Note: Descriptions are shown in the official language in which they were submitted.
WO 2014/091034 PCT/EP2013/076760
1
Novel MHC-Independent Tumor-Associated Antigens
FIELD OF THE INVENTION
The present invention relates to novel tumor-associated antigens, which elicit
independently
from a presentation via MHC a CD8 positive T-cell response. GM-CSF-Receptor
alpha chain
(CSF2RA) and Tyrosinase-related protein 2 (TRP-2) were found to be targets of
CD8 positive
reactive T-cell clones which could detect the proteins on the surface of HLA I
negative mela-
noma cells. Thus, the invention provides proteins, protein fragments and
polypeptides of the
novel antigens for use in medicine, for example for the treatment, diagnosis
and prevention of
a tumor disease. Furthermore provided are nucleic acids expressing the
antigens of the inven-
tion, binding agents specific for the antigens of the invention, such as T-
cell receptor chains
and isolated T cells which are reactive against the antigens of the invention
or which express
the T-cell receptors of the invention. The invention further pertains to
pharmaceutical compo-
sitions, especially vaccine compositions, comprising the antigens, nucleic
acids, binding
agents or T cells in accordance with the invention, and methods for the
generation of T cells
specifically reactive to the antigens of the invention in an MHC-independent
manner.
DESCRIPTION
Cancer is still the main cause of death albeit the development of many
treatment strategies
including extensive radiation and chemotherapy. Furthermore, it is known that
tumor rejec-
tion mechanisms are mediated by autologous immune cells, especially T-cells,
which are able
to differentiate between cancerous cells and healthy cells by the detection of
tumor-associated
antigen (TAA)-fragments via major histocompatibility complex (MHC)
presentation. Anti-
gens which are specifically expressed in tumor cells and not in healthy tissue
can be catego-
rized into four types: (I) mutated antigens develop during tumorigenesis by
point mutations or
translocations within the tumor cells. Those antigens are strictly tumor-
specific. (II) can-
cer/germline antigens are usually expressed solely within the germ cells of an
adult organism
and not in healthy somatic tissue. In cancer cells, however, due to the loss
of epigenetic regu-
lation, germ-cell specific genes can be activated. (III) differentiation
antigens are expressed in
tumors and their healthy progenitor cells. CTL responses against such antigens
often result in
auto-immune reactions. (IV) overexpressed TAA show only minor expression in
healthy cells
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
2
whereas in a tumor those antigens are strongly activated. Human tumors usually
express anti-
gens of different categories and might even process and present distinct
peptides from each of
these proteins via their respective HLA class I and class II molecules.
MHC molecules in humans are normally referred to as HLA (human leukocyte
antigen) mol-
ecules. There are two principal classes of HLA molecules: class I and class
II. CD8-positive
T cells are usually cytotoxic (therefore named cytotoxic T cells = CTL),
recognize peptides of
9 to 10 amino acids which are intracellularly processed from proteins of any
subcellular local-
ization and which are presented on the cellular surface by HLA class I
molecules. In the field
of human cancer immunology, the last two decades have seen intensive efforts
to characterise
cancer-associated and cancer-specific antigens. Also, effort has been devoted
to the analysis
of antibodies to human tumor antigens. Such antibodies can be used for
diagnostic and thera-
peutic purposes, for instance in combination with an anti-cancer agent. In
addition, promising
approaches of vaccine therapies are currently developed based on MHC-class I
antigenic
fragments, there is still no satisfactory immune therapy available for most
cancer types.
To date only few examples are known for HLA/MHC-independent recognition of TAA
via
CD4- or CD8-positive T cells. Barnd and co-workers, 1989 PINTAS, described the
recognition
of epithelial mucin on breast and ovarian cancer cells. A HLA-independent
recognition was
further found for nickel-reactive CD8-positive T-cells in two patients
suffering from contact
dermatitis (Moulon et al., J Invest Dertnatol 2003), for a melanoma-reactive T-
cell clone
without identifying the responsible antigen (Somasundaram et al., J Transl Med
2005) and for
a kidney cell carcinoma-reactive T-cell clone (Wang et al., J Immunol 2008);
the antigen of
the latter was recently published (Hanada et al., Blood 2011).
Although a high number of HLA-restricted TAAs out of all four of the above
mentioned cate-
gories were identified in the past, still no satisfactory treatment based on a
therapeutic vac-
cination and adoptive transfer of antigen-specific T cells is available. This
is in part due to
problems with respect to reproducibility of the results in clinical studies or
to the observation
of an only insufficient clinical effect of the vaccine. A problem often
encountered in cancer
immunotherapy is further an impairment of the immunogenicity in cancer tissue.
This so-
called "immune escape" can be understood on the basis of phenotype differences
encountered
in neoplastic cells. For example, tumor cells show decreased ability to
process and present
antigens, have a decreased ability to stimulate autologous T cells, show
complete down-
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
3
regulation of immunogenic proteins associated with transformed cells and/or no
or low ex-
pression of leukocyte adhesion molecules or other accessory molecules and
selective down-
regulation of certain MHC class I and class II alleles. The latter may affect
all class I/II anti-
gens, or only part of them. Partial HLA loss of function or expression can be
caused by loss of
single HLA alleles, HLA haplotypes or complete HLA class I loss due to bi-
allelic 132m gene
loss (Aptsiauri et al., Cancer Inununol Inununother 2008; Bernal M. et al.
Cancer Immunol
Immunother 61:1359-71, 2012). Tumors that have lost the expression of HLA are
thus re-
sistant to any treatment based on HLA-dependent T cells. Indeed, impairment of
HLA func-
tion is one of the key "immune escape" mechanisms of tumor cells and thus
limits the applica-
tion of T-cell mediated immune therapy.
In view of the above described background art, the objective of the present
invention is to
provide novel tumor associated antigens (TAA) which allow for the development
of novel
treatments of cancer, and specifically novel treatments that circumvent the
problem of im-
mune escape in cancer cells.
In a first aspect of the present invention, the above objective is solved by
providing a protein,
protein fragment or polypeptide comprising at least 8 contiguous amino acids
from the amino
acid sequence of the GM-CSF-receptor alpha chain (CSF2RA) (SEQ ID No. 1) or
the tyrosi-
nase-related protein 2 (TRP-2) (SEQ ID No. 2), wherein said protein, protein
fragment or
polypeptide is capable of inducing a T-cell response and/or binding a cognate
T-cell receptor.
In another embodiment of the invention, the protein, protein fragment or
polypeptide com-
prises the amino acid sequence of a complex epitope of the native TRP-2 or
CSF2RA pro-
teins. A complex epitope in connection with the herein described invention is
a binding site
for an immunological binding agent, such as a T-cell receptor (TCR) or
antibody, which is
composed of two or more amino acid sequences which are in close spatial
proximity in the
native three-dimensional folded proteins, but which do not constitute one
contiguous se-
quence within the linear amino acid sequence of the antigen. A complex
epitope, for example,
can be composed of stretches of the amino acid sequences of two spatially
closely folded sec-
ondary structures within the antigen, or between two separate amino acid
chains of contacting
subunits of a multi protein complex.
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
4
The inventors surprisingly identified the proteins tyrosinase-related protein
2 (TRP-2) and
GM-CSF receptor alpha chain (CSF2RA) as molecules expressed in melanoma (TRP-
2) and
other malignant cell types (CSF2RA), which are recognized by T cells in an HLA-
independent manner. Thus, T cells against the antigens of the invention
provide the surprising
advantage to lyse tumors cells that are either completely negative for HLA
class I expression,
or at least show an impairment of HLA expression and/or function. Normally
such cells
would escape the patient's natural or a therapeutically induced immune
rejection.
The protein, protein fragment or polypeptide of the invention in an additional
embodiment
comprises at least 10, preferably 15, 20, 50, and most preferably 100
contiguous amino acids
from the amino acid sequence of GM-CSF-Receptor alpha chain (CSF2RA) (SEQ ID
No. 1)
or tyrosinase-related protein 2 (TRP-2) (SEQ ID No. 2), wherein said protein,
protein frag-
ment or polypeptide is capable of inducing a T-cell response and/or binding a
cognate T cell
receptor.
In the context of the present invention the terms "protein" or "polypeptide"
are used inter-
changeably and denote a polymer composed of amino acid monomers joined by
peptide
bonds. A "peptide bond" is a covalent bond between two amino acids in which
the a-amino
group of one amino acid is bonded to the a-carboxyl group of the other amino
acid. All amino
acid or polypeptide sequences, unless otherwise designated, are written from
the amino termi-
nus (N-terminus) to the carboxy terminus (C-terminus). The terms "protein",
"protein frag-
ment" and "polypeptide" refer to a molecular chain of amino acids, and do not
refer to a spe-
cific length of the product and if required can be modified in vivo or in
vitro, for example by
glycosylation, amidation, carboxylation or phosphorylation. Thus, inter alio
peptides, oligo-
peptides and proteins are included within the definition of polypeptide.
Of course, functional derivatives and fragments of the polypeptide, summarized
under the
term "protein fragment", are also included in the present invention.
Functional derivatives are
meant to include polypeptides which differ in one or more amino acids in the
overall se-
quence, which have deletions, substitutions, inversions, insertions or
additions. Amino acid
substitutions which can be expected not to essentially alter biological and
immunological ac-
tivities, have been described. Amino acid replacements between related amino
acids or re-
placements which have occurred frequently in evolution are inter alio Ser/Ala,
Ser/Gly,
Asp/Gly, Asp,/Asn, Ile/Val.
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
In addition, the term "functional derivatives" of these polypeptides also
implies the addition
salts of the polypeptides, amides of the polypeptides and specifically the C-
terminal amides,
esters and specifically the C-terminal esters and N-acyl derivatives
specifically N-terminal
acyl derivatives and N-acetyl derivatives.
In accordance with the present invention, the protein, protein fragment or
polypeptide is in a
preferred embodiment a protein, protein fragment or polypeptide comprising an
amino acid
sequence with at least 50%, 60%, 70%, 80%, 90%, 95%, most preferably 99% and
even more
preferably 100% sequence identity to the amino acid sequence of the proteins
GM-CSF recep-
tor alpha chain (CSF2RA) or tyrosinase-related protein 2 (TRP-2), specifically
to the amino
acid sequences as shown in SEQ ID No. 1 or 2.
In preferred embodiments protein fragments of the herein described antigens
are immunogen-
ic fragments, which still have the ability to induce an immunogenic response,
preferably in-
dependent of MHC class I and/or II.
In preferred embodiments of the invention the protein, protein fragment or
polypeptide con-
sists of the amino acid sequence shown in SEQ ID No. 1 or 2.
The polypeptides according to the invention can be produced either
synthetically or by re-
combinant DNA technology. Methods for producing synthetic polypeptides are
well known in
the art.
With the aid of the proteins, protein fragments or polypeptides in accordance
with the inven-
tion cytotoxic and helper T cells can be generated, which develop an antigen-
specific, MHC-
independent cytotoxic activity against tumor cells expressing proteins,
protein fragments or
polypeptides of the invention and destroy them. Therefore, these polypeptides
open up the
possibility of an effective tumor therapy, in the course of which the
suppression of an immune
reaction, which is often observed in tumor patients, can be reversed.
The invention also relates to a fusion protein composed of one of the
aforementioned proteins,
protein fragments or polypeptides and of a second protein or polypeptide. Such
fusion pro-
teins are suitable for use as a diagnostic or therapeutic or prophylactic
agent or generally for a
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
6
detection and/or manipulation of T cells that recognize TRP-2 or CSF2RA,
specifically inde-
pendent of their presentation via MHC. For example, fusion proteins could be
envisioned that
consist of a carrier protein such as, for example, HSA, collagen or other
proteins and one or
more of the polypeptides of the invention. The polynucleotides coding for this
fusion protein
are also the subject matter of the present invention.
Further provided is the protein, protein fragment or polypeptide in accordance
with the pre-
sent invention, which is characterized by the presence of a signal peptide
which mediates the
cellular transport of the molecule, when expressed in a cell, to the outside
of the cellular
membrane. Signal peptides are known to the person of skill in the art. More
preferably the
protein, protein fragment or polypeptide in accordance with the present
invention comprises a
domain capable of anchoring the molecule of the invention to the cellular
membrane. Such a
domain could be a membrane anchor or a transmembrane domain.
In one embodiment the protein, protein fragment or polypeptide according to
the invention is
characterized in that it is capable of inducing a major histocompatibility
complex (MHC) in-
dependent T-cell response, preferably a MHC class I independent T-cell
response, or a MHC
class I and II independent T-cell response; and/or the protein, protein
fragment or polypeptide
is characterized in that it is capable of binding a cognate T-cell receptor
expressed by a MHC
class I independent T cell or a MHC class I and II independent T cell.
Due to the surprising finding of the independence of the recognition of the
molecules of the
invention from HLA/MHC expression, it is one further preferred embodiment that
the protein,
protein fragment or polypeptide in accordance with the invention is not
presented by MHC
class I, or MHC class I and II. The protein, protein fragment or polypeptide
of the invention is
preferably expressed on the cellular surface without undergoing a
fragmentation as it is
known for the presentation of MHC-restricted antigens. Thus, the present
invention shall in a
preferred embodiment pertain to such a protein, protein fragment or
polypeptide which, when
expressed in an HLA/MHC-negative cell, still is able to induce a T-cell
response.
In the context of the various embodiments described herein, a protein, protein
fragment or
polypeptide shall not be excluded from the scope of the invention just because
in addition to
its capability to mediate a HLA-independent T-cell response, it still can be
processed and pre-
sented by the MHC/HLA pathway. Only in specific embodiments of the invention a
protein, a
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
7
protein fragment or polypeptide shall be excluded, when it consists of an
MHC/HLA class I
and/or II binding epitope.
One particularly preferred embodiment of the present invention relates to the
protein, protein
fragment or polypeptide according to the description herein before, for use in
medicine, spe-
cifically for use in a method of treatment of the human or animal body by
surgery or therapy,
or diagnostic methods practised on the human or animal body.
Further provided according to the present invention is the protein, protein
fragment or poly-
peptide as described herein, for use in the prevention, diagnosis or treatment
of a proliferative
disease, preferably wherein the proliferative disease is a tumor disease. A
preferred tumor
disease according to the invention is a tumor disease that is devoid of a
functional MHC class
I complex, or that is devoid of functional MHC class I and II complexes,
specifically such
tumors which do not express MHC class I, or do not express MHC class I and II.
Hence, the
protein, protein fragment or polypeptide as described herein are specifically
for use in the
prevention, diagnosis or treatment of a tumor which exhibit immune escape by
alteration of
the MHC class I and/or II presentation complex.
As used herein, the term "tumor " or "tumor disease" means both benign and
malignant tu-
mors or neoplasms and includes melanomas, lymphomas, leukemias, and sarcomas,
illustra-
tive examples of tumor tissues are cutaneous such as malignant melanomas and
mycosis fun-
goides; hematologic tumors such as leukemias, for example, acute
lymphoblastic, acute mye-
locytic, or chronic myelocytic leukemia; lymphomas such as Hodgkin's disease
or malignant
lymphoma; gynecologic tumors such as ovarian and uterine tumors; urologic
tumors such as
those of the prostate, bladder, or testis; soft tissue sarcomas, osseus, or
non-osseous sarcomas,
breast tumors; tumors of the pituitary, thyroid, and adrenal cortex;
gastrointestinal tumors
such as those of the esophagus, stomach, intestine, and colon; pancreatic and
hepatic tumors;
laryngeal papillomas/carcinomas and lung tumors.
In preferred embodiments the tumor to be treated, diagnosed or prevented is
characterized by
the expression of CSF2RA (SEQ ID No 1) and/or TRP-2 (SEQ ID No 2). Or tumors
express-
ing homologs of the aforementioned antigens, wherein a homolog is
characterized the se-
quence identity of at least 75, preferably 80, 90, or 95% compared to a
sequence as shown in
SEQ ID No. 1 or 2, respectively.
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
8
Furthermore, such tumors are preferred in accordance with the various
embodiments of the
invention which underwent, or are at risk of undergoing, immune escape
mechanisms by al-
tering the expression and/or function of the HLA complexes (either class I or
II or both) with-
in the tumor cell.
Preferred tumors of the present invention with respect of TRP-2 are tumors of
the skin, pref-
erably melanoma, or tumors of the central nervous system, preferably
glioblastoma.
On the other hand preferred tumors (or malignancies) of the present invention
with respect to
CSF2RA are tumors of the skin, such as melanoma, hematological malignancies
expressing
CSF2RA, such as leukemia, and solid tumors expressing CSFRA, such as lung
cancer, pan-
creatic cancer, colorectal cancer and ovarian cancer. Specifically preferred
in another embod-
iment is that the malignancy which expresses CSF2RA does not express CSF2RB,
or ex-
pressed CSF2RB to a significantly lower level than CSF2RA.
In a preferred embodiment of the present invention, the above described
protein, protein
fragment or polypeptide of the invention for use in medicine, or proteins used
within the here-
in described specific methods, are the full length proteins of CSF2RA and/or
TRP-2, possible
with minor amino acid changes of preferably not more than 50, 40, 30, 20,
preferably 10,
most preferably 5 amino acid residues compared to the sequences shown in SEQ
ID No. 1 or
2, respectively. Such sequence changes can be additions, deletions,
substitutions, inversions,
insertions or chemical modification of one or more amino acid residues.
In an additional aspect, the present invention further provides an isolated
nucleic acid mole-
cule, wherein said nucleic acid molecule (a) has a strand encoding for a
protein, protein frag-
ment or polypeptide according to the invention; (b) has a strand complementary
to the strand
in (a); or (c) has a strand that hybridizes under stringent conditions with a
molecule as de-
scribed in (a) or (b). Stringent conditions are known to the person of skill
in the art, specifical-
ly from Sambrook et al, "Molecular Cloning". In addition to that, the nucleic
acid optionally
has further sequences which are necessary for expressing the nucleic acid
sequence corre-
sponding to the protein, specifically for expression in a mammalian/human
cell. The nucleic
acid used can be contained in a vector suitable for allowing expression of the
nucleic acid
sequence corresponding to the peptide in a cell. However, the nucleic acids
can also be used
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
9
to trasnfect a presenting cell, which shall not be restricted to classical
antigen-presenting cells
such as dendritic cells, in such a way that they themselves produce the
corresponding proteins
on their cellular surface.
The nucleic acid molecules of the invention are preferably for use in
medicine.
Also provided is a vector or a cell comprising a nucleic acid molecule
described herein above,
specifically wherein the vector is for use in medicine. Also a cell comprising
a vector accord-
ing to the invention is provided.
Another aspect of the present invention is the use of at least one protein,
protein fragment or
polypeptide in accordance with the invention or a nucleic acid in accordance
with the inven-
tion for eliciting an immune reaction in connection with a tumor therapy or a
treatment for
preventing a tumor. Advantageous here is the fact that the frequently observed
immune es-
cape mechanisms and tolerance to TAA in a tumor disease can be overcome (or
reversed) by
the use of a protein, protein fragment or polypeptide, or nucleic acids in
accordance with the
invention. The use in accordance with the invention can also be employed in
addition to es-
tablished tumor therapies.
A preventive treatment in the context of the herein described invention is of
benefit possibly
mainly to persons who have an increased risk of developing a tumor, because,
for example,
they are hereditarily predisposed or because they have already had a tumor
before. In another
embodiment a preventive treatment is of benefit for a patient suffering from a
tumor disease
with increased risk of having developed or developing resistance to immune
rejection, by e.g.
immune escape via the alteration of the function and/or expression of HLA
class I/II com-
plexes.
Yet another aspect of the invention pertains to a binding agent, which binds
to a protein, pro-
tein fragment or polypeptide as described herein above, preferably wherein the
binding agent
is specific for said protein, protein fragment or polypeptide. In preferred
embodiments the
binding agents as described herein are for use in medicine.
In one embodiment the binding agent according to the invention is an antibody,
or a fragment
thereof. The term "antibody" in its various grammatical forms is used herein
to refer to im-
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
muno globulin molecules and immunologically active portions of immunoglobulin
molecules,
i.e., molecules that contain an antibody combining site or a paratope. Such
molecules are also
referred to as "antigen binding fragments" of immunoglobulin molecules.
Illustrative antibody
molecules are intact immunoglobulin molecules, substantially intact
immunoglobulin mole-
cules and those portions of an immunoglobulin molecule that contain the
paratope, including
those portions known in the art as Fab, Fab', F(ab')2 and F(v). Antibodies of
the present in-
vention may be monoclonal or polyclonal. The term antibody is also intended to
encompass
single chain antibodies, chimeric, humanized or primatized (CDR-grafted)
antibodies and the
like, as well as chimeric or CDR-grafted single chain antibodies, comprising
portions from
two different species. Immunological adjuvants for vaccines comprising
lecithin may be used
to stimulate antibody production.
In another embodiment the binding agent of the invention is a T-cell receptor
(TCR), or a
fragment thereof. A TCR is a heterodimeric cell surface protein of the
immunoglobulin super-
family which is associated with invariant proteins of the CD3 complex involved
in mediating
signal transduction. TCRs exist in al3 and yei forms, which are structurally
similar but have
quite distinct anatomical locations and probably functions. The extracellular
portion of native
heterodimeric uPTCR consists of two polypeptides, each of which has a membrane-
proximal
constant domain, and a membrane-distal variable domain. Each of the constant
and variable
domains includes an intra-chain disulfide bond. The variable domains contain
the highly pol-
ymorphic loops analogous to the complementarity determining regions (CDRs) of
antibodies.
In one preferred embodiment the TCR of the invention is characterized to
comprise a se-
quence according to any one of SEQ ID No. 3 to 8, or having a sequence that is
at least 75,
preferably 80, 90, or 95% identical any one of SEQ ID No. 3 to 8. Also
comprised are T cells
which express TCRs having a sequence according to any one of SEQ ID No. 3 to
8, or having
a sequence that is at least 75, preferably 80, 90, or 95% identical to SEQ ID
No. 3 to 8.
An antigen binding agent of the invention, preferable a TCR or antibody, is in
one embodi-
ment characterized by the presence of any one of, or preferably all, CDR 1 to
3 sequences as
depicted for the respective alpha or beta chains of the TCRs of the invention
in the figures and
table 1 below. In this embodiment it is also preferred that the TCR of the
invention is a chi-
merized TCR, for example, by exchanging completely or in part the original
human constant
domain with a murine constant domain (see figure 13). A preferred murinization
of the con-
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
11
stant domain is the exchange of at least the extracellular part of the
constant domain with mu-
rifle sequences.
One embodiment of the present invention pertains to an antigen binding
polypeptide compris-
ing at least one CDR sequences, preferably CDR3, more preferably CDR1, CDR2
and CDR3,
of any one of the TCR as isolated in context of the present invention and as
depicted in table 1
below.
Table 1: CDR sequences of the T-cell receptor clones of the invention. SEQ ID
NO are given
in ():
Target TCR Chain: CDR1 CDR2 CDR3
CSF2RA 1A.1/506 alpha DSAIYN (9) IQSSQRE(10) CAVGGNDYKLS(11)
CSF2RA 1A.1/506 beta ENHRY(12) SYGVKD (13) CAISEKLAGAYEQY(14)
TRP2 2C/417 alpha VS GNPY(15) YITGDNLV(16)
CAVRDMIEGGGNKLT(17)
TRP2 2C/417 beta MDHEN(18) SYDVKM(19) CASSRQGAVGQPQH(20)
CSF2RA 1A3/46 alpha T SDP SYG(21) QGSYDQQN(22) CAMRPHF GNEKLT (23)
CSF2RA 1A3/46 beta ENHRY(24) SYGVKD (25) CAISEKLAGAYEQY(26)
The antigen binding polypeptide of the invention is preferably a TCR.
Thus also preferred is a T cell receptor alpha chain comprising any one, or
all of, of the SEQ
ID NO: 9 to 11, or 15 to17, or 21 to 23.
Thus also preferred is a T cell receptor beta chain comprising any one, or all
of, of the SEQ
ID NO: 12 to 14, or 18 to 20, or 24 to 26.
Preferably a T-cell receptor of the invention, or a binding fragment thereof,
has an alpha chain
variable region comprising the CDR sequences of SEQ ID NO: 9, 10 and/or 11,
and a beta
chain variable region comprising the CDR sequences of SEQ ID NO: 12, 13 and/or
14. Such a
TCR is a TCR specific for the antigen CSF2RA. Preferably this TCR is the TCR
as isolated
from the CTL 1A.1/506 as described herein in the examples. Such a receptor may
in one em-
bodiment comprise the at least variable region, preferably full length,
sequence according to
SEQ ID No. 3 (alpha chain) and 4 (beta chain).
Preferably a T-cell receptor of the invention, or a binding fragment thereof,
has an alpha chain
variable region comprising the CDR sequences of SEQ ID NO: 21, 22 and/or 23,
and a beta
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
12
chain variable region comprising the CDR sequences of SEQ ID NO: 24, 25 and/or
26. Such a
TCR is a TCR specific for the antigen CSF2RA. Preferably this TCR is the TCR
as isolated
from the CTL 1A3/46 as described herein in the examples. Such a receptor may
in one em-
bodiment comprise the at least variable region, preferably full length,
sequence according to
SEQ ID No. 7 (alpha chain) and 8 (beta chain).
Preferably a T-cell receptor, or a binding fragment thereof, has an alpha
chain variable region
comprising the CDR sequences of SEQ ID NO: 15, 16 and/or 17, and a beta chain
variable
region comprising the CDR sequences of SEQ ID NO: 18, 19 and/or 20. Such a TCR
is a
TCR specific for the antigen TRP2. Preferably this TCR is the TCR as isolated
from the CTL
2C/417 as described as described herein in the examples. Such a receptor may
in one embod-
iment comprise the at least variable region, preferably full length, sequence
according to SEQ
ID No. 5 (alpha chain) and 6 (beta chain).
Yet another embodiment of the invention pertains to a single chain TCR (scTCR)
as a binding
agent, preferably an a3-scTCR. Single-chain TCRs (scTCRs) are artificial
constructs consist-
ing of a single amino acid strand. An scTCR can comprise a polypeptide of a
variable region
of a first TCR chain (e.g., an [alpha] chain) and a polypeptide of an entire
(full-length) second
TCR chain (e.g., a [beta] chain), or vice versa. Furthermore, the scTCR can
optionally com-
prise one or more linkers which join the two or more polypeptides together.
The linker can be,
for instance, a peptide which joins together two single chains, as described
herein. Such a
scTCR may be composed of any of the variable and/or constant region as
provided herein.
Also provided is such a scTCR of the invention, which is fused to a human
cytokine, such as
IL-2, IL-7 or IL-15.
The binding agent according to the invention can also be provided in the form
of a multimeric
complex, comprising at least two scTCR molecules, wherein said scTCR molecules
are each
fused to at least one biotin moiety, and wherein said scTCRs are
interconnected by biotin-
strepavidin interaction to allow the formation of said multimeric complex.
Also provided are
multimeric complexes of a higher order comprising more than two scTCR of the
invention.
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
13
In another preferred embodiment the binding agents of the invention is a bi-
specific monoclo-
nal antibody comprising the binding fragments of an antibody as described
herein above, and
the binding fragments of a second antibody which is, for example, specific for
CD3.
Another aspect of the present invention pertains to a nucleic acid encoding a
TCR or antigen
binding agent as described herein.
In a further aspect, the objective of the present invention is solved by
providing a T cell which
is reactive against any one of the proteins, protein fragments or polypeptides
according to the
invention, specifically against CSF2RA or TRP-2. In a preferred embodiment,
the T-cell of
the invention is reactive against the protein, protein fragment or polypeptide
according to the
invention independent of the presentation of said protein, protein fragment or
polypeptide by
MHC class I and/or class II. An even more preferred embodiment of the
invention provides a
T cell comprising a T-cell receptor (TCR) which binds to a protein, protein
fragment or poly-
peptide according to the invention, and wherein said binding is independent of
the presenta-
tion of said polypeptide by MHC class I or MHC class I and II. The T cell of
the invention is
preferably CD8 and/or CD4 positive.
Further provided according to the present invention is the use of a protein,
protein fragment or
polypeptide as described above, a nucleic acid as described above, a vector or
cell as de-
scribed above, a binding agent as described above, a T cell as described
above, a multimeric
complex as described above, in the preparation of a medicament for treating
cancer, or in the
preparation of a diagnostic for diagnosing cancer. The cancer may be a
mammalian cancer. In
particular, the cancer may be human cancer. For example, the cancer may be
breast cancer,
prostate cancer, pancreatic cancer, colorectal cancer, lung cancer, malignant
melanoma, leu-
kaemia, lymphoma, ovarian cancer, cervical cancer or a biliary tract
carcinoma. Specifically
preferred cancers are melanoma, glioblastoma or leukemia. Said medicament may
be a vac-
cine.
In another aspect the objective of the invention is further solved by an in-
vitro method for
generating MHC-independent T-cells, comprising the steps of
i. providing a first cell, preferably a tumor cell, that expresses a
protein, protein
fragment or polypeptide according to the invention as described herein above,
preferably wherein the polypeptide is a full-length CSF2RA or TRP-2,
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
14
bringing a population of peripheral blood mononuclear cells (PBMCs) into
contact with said first cell, and thereby stimulating said PBMCs, and
selecting out of the population of stimulated PBMCs T cells which have the
ability to recognize (or which are reactive against) a cell expressing the
protein,
protein fragment or polypeptide used in (i), independent of the expression of
MHC in said cell.
In this aspect, the MHC is preferably MHC class I and/or class II.
In one preferred embodiment of the method described above, said tumor cell and
said PBMCs
are autologous cells derived from one tumor patient. This embodiment has the
advantage that
MHC independent T cells can be generated for a tumor patient. Such T cells are
usable for re-
injection into the patient as a treatment-agent against the tumor the patient
is suffering from.
The above described method in one preferred embodiment comprises as said first
cell a cell
that does not express MHC class I, or MHC class I and 11, or that is at least
impaired in MHC
class I and/or II function and/or expression.
Yet a further preferred embodiment of the above described method is, when in
step (iii) said
ability of a T cell to recognize a cell expressing the protein, protein
fragment or polypeptide
used in (i) independent of the expression of MHC in said cell, is determined
by testing the
reactivity of said T cell against said cell expressing the protein, protein
fragment or polypep-
tide, wherein
(a) said cell expressing the protein, protein fragment or polypeptide is
devoid of
MHC class I or MHC class 1 and II, and/or
(b) said T cell is tested for its reactivity against said cell expressing
the protein,
protein fragment or polypeptide in the presence of antibodies against MHC
class I or II; and/or
(c) said T cell is tested for its reactivity against xenogenic cells
transfected with
DNA or RNA encoding the protein, protein fragment or polypeptide,
wherein in (a), (b) and/or (c) a T cell that shows reactivity is a T cell
having the ability to rec-
ognize a cell expressing the protein, protein fragment or polypeptide used in
(i) independent
of the expression of HLA/MHC in said cell.
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
Also provided are T cells which are generated by a method according to the
invention as de-
scribed herein above. Preferably, the T cell of the invention is for use in
medicine. Specifical-
ly, the T cell of the invention is for treating a patient suffering from a
malignant disease by
infusing said T cells into said patient, preferably wherein said T cells are
derived from autolo-
gous PBMCs of said patient.
A further aspect pertains to a pharmaceutical composition, comprising a
protein, protein
fragment or polypeptide according to the invention, or a nucleic acid, a
vector, a cell, a bind-
ing agent or an isolated T cell according to the invention. In a preferred
embodiment the
pharmaceutical composition is a vaccine.
Examples of pharmaceutically acceptable carriers or diluents useful in the
present invention
include stabilizers such as SPGA, carbohydrates (e.g. sorbitol, mannitol,
starch, sucrose, glu-
cose, dextran), proteins such as albumin or casein, protein containing agents
such as bovine
serum or skimmed milk and buffers (e.g. phosphate buffer).
Optionally, one or more compounds having adjuvant activity may be added to the
vaccine.
Suitable adjuvants are, for example, aluminium hydroxide, phosphate or oxide,
oil-emulsions
(e.g. of Bayol F<(R)> or Marcol 52<(R)>), saponins or vitamin-E solubilisate.
The vaccine according to the present invention can be given inter alia
intravenously, intraper-
itoneally, intranasally, intradermally, subcutaneously or intramuscularly.
The useful effective amount to be administered will vary depending on the age
and weight of
the patient and mode of administration of the vaccine.
The vaccine can be employed to specifically obtain a T-cell response, but it
is also possible
that a B-cell response is elicited after vaccination. If so, the B-cell
response leads to the for-
mation of antibodies against the protein, protein fragment or polypeptide of
the vaccine,
which antibodies will be directed to the source of the antigen production,
i.e. the tumor cells.
This is an advantageous feature, because in this way the tumor cells are
combatted by re-
sponses of both the cellular and the humoral arm of the immune system.
Both arms of immunological defence will even be more effectively triggered
when the vac-
cine comprises the antigens of the invention in an antigen-presenting cell,
independent of
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
16
MHC expression. Antigen presentation can be achieved by using monocytes,
macrophages,
interdigitating cells, Langerhans cells and especially dendritic cells, loaded
with one of the
antigens of the invention.
It is also possible to use cells already transfected with a cloning vehicle
harbouring the infor-
mation for the antigens of the invention. These cells will act as antigen-
presenting cells and
will present the full-length antigens of the invention, or fragments thereof,
on their surface in
an MHC-independent manner. Thus, in the context of the present invention it is
preferred to
express the antigens of the invention such, that they are transported to the
cellular surface of
the antigen-presenting cell.
Instead of a vaccination with these cells, which next to the desired
expression products also
harbour many elements which are also expressed and which can negatively affect
the desired
immunogenic reaction of the cell, it is also possible that a vaccine is
composed of liposomes
which are loaded with the proteins, protein fragments and polypeptides of the
invention, and
which thus expose these antigens to the host immune system. Such liposomes,
for instance,
are filled with lymphokines. Such liposomes will trigger an immunological T-
cell reaction.
By presenting the protein, protein fragment or peptide in the same way as it
is also presented
in vivo, an enhanced T-cell response will be evoked. Furthermore, by the
natural adjuvant
working of the relatively large antigen-presenting cells also a B-cell
response is triggered.
This B-cell response will a.o. lead to the formation of antibodies directed to
the native anti-
gen. This complex is especially found in tumor cells, where it has been shown
that the anti-
gens of the invention are presented naturally, which are thus able to elicit a
T-cell response. It
is this naturally occurring phenomenon which is enlarged by the vaccination
with cells al-
ready presenting the proteins, protein fragments or peptides of the invention.
By enlarging not
only an enlarged T-cell response will be evoked, but also a B-cell response
will be initiated
which leads to antibodies directed against the MHC-independent peptide.
The vaccines according to the invention can be enriched by numerous compounds
which have
an enhancing effect on the initiation and the maintenance of both the T-cell
and the B-cell
response after vaccination.
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
17
In this way addition of cytokines to the vaccine will enhance the T-cell
response. Suitable
cytokines are for instance interleukins, such as IL-2, IL-4, IL-7, IL-15 or IL-
12, GM-CSF,
RANTES, tumor necrosis factor and interferons, such as IFN-a, -13, or -y.
In a similar way, antibodies against T-cell surface antigens, such as CD2,
CD3, CTLA-4, PD-
1, CD27 and CD28 will enhance the immunogenic reaction.
Also the addition of helper epitopes to stimulate CD4<+> helper cells or
CD8<+> killer cells
augments the immunogenic reaction. Alternatively also helper epitopes from
other antigens
can be used, for instance from heat shock-derived proteins or cholera toxin.
Finally, the present invention relates to a method of treating a patient
suffering from a tumor
disease, comprising the administration of a therapeutically effective amount
of at least one
protein, protein fragment or polypeptide in accordance with the invention
and/or at least one
nucleic acid and/or at least one binding agent and/or at least one vector
molecule and/or at
least one T cell of the invention in an amount sufficient to achieve a
therapeutic effect. An-
other aspect is a method of eliciting a tumor-specific CTL response comprising
the admin-
istration of a response-eliciting amount of the MHC independent antigens in
accordance with
the invention (the proteins, protein fragments and polypeptides of the
invention). Target ma-
lignancies are those expressing CSF2RA and TRP-2.
The present invention will now be further described in the following examples
with reference
to the accompanying figures and sequences, nevertheless, without being limited
thereto. For
the purposes of the present invention, all references as cited herein are
incorporated by refer-
ence in their entireties. In the Figures and Sequences:
Figure 1: HLA class I-phenotyping of melanoma cell lines MA-MEL-86A, -86B, -
86C
und -86F, generated from distinct lymph node metastases of patient MA-MEL-
86 (schematic representation). MEL-86A expresses all HLA class 1 alleles of
the patient but turned out to be negative for the expression of melanocyte dif-
ferentiation antigens. Bi-allelic inactivations of the beta2-microglobulin
(B2m)
genes due to different mutations resulted in a complete loss of surface expres-
sion of HLA molecules in MA-MEL-86B and-F. MA-MEL-86C has lost ex-
pression of one (the "blue") HLA class I haplotype.
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
18
Figure 2: Recognition of different MA-MEL-86 melanoma lines by
independently gen-
erated Mixed Lymphocyte-Tumor cell Cultures (MLTC). Several different
MLTCs were generated by stimulation of peripheral blood mononuclear cells
(PBMC) with either melanoma line MA-MEL-86A (A) or -86C (B). MLTC re-
sponders (20.000/well) were then tested for recognition of MA-MEL-86A, -
86B and -86C (50.000 cells/well) as well as control cell lines by use of 20h-
IFN-y-ELISpot-Assays.
Figure 3: cDNA-library-screening using MLTC 1A.1. MLTC 1A.1 was applied to
the
screening of the cDNA expression library constructed from the MA-MEL-86A
cell line. Left part: Pictures show magnified sections of ELISpot plates
contain-
ing positive wells. Right part: Diagrams showing the results of the analyses
of
the assays. (A) Section of the ELISpot plate testing of pools of 100 cDNAs per
well comprising pools #701-796. After co-transfection of these cDNA pools
together with HLA-A*24:02-cDNA into 293T cells, MLTC 1A.1 recognized
transfectants expressing pool #709 (red circle). Pools of 10 cDNAs per well de-
rived from 100x pool #709 tested in the same way identified pools #39 and #51
as being recognized by the T cells (B). Pool #39 was chosen for further sub-
cloning. The subsequent testing of cDNA clones 709.39.1 to 709.39.96 identi-
fied cDNA-clone #18 as being recognized by MLTC 1A.1 (C). Targets: 293T
cells (20.000 cells/well), MA-MEL-86A (50.000 cells/well); T cells: MLTC
1A.1 (10.000 lymphocytes/well); transfected cDNAs: HLA-cDNA (100
ng/well); cDNA pools (300 ng/well); 20h-IFN-y-ELISpot-Assay. Sequencing
of cDNA clone #709.39.18 and Blast search with the derived sequences identi-
fied CSF2RA (the alpha chain of the GM-CSF-receptor) as recognized antigen.
The 1.831 bp long ORF of the #709.39.18-cDNA encodes for the transcript
variant 2 of the gene, the translation of which results in the iso form A of
the
CSF2RA protein.
Figure 4: Responses of CSF2RA-reactive CTL 1A.1/506 to different myeloid
cells iso-
lated from Buffy Coats (BC) of healthy donors. CTL 1A.1/506 (40,000
cells/well) was tested for recognition of Monocytes, Granulocytes and Dendrit-
ic cells (DC) (50,000 cells/well), the latter isolated and differentiated in
vitro
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
19
from PBMC of BC of four different healthy donors. The autologous melanoma
lines served as controls.
Figure 5: Recognition of cells of various species after transfection with
CSF2RA by CTL
1A.1/506. Human (K562, 293T), monkey (COS-7), and chinese hamster ovary
(CHO) cells were transiently transfectcd with CSF2RA and tested for recogni-
tion by CTL IA.1/506 using the IFN-y ELISpot assay. All reactions were test-
ed in duplicates.
Figure 6: Tumor recognition by CTL IA.1/506 with and without blocking
antibodies.
CTL 1A.1/506 (10.000 cells/well) was tested with an IFN-y-ELISpot-assay for
the recognition of MA-MEL-86B (50.000 cells/well). Monoclonal antibodies
(mAbs) specific for pan-HLA I, CD3 or CSF2RA were applied to block recog-
nition. Only mAbs binding to CSF2RA or the T-cell receptor (CD3) inhibited
the CTL response.
Figure 7: Cloning of the T-cell receptor (TCR) of CTL 1A.1/506. Cloning of
the TCR a-
and 13-chains was done according to the protocol published by Birkholz et al.
(J
Immunol Meth, 2009). TCR cDNA clones were sequenced and analyzed using
the IMGTNQuest database. TCR beta chains are composed of V (Variability)-,
D (Diversity)- and J (Joining)- segments, while alpha chains are made up by V
and J regions only. CDR (complementarity determining regions).
Figure 8: Recognition of cells of various species after transfection with
TRP-2 by CTL
2C/417. Human (K562, 293T, L721.221), monkey (COS-7), mouse (RMA/A2
#7, P815-TK-), and chinese hamster ovary (CHO) cells were transiently trans-
fected with TRP-2 and tested for recognition by CTL 2C/417 using the IFN-y
ELISpot assay. All reactions were tested in duplicates.
Figure 9: Detection of TRP-2 surface expression by Confocal Laser Scanning
Microsco-
py. 293T cells transfected with plasmids encoding membrane-bound pEYFP-
Mem (a) and human TRP-2 were cultured on microscope slides. TRP-2 was de-
tected with an Alexa 564-labeled polyclonal antibody against TRP-2 (b). The
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
3D confocal picture revealed that TRP-2 was detected as a transmembrane pro-
tein by this antibody (c).
Figure 10: Detection of TRP-2 surface expression by Confocal Laser Scanning
Microsco-
py using a TRP-2-a-BTX fusion protein. The 13 amino acids long a-BTX bind-
ing site binds a-Bungarotoxin with high affinity. An a-BTX-binding site en-
coding sequence was integrated at different positions in the sequence coding
for the extracellular portion of TRP-2 (A). MA-MEL-86A cells, cultured on
microscope slides, were transiently co-transfected with a plasmid encoding the
cell membrane tracking reagent pEYFP-Mem (a) and the TRP-2/aBTX-fusion
protein. After staining with fluorescently labeled a-Bungarotoxin (red fluores-
cence, b), and overlaying the two pictures, the cell surface expression of the
fu-
sion protein became evident (yellow fluorescence, c).
Figure 11: Recognition of TRP-2 by CTL 2C/417 requires that the protein
contains a
transmembrane domain (TMD). Full length (fl) TRP-2 cDNA or a TRP-2 vari-
ant lacking the TMD-coding sequence of the protein (TMDdel) were transfect-
ed into 293T cells and tested for recognition by CTL 2C/417 via the IFN-y
ELISpot assay. The deletion variant was not recognized (A). When the original
TMD-coding sequence was replaced by the TMD cloned from the HLA-A24-
cDNA and this replacement variant was transfected in comparison with the
TRP-2 fl-cDNA into 293T cells, the CTL recognized both variants (B). This
result further confirms that TRP-2 needs to be displayed on the cell surface
to
become recognized by the T cells. (C) Schematic representation of the recom-
binant TRP-2 containing the HLA-A24-TMD.
Figure 12: Cloning of the T cell receptor (TCR) of CTL 2C/417. Cloning of the
TCR a-
and 0-chains was done according to the protocol published by Birkholz et al.
(J
Immunol Meth, 2009). TCR cDNA clones were sequenced and analyzed using
the IMGTNQuest database. TCR beta chains are composed of V (Variability)-,
D (Diversity)- and J (Joining)- segments, while alpha chains are made up by V
and1 regions only. CDR (complementarity determining regions).
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
21
Figure 13: Cloning, expression and analysis of a native and chimerized TCR
isolated from
CTL 1A.3/46.
SEQ ID NO. 1 shows the amino acid sequence of CSF2RA:
MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQE
NTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQ
QKLLYF'NSGREGTAAQNFSCFIYNADLMNCTVVARGPTAPRDVQYFLYIRNSK
RRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDT
KKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQP
GTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSD
DGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEV
EDEIIWEEFTPEEGKGYREEVLTVKEIT
SEQ ID NO. 2 shows the amino acid sequence of TRP-2 (isoform 1)
MSPLWWGFLLSCLGCK1LPGAQGQFF'RVCMTVDSLVNKECCF'RLGAESAN VC
GSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGY
NCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDY
VITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAID
FSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQ
LFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQM
GRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNALEGFDKADGTLDSQV
MSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAW
PQELAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSYAIDLPVSVEETPGWPT
TLLVVMGTLVALVGLFVLLAFLQYRRLRKGYTPLMETHLSSKRYTEEA
SEQ ID NO. 3 shows the TCR alpha chain sequence of CTL 1A.1/506
METLLGPLILWLQLQWVSSKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQ
WFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQSGDSATY
LCAVGGNDYKLSFGAGTTVTVRANIQNSDPAVYQLRDSKSSDKSVCLFTDFD
SQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSI
IPEDTFFPSPESSCDVKLVEKSFETDINLNFQNLSVIGFRILLLKVAGFNLLMTL
RLWSS
SEQ ID NO. 4 shows the TCR beta chain sequence of clone CTL 1A.1/506
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
22
MGTRLFFYVALCLLWTGHMDAGITQ SPRHKVTETGTPVTLRCHQTENHRYM
YWYRQDP GHGLRLIHY SYGVKDTDKGEVS D GY SVS RSKTEDFLLTLE SAT SS
QT SVYF CAI S EKLAGAYE QYF GP GTRLTVTED LKNVFPPEVAVFEP SEAEI S HT
QKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALND SRYC
LSSRLRVSATFWQNPRNHFRCQVQFYGL S ENDEWT QDRAKPVTQ IV SAEAWG
RAD C GFTSESYQQ GVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG
SEQ ID NO. 5 shows the TCR alpha chain sequence of clone CTL 2C/417
MASAPISMLAMLFTLSGLRAQ SVAQPEDQVNVAEGNPLTVKCTYSVSGNPYL
FWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDS
ALYFCAVRDMIE GGGNKL TFGT GT QLKVELNIQNPDPAVYQLRD S KS SDKSV
CLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACA
NAFNN SIIPED TFFP SPE S S CDVKLVEKS FETDTNLNF QNL SVI GFRILLLKVAGF
NLLMTLRLWS S
SEQ ID NO. 6 shows the TCR beta chain sequence of clone CTL 2C/417
MG IRLL CRVAF C FLAVGLVDVKVT Q SSRYLVKRTGEKVFLECVQDMDHENM
FWYRQDPGLGLRLIYF SYDVKMKEKGDIPEGY SVSREKKERF S LILE SAS TNQT
S MYL CAS S RQGAVGQP QHF GD GTRL SILEDLNKVFPPEVAVFEP SEAEISHTQK
ATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSS
RLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
DCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF
SEQ ID NO. 7 shows the TCR alpha chain sequence of clone CTL 1A3/46
MSLSSLLKVVTASLWLGPGIAQKITQTQPGMFVQEKEAVTLDCTYDTSDPSYG
LFWYKQPSSGEMIFLIYQGSYDQQNATEGRY SLNFQKARKSANLVI SAS QLGD
SAMYF CAMRPHF GNEKLTFGTGTRLTIIPNI QNPDPAVYQLRD S KS SD KSV CLF
TDFDSQTNVS Q SKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANA
FNN S IIPEDTFFPS PE S S CDVKLVEKS FETDTNLNF QNL SVI GFRILLLKVAGFNL
LMTLRLWS S
SEQ ID NO. 8 shows the TCR beta chain sequence of clone CTL 1A3/46
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
23
MGTRLFFYVALCLLWTGHMDAGITQ SPRHKVTETGTPVTLRCHQTENHRYM
YWYRQDP GHGLRLIHY SYGVKDTDKGEVS D GY SVS RSKTEDFLLTLE SAT SS
QT SVYFCAISEKLAGAYEQYFGPGTRLTVTEDLKNVFPPEVAVFEP SEAEISHT
QKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYC
LSSRLRVSATFWQNPRNHFRCQVQFYGL S ENDEWT QDRAKPVTQ IV SAEAWG
RAD C GFTS E SYQ Q GVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG
SEQ ID NOs 9 to 26 show the CDR sequences of the TCR of the invention.
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
24
EXAMPLES
Example 1: Generation of Melanoma-Reactive CD8 Positive T Cells
Out of the melanoma patient MA-MEL-86 four different permanent tumor cell
lines (MA-
MEL-86A, -86B, -86C, -86F) were established from separate lymph node
metastases. Both
MA-MEL-86B and MA-MEL-86F did not express HLA I on their cellular surface due
to a
biallelic mutation in the 132-microglobulin gene. The tumor cell line MA-MEL-
86C lost one
HLA haplotype. In contrast thereto, the MA-MEL-86A line expressed all HLA I
alleles, but
showed as the only one out of the four tumor cell lines no expression of
melanosomal differ-
entiation antigens (Figure 1).
Tumor-reactive CD8 positive T cells were generated in so called mixed
lymphocyte- tumor
cell culture (MLTC) by weekly stimulation of lymphocytes taken from peripheral
blood mon-
onuclear cells, PBMCs, with autologous tumor cell lines MA-MEL-86A or MA-MEL-
86C.
Surprisingly, the inventors recognized that MLTC-responder lymphocytes in
varying recogni-
tion patterns still recognized the HLA I negative variants MA-MEL-86B (Figure
2) and MA-
MEL-86F. This was confirmed with clonal T cells (CTL) from these MLTCs. MLTCs
and
CTL clones were used for the identification of their target molecules.
Example 2: Identification of CSF2RA
A cDNA library of the melanoma cell line MEL-86A constructed in the eukaryotic
expression
vector pcDNA3.1 was screened with responder lymphocytes of MLTC 1A.1. In a
first step,
cDNA pools consisting of 100 cDNA clones were co-transfected with HLA I
alleles of the
patient into 293T-cells. The transfectants were tested for recognition by the
T cells. One of
the pools was found to be responsive. Subsequently, a step-by-step cDNA
cloning was per-
formed. In this way CSF2RA was identified as a target of the MLTC 1A.1 (Figure
3). Then T
cell clones were isolated which were able to detect the HLA I negative
melanoma cell variants
and which were directed against CSF2RA. In particular when looking at the
cross-reactivity
of T cells against CSF2RA, one recognizes the particularity of the antigen.
The CSF2RA-
reactive T cells were able to detect 60% of the available melanoma cells
lines, but also tumor
cell lines of pancreas, colon, lung, ovarian, gallbladder origin as well as
myeloid leukemias
(Table 2).
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
Analyzed tumor lines recognition .. / n tested
Melanomas 12/20
Pankreas carcinomas (PC) 2/2
Kidney carcinomas (RCC) 0/5
Acute myeloid Leukemias (AML) 5/13
Chronic myelogenous Leukemias (CML) 0/11
Colorectal carcinomas (CRC) 1/6
Lung carcinomas 1/4
Breast carcinoma 0/1
Ovarian carcinoma 1/1
Gallbladder carcinoma 1/1
Gliobla stoma 0/11
Table 2: Allogeneic tumor lines recognized by the CSF2RA-reactive CTL
1A.1/506.
On the other hand, all tested normal cell lines, amongst others melanocytes,
granulocytes and
monocytes, derived from peripheral blood, were not recognized by the CSF2RA-
reactive T
cells (see Figure 4). The purity of the cell preparations were tested in
advance via flow cy-
tometry. Furthermore, subsequent to a transfection with CSF2RA, cell lines
from different
species could be detected by the CSF2RA-reactive T cells (see Figure 5). A co-
transfection
with HLA I was not necessary.
Using flow cytometry the inventors furthermore showed that all CSF2RA-reactive
T-cells
were TCRaf3 positive, CD3 positive and CD8 positive, and expressed the T cell
receptor beta
chain V1312 (TRBV10-3). The reactivity of these T cells could only be
inhibited by antibodies
against CD3 or CSF2RA, but not with antibodies against HLA I or II (see Figure
6).
cDNAs of the alpha and the beta chain of the TCR of the HLA-independent CSF2RA-
reactive
T-cell clone 1A.1/506 were cloned and sequenced (see Figure 7, SEQ ID No. 3
and 4).
Example 3: Identification of TRP-2
In panel test 40 cDNA clones which encode known melanoma-associated antigens,
were
transfected into 293T cells. The transfectants were subsequently tested for
recognition by re-
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
26
sponder lymphocytes of MLTCs 1C and 2C. It was found that both MLTCs and CTL
clones
derived thereof could recognize the HLA I negative tumor cell lines MA-MEL-86B
and -86F
and targeted the melanosomal differentiation antigen TRP-2. They cross-reacted
with any of
the TRP-2-expressing melanoma cell lines available in the laboratory as well
as with normal
melanocytes, and - after transfection with TRP-2 - also with non-melanocytic
cells of mouse,
hamster and monkey origin (see Figure 8). A co-transfection of HLA I molecules
was not
necessary. The HLA-independent TRP-2 reactive T cells recognized also murine
melanoma
cells and murine TRP-2 after transfection.
Using flow cytometry the inventors furthermore showed that all TRP-2-reactive
T cells were
TCRc43 positive, CD3 positive and CD8 positive, and expressed the T-cell
receptor beta chain
VI33 (TRBV28). The reactivity of these T cells could only be inhibited by
antibodies against
CD3, but not by antibodies against HLA I or II.
The direct recognition of TRP-2 by CD8 positive T cells would require the cell
surface ex-
pression of the antigen. Indeed the inventors could show cell surface
expression with a TRP-2
reactive antibody (see Figure 9). For a clear-cut evidence of TRP-2 on the
surface of human
melanoma cells, the inventors used recombinant DNA technology to modify TRP-2
with a 13
amino acid-long alpha-bungarotoxin recognition site. This site is able to bind
the neurotoxin
alpha-BTX with high affinity and specificity. Using alpha-BTX coupled to a
fluorochrome,
visualization of the TRP-2 fusion protein on the cell surface of transfectants
became possible
(see Figure 10).
This result was further supported by the finding that a deletion of the
transmembrane domain
(TMD)of TRP-2 resulted in a loss of the recognition by the T cells, which
could be reversed
by the substitution with an unrelated TMD of HLA-A*24:01 (see Figure 11).
cDNAs of the alpha and the beta chain of the TCR of the HLA-independent TRP-2-
reactive
T-cell clone 2C/417 were cloned and their function was tested via transfer
into CD8 positive
T cells of PBMCs of a healthy donor (SEQ ID No. 5 and 6; Figure 12).
Example 4: Cloning, ectopic expression and functional analysis of a second
CSF2RA-
specific a/b T cell receptor.
Date Recue/Date Received 2021-02-08
WO 2014/091034 PCT/EP2013/076760
27
The a- and b T cell receptor chain- (TCR-) cDNAs were isolated from the CSF2RA-
specific
CTL 1A.3/46 and cloned as a bicistronic construct into a retroviral vector
(Figure 13A). Sub-
sequently, the human constant domains were replaced by murine TCR-constant
domains
(õchimerized" or "murinized") to minimize pairing of transduced with
endogenous TCR-
chains after ectopic expression in human T cells.
Cell surface expression of the CSF2RA-specific TCR in human T cells transduced
with the
native (left) and the chimerized (right) constructs is shown in Figure 13B.
The percentage of
TCR-Vb12-positive T cells in untransduced PBMCs in this sample was < 3% (not
shown).
In a response analysis of the CSF2RA-reactive CTL 1A.3/44 in comparison to
CSF2RA-
TCR-transduced allogeneic T cells CSF2RA-negative target cells (MA-MEL-86F and
293T)
were not recognized while MA-MEL-86B cells expressing CSF2RA endogenously and
293T
cells transfected with the antigen were recognized (Figure 13C). T cells
transduced with the
chimerized TCR showed a response comparable to that of the CSF2RA-reactive CTL
1A.3/44
and significantly higher reactivity than T cells transduced with the õnative"
TCR construct.
Date Recue/Date Received 2021-02-08
