7.20 - 7.40 (m, 14H), 6.14 -6.28
(m, 3H), 5.01
- 5.07 (m, 2H), 4.15 -4.36 (m, 8H), 3.71 -3.77 (m, 911), 2.80 -3.53 (m, 9H),
2.66 -2.75 (m,
4H), 2.36 -2.39 (m, 1H), 1.52- 1.55 (m, 2H), 0.88- 1.19 (m, 13H) ppm.
Two reactions were carried out in parallel. To a solution of 33b (60 g, 52
mmol) in Me0H (1.2
L) was added 10% Pd/C (18 g) in a 2 L hydrogenated bottle. The reaction
mixture was degassed
and purged 3 x with H2 and then stirred at 25 C under H2-atmosphere (45 psi)
for 2.5 h. The
two reactions which were performed in parallel were combined for work-up. The
reaction
mixture was filtered by diatomite and the filtrate was concentrated in vacuo
to give crude 33c.
33c was purified by chromatography on silica (100-200 mesh) with DCM/Me0H
(200/1 to
100/3).
Yield: 70 g (63%)
1H-NMR (400 MHz, DMSO-d6):
218
W ecWecue/Date Received 2023-02-08
= 12.15 (s, 1H), 7.87 - 7.89 (m, 4H), 7.50 - 7.70 (m, 5H), 7.31 - 7.40 (m,
9H), 6.20 - 6.23
(m, 2H), 4.13 -4.36 (m, 10H), 3.70 - 3.77 (m, 9H), 2.62 - 3.10 (m, 12H), 2.30 -
2.34 (m, 1H),
2.14 -2.18 (m, 1H), 1.50- 1.58 (m, 2H), 1.25 - 1.34 (m, 13H) ppm
MS: m/z 1056.4= [M+H], (calculated monoisotopic mass =1056.50).
Example 34
Alternative synthesis of 11c
Compund 11c was synthesized according to the following scheme:
N H2 0
N- CNP /[. 0- resin 33c, PyBOP,
Boc I
DIPEA
DMF
STrt STrt
10a
0
Tmob
rõ,\Nyk NI-IFmoc
o
0 N H 0
Boc H
CNP --)cij resin
Boc
STrt STrt
11 C
A solution of linker reagent 33c (3.21 g, 3.04 mmol), PyBOP (1.58 g, 3.04
mmol) and DIPEA
(848 mL, 4.86 mmol) in DMF (24.0 mL) was incubated for 5 min at rt, then added
to the resin
10a (12 g, 1.21 mmol). The suspension was shaken for 2.5 h at rt. The resin
was washed 10 x
with DMF (10 mL) and 10 x with DCM (10 m1.) and dried in vacuo for 60 min.
Example 35
CNP-38 and Conjugate lli: Evaluation of Cardiovascular Effects in the
Conscious Mouse
(Subcutaneous Administration)
The purpose of this study was to evaluate the haemodynamic side effects of lli
at dose level
equivalent to a CNP-38 dose level eliciting haemodynamic side effects
(decrease in blood
pressure) in the telemetered mouse.
Male Crl:CD1(ICR) mice (age range 8-13 weeks and body weight range 27.3-35.6 g
at start of
dosing) were surgically implanted with a TA11PA-C10 telemetry transmitter
(Data Sciences
219
NfAecue/Date Received 2023-02-08
International (DSI)) in the carotid artery. The body of the transmitter was
placed subcutaneously
in the lateral flank of the mouse. The mice were dosed subcutaneously in a
latin square
crossover design with at least 72 hours between dosing occasions. Mice were
dosed with 1)
vehicle (10mM succinate, 46.0 g/L mannitol, pH 4.00), 2) CNP-38 (80014 CNP-
38/kg, 10mM
succinate, 46.0 g/L mannitol, pH 4.00) or 3) 111 (800 mg CNP-38 eq/kg, 10mM
succinate, 46.0
g/L mannitol, pH 4.00). At least four mice were included at each dose level.
Blood pressure
(systolic (SAP), diastolic (DAP) and mean (MAP) and heart rate (HR, derived
from blood
pressure), were recorded using a digital data capture system linked with a
DSITM Ponemah
data acquisition and analysis system. The capture system allowed recording of
the
cardiovascular parameters whilst the mice were in individual cages. On the day
of each test
session the animals were weighed and a predose recording was performed for at
least 60 min
prior to dosing. Each mouse was returned to the home cage and the
cardiovascular parameters
were recorded for approximately 48 hours postdose. Blood pressure and HR were
reported at
the following time points: -30, -20, -10, 5, 15 and 30 min postdose and 1, 2,
6, 12, 18, 24, 30,
36, 42 and 48 hours postdose. Each time point was presented as the average
value of five
minute's recording prior to the time point. The monitoring period was selected
to cover
exposure to the test items both prior to and after T..
Results: Compared to predose values, vehicle dosed animals had increased MAP
at the 5, 15,
and 30 min post dose sampling time point. This was considered a normal
physiological response
due to handling and dosing. The same physiological increase in MAP was seen
for animals
dosed with lli at the 5, 15, and 30 min post dose sampling time point predose.
In 3 of 4 animals
dosed with CNP-38 the physiological increase in MAP was not evident. On the
contrary, 3 of
4 CNP-38 dosed animals showed a significant decrease in MAP at the 5, 15, and
30 min post
dose sampling time point. During the remaining ten time points there were no
difference in
MAP between animals dosed with vehicle, CNP-38 and lli.
MAP (mmHg) predose to 30 min post dose (mean SD)
Vehicle (n=10) lii (17-4) CNP-38 (n=4)
predose 101.9+10.0 106.4+10.7 106.8+13.4
5 min post dose 125.9+7.3 122.8+5.9 102.0+7.5
15 min post dose 126.3+6.9 121.5+7.5 89.5+29.4
min post dose 114.4+15.3 111.5+13.7 99.5+25.2
220
NfAecue/Date Received 2023-02-08
Similar trends were seen for SAP and DAP for all dose levels. HR was not
impacted by
treatment with CNP-38 or lli.
In conclusion, subcutaneous administration of lli did not decrease blood
pressure as seen for
an equivalent dosage CNP-38.
Example 36
Pharmacokinetic profile of CNP-38 after subcutaneous single-dose
administration to
cynomolgus monkeys
This study was performed in order to test the pharmacokinetics of CNP-38 after
subcutaneous
(s.c.) administration in cynomolgus monkeys. Three male monkeys (2-4 years
old, 3-5 kg)
received a single s.c. injection at a dose of 40 g/kg of CNP-38. Blood
samples were collected
at 5, 10, 15, 30, 45 min and 1, 2, 4, 8 hours upon dose.
Method: Plasma levels of CNP were analysed using a commercially available
competitive
radioimmuno-assay (RK-012-03, Phoenix Pharmaceuticals, CA). The assay was
applied
essentially as described by the manufacturer. The assay is based on
competitive binding
between 125I-labelled CNP (supplied in the kit) and unlabeled CNP (from study
sample or
calibrants) to an anti-CNP antibody. When the concentration of CNP in the
sample increases,
the amount of 125I-labelled CNP that is able to bind to the antibody
decreases. By measuring
the amount of 125I-labelled CNP bound as a function of the concentration of
peptide, it is
possible to construct a calibration curve from which the concentration of
peptide in the sample
can be determined.
A few changes to the supplied assay protocol were made. These changes included
using in-
house CNP calibrant and QC samples to secure consistency between assay runs.
In order to
shorten the duration of the assay, the initial incubation of samples with
antibodies was
performed at room temperature for 5 hours (instead of 16-24 hours at 4 C). Due
to matrix
effects in monkey plasma, the minimal required dilution was set at 1:10,
yielding an assay range
of 150-1080 pg/mL CNP.
Results: Administration of CNP-38 to cynomolgus monkeys was well tolerated.
After s.c.
injection, the CNP-38 median T. was observed at 10 mm, with a mean half-life
time of
approximately 7 min.
221
NfAecue/Date Received 2023-02-08
PK Parameter Result
Tmax (median) 10 min
Cm ax (mean) 7.9 ng/mL
AUCtust (mean) 2.5 h*ng/mL
Half-life (mean) 6.6 min
Example 37
Pharmacokinetic profile of Conjugate Iii after subcutaneous single-dose
administration
to cynomolgus monkeys
This study was performed in order to investigate pharmacolcinetics of lli
after s.c.
administration in cynomolgus monkeys. Four male animals (2-4 years old, 3-5
kg) received a
single s.c. injection of 111 at a dose of 40 g CNP-38 eq/kg. Blood samples
were collected up
to 168 h post dose and plasma was generated (LiHeparin). Total CNP-38
concentrations were
determined by LC-MS/MS
Method: The term "total CNP-38" refers to a combination of both free CNP-38
and CNP-38
bound in the CNP-38 conjugate. Plasma total CNP-38 concentrations were
determined by
quantification of the C-tellninal signature peptide (sequence: IGSMSGLGC)
after tryptic
digestion and disulfide bridge reduction.
LC-MS analysis was carried out by using an Agilent 1290 UPLC coupled to an
Agilent 6460
Triple Quad mass spectrometer via an ESI probe. Chromatography was performed
on a Waters
Acquity BEH C18 analytical column (50 x 1.0 mm I.D., 1.7 m particle size, 130
A) with pre-
filter at a flow rate of 0.5 mL/min (T = 45 C). Water (Ultrapure < 500 ppt
sodium grade)
containing 0.1 % formic acid (v/v) was used as mobile phase A and acetonitrile
(ULC/MS
grade) with 0.1 % formic acid as mobile phase B. The gradient system comprised
a short
isocratic step at the initial parameters of 0.1 % B for 0.5 min followed by a
linear increase from
0.1 % B to 30 % B in 1.5 min. Mass analysis was performed in the multiple
reaction monitoring
(MRM) mode, monitoring the reactions of the ionsation m/z 824.5 [M+1111+ to
515.2. As
internal standard deuterated CNP-38 conjugate was used.
Calibration standards of CNP-38 conjugate in blank plasma were prepared as
follows: The
thawed Li-heparin cynomolgus plasma was first homogenized, then centrifuged
for 5 minutes.
222
NfAecue/Date Received 2023-02-08
The CNP-38 conjugate formulation was diluted to eight different calibration
working solutions
containing between 0.103 and 51.28 lig/mL (CNP-38 eq.) in 50% methano1/50%
water/0.1 %
foimic acid (v/v/v). The working solutions were spiked into blank plasma at
concentrations
between 10.3 ng/ mL (CNP-38 eq.) and 5128 ng/mL (CNP-38 eq.). The standards
were used
for the generation of a calibration curve. A calibration curve was generated
based on analyte to
internal standard peak area ratios using weighted (1/x2) linear regression and
the sample
concentrations were determined by back-calculation against the calibration
curve.
For sample preparation, protein precipitation was carried out by addition of
200 j.iL of precooled
(0 C) acetonitrile to 50 1.11, of the plasma sample and 10 j.iL of internal
standard solution (2.8
ng/mL CNP-38 eq. in 50% methanol/50% water/0.1 % formic acid (v/v/v)). 200
[11, of the
supernatant were transferred into a new well-plate and evaporated to dryness
(under a gentle
nitrogen stream at 35 C). For reconstitution solvent 100 lig Trypsin (order
number V5111,
Promega GmbH, Mannheim, Germany) were dissolved in 100 L 10 mM acetic acid.
2.5 mL
Tris buffer and 500 pi, methanol were added. 50 tL of the resulting
reconstitution solvent were
added to each cavity of the-well plate. After 3 hours incubation at 37 C
(Eppendorf
ThermoMixer with ThermoTop), 5 pi, of a 0.5 M TCEP solution were added to each
cavity and
incubated again for 30 min at 37 C. After the samples had cooled to room
temperature, 2 iL
60% formic acid in water were added. 10 1., were injected into the UHPLC-MS
system.
Results: Administration of lli to cynomolgus monkeys was well tolerated. After
s.c. injection
the 11i median Tmax was 36 h, and with a mean half-life time of 107 h.
PK Parameter Result
T. (median) 36 hours
C. (mean) 316 ng/mL
AUCtiast (mean) 38,051 h*ng/mL
Half-life (mean) 107 hours
Example 38
Functional cGMP stimulation in NIH-3T3 cells with released CNP
lli was incubated under physiological conditions (1 mg CNP-38 eq/mL), as
described in
Example 20. After 7 d, released CNP-38 was isolated by RP-HPLC and analyzed
for bioactivity
as described in Example 21.
223
NfAecue/Date Received 2023-02-08
Compound CNP Variant PEGylation EC 50
compound/EC 50
CNP-38
Released CNP-38 CNP-38 1
Example 39
Alternative synthesis of 11h
PG1
H
0
___________________________________ . resin cleavage
N4 CNP ()¨[ resin
Boc' I I
S S
PG2 'PG2
39a
N H
, 2 o
Disulfide formation
CNP H
Boc I I
S
PG2 'PG2
39b
N H2 0 1 . Coupling of linker 39d
1 1 h
CNP )10H
Boc II 2. Removal of protecting groups
s¨s
39c
39d
0 0 STrt
Tmob
Boc HN
STrt
0 0
aN 0Su
Alternative synthesis of compound 11h: 39a is synthesized by solid phase
synthesis as
described in Material and Methods. Protecting group PG1 for the ring lysin
side chain and
protecting groups PG2 for the cysteine side chains is Mmt. Mild resin cleavage
and disulfide
formation by iodine treatment affords compound 39c. After coupling of linker
molecule 39d
and global deprotection, 1in is purified by RP-HPLC.
224
NfAecue/Date Received 2023-02-08
Abbreviations:
ACH achondroplasia
ACN acetonitrile
AcOH acetic acid
AUCtiast Area Under the Curve to the last quantifiable time point
Bn benzyl
Boc tert-butyloxycarbonyl
BSA bovine serum albumin
cGMP cyclic guanosine monophosphate
Cm. Maximum concentration
CMV cytomegalovirus
CNP C-type natriuretic peptide
COMU ( 1 -cy ano-2-ethoxy -2-oxo ethyli denaminooxy
)dimethylamino -
morpholino-carbenium hexafluorophosphate
conc. Concentrated
day
CTC Chlorotritylchloride polystyrol
DAP Diastolic arterial pressure
DBU 1,3-diazabicyclo[5.4.01undecene
DCC N,N'-dicyclohexylcarbodiimide
DCM dichloromethane
DIC N,N'-diisopropylcarbodiimide
DIEA N,N-diisopropylethylamine
DIPEA N,N-diisopropylethylamine
DMAP dimethylamino-pyridine
DMEM Dulbecco's modified Eagle's medium
Dmb 2,4-dimethylbenzyl
DMEM Dulbecco's modified eagle medium
DMF N,N-dimethy lfoimamide
DMSO climethylsulfoxide
DTT dithiothreitol
EC50 half maximal effective concentration
EDC 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide
225
NfAecue/Date Received 2023-02-08
EDTA ethylenediaminetetraacetic acid
ELISA enzyme-linked immunosorbent assay
eq stoichiometric equivalent
ESI-MS electrospray ionization mass spectrometry
Et ethyl
Et0Ac ethyl acetate
EtOH ethanol
FBS fetal bovine serum
FGFR3 fibroblast-growth-factor-receptor 3
FITC fluorescein isothiocyanate
Fmoc 9-fluorenylmethyloxycarbonyl
hour
HATU 0-(7-azabenzotri azole-1-y1)-N,N,N',N'-tetramethy
luronium
hexafluorophosphate
HCH hypochondroplasia
HFIP hexafluoroisopropanol
HPLC high performance liquid chromatography
HOBt N-hydroxybenzotriazole
HR Heart rate
IBMX 3-isobuty1-1-methylxanthine
iPrOH 2-propanol
iv intravenous
ivDde 4,4-dimethy1-2,6-dioxocyclohex-1-ylidene)-3-methylbutyl
LC liquid chromatography
LTQ linear trap quadrupole
Mal 3-maleimido propyl
MAP Mean arterial pressure
Me methyl
Me0H methanol
min minutes
Mmt monomethoxytrityl
MS mass spectrum / mass spectrometry
MSA methanesulfonic acid
MTBE methyl-tert-butylether
226
NfAecue/Date Received 2023-02-08
MU methyltrityl
MW molecular weight
m/z mass-to-charge ratio
NEP neutral endopeptidase
NHS N-hydroxy succinimide
NPR natriuretic peptide receptor
OtBu tert-butyloxy
PBS phosphate buffered saline
PEG poly(ethylene glycol)
PFP pentafluorophenol
pH potentia Hydrogenii
Pr propyl
PyBOP benzotriazol-1-yl-oxytripyrrolidinophosphonium
hexafluorophosphate
Q-TOF quadrupole time-of-flight
qRT-PCR quantitative real-time polymerase chain reaction
RP-HPLC reversed-phase high performance liquid chromatography
rpm rounds per minute
rt room temperature
SIM single ion monitoring
SAP Systolic arterial pressure
SEC size exclusion chromatography
sc subcutaneous
Su succinirruidyl
T3P 2,4,6-tripropy1-1,3,5,2,4,6-trioxatriphosphorinane-2,4,6-
trioxi de
TCEP tris(2-carboxy ethyl)phosphine
TCP tritylchloride poly styro
TD thanatophoric dysplasia
TES triethylsilane
A trifluoroacetic acid
THF tetrahydrofuran
TIPS triisoproylsilane
Tmax Time of maximum concentration
TMEDA N,N,N"Nr-tetramethylethylene diamine
Tmob 2,4,6-trimethoxybenzyl
227
NfAecue/Date Received 2023-02-08
'1k-FRET time-resolved fluorescence energy transfer
Trt triphenylmethyl, trityl
UPLC ultra perfonnance liquid chromatography
UV ultraviolet
vs. versus
ZQ single quadrupole
228
NfAecue/Date Received 2023-02-08
