Sélection de la langue

Search

Sommaire du brevet 2377536 

Énoncé de désistement de responsabilité concernant l'information provenant de tiers

Une partie des informations de ce site Web a été fournie par des sources externes. Le gouvernement du Canada n'assume aucune responsabilité concernant la précision, l'actualité ou la fiabilité des informations fournies par les sources externes. Les utilisateurs qui désirent employer cette information devraient consulter directement la source des informations. Le contenu fourni par les sources externes n'est pas assujetti aux exigences sur les langues officielles, la protection des renseignements personnels et l'accessibilité.

Disponibilité de l'Abrégé et des Revendications

L'apparition de différences dans le texte et l'image des Revendications et de l'Abrégé dépend du moment auquel le document est publié. Les textes des Revendications et de l'Abrégé sont affichés :

  • lorsque la demande peut être examinée par le public;
  • lorsque le brevet est émis (délivrance).
(12) Demande de brevet: (11) CA 2377536
(54) Titre français: NOUVEAUX COMPOSES
(54) Titre anglais: NOVEL COMPOUNDS
Statut: Réputée abandonnée et au-delà du délai pour le rétablissement - en attente de la réponse à l’avis de communication rejetée
Données bibliographiques
(51) Classification internationale des brevets (CIB):
  • C12N 15/31 (2006.01)
  • A61K 39/00 (2006.01)
  • A61K 39/02 (2006.01)
  • C07K 14/21 (2006.01)
  • C07K 16/12 (2006.01)
  • C12N 15/62 (2006.01)
  • G01N 33/53 (2006.01)
(72) Inventeurs :
  • THONNARD, JOELLE (Belgique)
(73) Titulaires :
  • SMITHKLINE BEECHAM BIOLOGICALS S.A.
(71) Demandeurs :
  • SMITHKLINE BEECHAM BIOLOGICALS S.A. (Belgique)
(74) Agent: BORDEN LADNER GERVAIS LLP
(74) Co-agent:
(45) Délivré:
(86) Date de dépôt PCT: 2000-06-23
(87) Mise à la disponibilité du public: 2001-01-04
Licence disponible: S.O.
Cédé au domaine public: S.O.
(25) Langue des documents déposés: Anglais

Traité de coopération en matière de brevets (PCT): Oui
(86) Numéro de la demande PCT: PCT/EP2000/005851
(87) Numéro de publication internationale PCT: EP2000005851
(85) Entrée nationale: 2001-12-20

(30) Données de priorité de la demande:
Numéro de la demande Pays / territoire Date
9915044.3 (Royaume-Uni) 1999-06-25

Abrégés

Abrégé français

L'invention concerne des polypeptides BASB113 et des polynucléotides codant pour ces polypeptides BASB113 ainsi que des méthodes de production de ces polypeptides au moyen de techniques de recombinaison. L'invention concerne également leurs utilisations à des fins diagnostiques, prophylactiques et thérapeutiques.


Abrégé anglais


The invention provides BASB113 polypeptides and polynucleotides encoding
BASB113 polypeptides and methods for producing such polypeptides by
recombinant techniques. Also provided are diagnostic, prophylactic and
therapeutic uses.

Revendications

Note : Les revendications sont présentées dans la langue officielle dans laquelle elles ont été soumises.


CLAIMS:
1. An isolated polypeptide comprising an amino acid sequence which has at
least 85%
identity to the amino acid sequence selected from the group consisting of SEQ
ID NO:2
and SEQ ID NO:4, over the entire length of SEQ ID NO:2 or SEQ ID NO:4
respectively.
2. An isolated polypeptide as claimed in claim 1 in which the amino acid
sequence has at
least 95% identity to the amino acid sequence selected from the group
consisting of: SEQ
ID NO:2 and SEQ ID NO:4, over the entire length of SEQ ID NO:2 or SEQ ID NO:4
respectively.
3. The polypeptide as claimed in claim 1 comprising the amino acid sequence
selected
from the group consisting of: SEQ ID NO:2 and SEQ ID NO:4.
4. An isolated polypeptide of SEQ ID NO:2 or SEQ ID NO:4.
5. An immunogenic fragment of a polypeptide as claimed in any one of claims 1
to 4
in which the immunogenic fragment is capable of raising an immune response (if
necessary when coupled to a carrier) which recognises the polypeptide of SEQ
ID
NO:2 or SEQ ID NO:4.
6. A polypeptide as claimed in any of claims 1 to 5 wherein said polypeptide
is part of a
larger fusion protein.
7. An isolated polynucleotide encoding a polypeptide as claimed in any of
claims 1 to 6.
8. An isolated polynucleotide comprising a nucleotide sequence encoding a
polypeptide
that has at least 85% identity to the amino acid sequence of SEQ ID NO:2 or 4
over the
entire length of SEQ ID NO:2 or 4 respectively; or a nucleotide sequence
complementary to
said isolated polynucleotide.
69

9. An isolated polynucleotide comprising a nucleotide sequence that has at
least 85%
identity to a nucleotide sequence encoding a polypeptide of SEQ ID NO:2 or 4
over the
entire coding region; or a nucleotide sequence complementary to said isolated
polynucleotide.
10. An isolated polynucleotide which comprises a nucleotide sequence which has
at least
85% identity to that of SEQ ID NO:1 or 3 over the entire length of SEQ ID NO:1
or 3
respectively; or a nucleotide sequence complementary to said isolated
polynucleotide.
11. The isolated polynucleotide as claimed in any one of claims 7 to 10 in
which the
identity is at least 95% to SEQ ID NO:1 or 3.
12. An isolated polynucleotide comprising a nucleotide sequence encoding the
polypeptide
of SEQ ID NO:2 or SEQ ID NO:4.
13. An isolated polynucleotide comprising the polynucleotide of SEQ ID NO: 1
or SEQ
ID NO:3.
14. An isolated polynucleotide comprising a nucleotide sequence encoding the
polypeptide
of SEQ ID NO:2, SEQ ID NO:4 obtainable by screening an appropriate library
under
stringent hybridization conditions with a labeled probe having the sequence of
SEQ ID
NO: 1 or SEQ ID NO:3 or a fragment thereof.
15. An expression vector or a recombinant live microorganism comprising an
isolated
polynucleotide according to any one of claims 7 - 14.
16. A host cell comprising the expression vector of claim 15 or a subcellular
fraction or a
membrane of said host cell expressing an isolated polypeptide comprising an
amino acid

sequence that has at least 85% identity to the amino acid sequence selected
from the group
consisting of SEQ ID NO:2 and SEQ ID NO:4.
17. A process for producing a polypeptide of claims 1 to 6 comprising
culturing a host
cell of claim 16 under conditions sufficient for the production of said
polypeptide and
recovering the polypeptide from the culture medium.
18. A process for expressing a polynucleotide of any one of claims 7 - 14
comprising
transforming a host cell with the expression vector comprising at least one of
said
polynucleotides and culturing said host cell under conditions sufficient for
expression of
any one of said polynucleotides.
19. A vaccine composition comprising an effective amount of the polypeptide of
any
one of claims 1 to 6 and a pharmaceutically acceptable carrier.
20. A vaccine composition comprising an effective amount of the polynucleotide
of any
one of claims 7 to 14 and a pharmaceutically effective carrier.
21. The vaccine composition according to either one of claims 19 or 20 wherein
said
composition comprises at least one other Moraxella catarrhalis antigen.
22. An antibody immunospecific for the polypeptide or immunological fragment
as
claimed in any one of claims 1 to 6.
23. A method of diagnosing a Moraxella catarrhalis infection, comprising
identifying a
polypeptide as claimed in any one of claims 1 - 6, or an antibody that is
immunospecific
for said polypeptide, present within a biological sample from an animal
suspected of
having such an infection.
71

24. Use of a composition comprising an immunologically effective amount of a
polypeptide as claimed in any one of claims 1 - 6 in the preparation of a
medicament for
use in generating an immune response in an animal.
25. Use of a composition comprising an immunologically effective amount of a
polynucleotide as claimed in any one of claims 7 - 14 in the preparation of a
medicament
for use in generating an immune response in an animal.
26. A therapeutic composition useful in treating humans with Moraxella
cararrhalis
disease comprising at least one antibody directed against the polypeptide of
claims 1- 6
and a suitable pharmaceutical carrier.
72

Description

Note : Les descriptions sont présentées dans la langue officielle dans laquelle elles ont été soumises.


CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Novel Compounds
FIELD OF THE INVENTION
This invention relates to polynucleotides, (herein referred to as " BASB 113
polynucleotide(s)" ), polypeptides encoded by them (referred to herein as "
BASB 113" or
"BASB 113 polypeptide(s)" ), recombinant materials and methods for their
production. In
another aspect, the invention relates to methods for using such polypeptides
and
polynucleotides, including vaccines against bacterial infections. In a further
aspect, the
invention relates to diagnostic assays for detecting infection of certain
pathogens.
BACKGROUND OF THE INVENTION
Moraxella catarrhalis (also named Branhamella catarrhalis) is a Gram negative
bacteria
frequently isolated from the human upper respiratory tract. It is responsible
for several
pathologies the main ones being otitis media in infants and children, and
pneumonia in
elderlies. It is also responsible of sinusitis, nosocomial infections and less
frequently of
invasive diseases.
Otitis media is an important childhood disease both by the number of cases and
its potential
sequelae. More than 3.5 millions cases are recorded every year in the United
States, and it is
estimated that 80 % of the children have experienced at least one episode of
otitis before
reaching the age of 3 (Klein, JO (1994) Clin.Inf.Dis 19:823). Left untreated,
or becoming
chronic, this disease may lead to hearing losses that could be temporary (in
the case of fluid
accumulation in the middle ear) or permanent (if the auditive nerve is
damaged). In infants,
such hearing losses may be responsible for a delayed speech learning.
Three bacterial species are primarily isolated from the middle ear of children
with otitis
media: Streptococcus pneumoniae, non typeable Haemophilus influenza (NTHi) and
M.
catarrhalis. They are present in 60 to 90 % of the cases. A review of recent
studies shows
that S pneumoniae and NTHi represent both about 30 %, and M. catarrhalis about
15 % of

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
the otitis media cases (Murphy, TF (1996) Microbiol.Rev. 60:267). Other
bacteria could be
isolated from the middle ear (H. influenza type B, S. pyogenes etc) but at a
much lower
frequency (2 % of the cases or less).
Epidemiological data indicate that, for the pathogens found in the middle ear,
the
colonization of the upper respiratory tract is an absolute prerequisite for
the development of
an otitis; other are however also required to lead to the disease (Dickinson,
DP et al. (1988)
J. Infect.Dis. 158:205, Faden, HL et al. (1991) Ann.Otorhinol.Laryngol.
100:612). These are
important to trigger the migration of the bacteria into the middle ear via the
Eustachian
tubes, followed by the initiation of an inflammatory process. These factors
are unknown
todate. It has been postulated that a transient anomaly of the immune system
following a
viral infection, for example, could cause an inability to control the
colonization of the
respiratory tract (Faden, HL et al (1994) J. Infect.Dis. 169:1312). An
alternative explanation
is that the exposure to environmental factors allow a more important
colonization of some
children, who subsequently become susceptible to the development of otitis
media because
of the sustained presence of middle ear pathogens (Murphy, TF ( 1996)
Microbiol.Rev.
60:267).
The immune response to M. catarrhalis is poorly characterized. The analysis of
strains
isolated sequentially from the nasopharynx of babies followed from 0 to 2
years of age,
indicates that they get and eliminate frequently new strains. This indicates
that an
efficacious immune response against this bacteria is mounted by the colonized
children
(Faden, HL et al (1994) J. Infect.Dis. 169:1312).
In most adults tested, bactericidal antibodies have been identified (Chapman,
AJ et al.
(1980 J. Infect.Dis. 151:878). Strains ofM. catarrhalis present variations in
their capacity
to resist serum bactericidal activity: in general, isolates from diseased
individuals are more
resistant than those who are simply colonized (Hol, C et al. (1993) Lancet
341:1281, Jordan,
KL et al. (1990) Am.J.Med. 88 (suppl. SA):28S). Serum resistance could
therfore be
2

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
considered as a virulence factor of the bacteria. An opsonizing activity has
been observed in
the sera of children recovering from otitis media.
The antigens targetted by these different immune responses in humans have not
been
identified, with the exception of OMP B 1, a 84 kDa protein which expression
is regulated
by iron, and that is recognized by the sera of patients with pneumonia (Sethi,
S, et al. (1995)
Infect.Immun. 63:1516) , and of UspAl and UspA2 (Chen D. et al.(1999),
Infect.Immun.
67:1310).
A few other membrane proteins present on the surface of M. catarrhalis have
been
characterized using biochemical method, or for their potential implication in
the induction of
a protective immunity (for review, see Murphy, TF (1996) Microbiol.Rev.
60:267). In a
mouse pneumonia model, the presence of antibodies raised against some of them
(UspA,
CopB) favors a faster clearance of the pulmonary infection. Another
polypeptide (OMP CD)
is highly conserved among M. catarrhalis strains, and presents homologies with
a porin of
Pseudomonas aeruginosa, which has been demonstrated efficacious against this
bacterium
in animal models.
The frequency of Moraxella catarrhalis infections has risen dramatically in
the past few
decades. This has been attributed to the emergence of multiply antibiotic
resistant strains
and an increasing population of people with weakened immune systems. It is no
longer
uncommon to isolate Moraxella catarrhalis strains that are resistant to some
or all of the
standard antibiotics. This phenomenon has created an unmet medical need and
demand for
new anti-microbial agents, vaccines, drug screening methods, and diagnostic
tests for this
organism.
SUMMARY OF THE INVENTION

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
The present invention relates to BASB 113, in particular BASB 113 polypeptides
and
BASB 113 polynucleotides, recombinant materials and methods for their
production. In
another aspect, the invention relates to methods for using such polypeptides
and
polynucleotides, including prevention and treatment of microbial diseases,
amongst others.
In a further aspect, the invention relates to diagnostic assays for detecting
diseases
associated with microbial infections and conditions associated with such
infections, such
as assays for detecting expression or activity of BASB 113 polynucleotides or
polypeptides.
Various changes and modifications within the spirit and scope of the disclosed
invention
will become readily apparent to those skilled in the art from reading the
following
descriptions and from reading the other parts of the present disclosure.
DESCRIPTION OF THE INVENTION
The invention relates to BASB 113 polypeptides and polynucleotides as
described in
greater detail below. In particular, the invention relates to polypeptides and
polynucleotides of BASB 113 of Moraxella catarrhalis, which have the
characteristics of
an outer membrane protein (or a polynucleotide encoding an outer membrane
protein) and
in particular a lipoprotein. ). BASB 113 polypeptides are thus surface exposed
proteins
and useful vaccine candidates. BASB 113 is found to be related by amino acid
sequence
homology to the c-terminal part of Pseudomonas fluorescens outer membrane
protein F
precursor (OrpF). The invention relates especially to BASB 113 having the
nucleotide and
amino acid sequences set out in SEQ ID NO:1 or 3 and SEQ ID N0:2 or 4
respectively. It
is understood that sequences recited in the Sequence Listing below as "DNA"
represent
an exemplification of one embodiment of the invention, since those of ordinary
skill
will recognize that such sequences can be usefully employed in polynucleotides
in
general, including ribopolynucleotides.
4

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Polypeptides
In one aspect of the invention there are provided polypeptides of Moraxella
catarrhalis
referred to herein as "BASB 113" and "BASB 113 polypeptides" as well as
biologically,
diagnostically, prophylactically, clinically or therapeutically useful
variants thereof, and
compositions comprising the same.
The present invention further provides for:
(a) an isolated polypeptide which comprises an amino acid sequence which has
at least
85% identity, preferably at least 90% identity, more preferably at least 95%
identity, most
preferably at least 97-99% or exact identity, to that of SEQ ID N0:2 or 4;
(b) a polypeptide encoded by an isolated polynucleotide comprising a
polynucleotide
sequence which has at least 85% identity, preferably at least 90% identity,
more
preferably at least 95% identity, even more preferably at least 97-99% or
exact identity to
SEQ ID NO: l or 3 over the entire length of SEQ ID NO:1 or 3 respectively; or
(c) a polypeptide encoded by an isolated polynucleotide comprising a
polynucleotide
sequence encoding a polypeptide which has at least 85% identity, preferably at
least 90%
identity, more preferably at least 95% identity, even more preferably at least
97-99% or
exact identity, to the amino acid sequence of SEQ ID N0:2 or 4.
The BASB 113 polypeptides provided in SEQ ID N0:2 or 4 are the BASB 113
polypeptides from Moraxella catarrhalis strain Mc2931 (ATCC 43617).
The invention also provides an immunogenic fragment of a BASB 113 polypeptide,
that
is, a contiguous portion of the BASB 113 polypeptide which has the same or
substantially
the same immunogenic activity as the polypeptide comprising the amino acid
sequence of
SEQ ID N0:2 or 4; That is to say, the fragment (if necessary when coupled to a
carrier) is
capable of raising an immune response which recognises the BASB 113
polypeptide.
Such an immunogenic fragment may include, for example, the BASB 113
polypeptide

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
lacking an N-terminal leader sequence, and/or a transmembrane domain and/or a
C-
terminal anchor domain. In a preferred aspect the immunogenic fragment of BASB
113
according to the invention comprises substantially all of the extracellular
domain of a
polypeptide which has at least 85% identity, preferably at least 90% identity,
more
preferably at least 95% identity, most preferably at least 97-99% identity, to
that of SEQ
ID N0:2 or 4 over the entire length of SEQ ID N0:2 or 4 respectively.
A fragment is a polypeptide having an amino acid sequence that is entirely the
same as part
but not all of any amino acid sequence of any polypeptide of the invention. As
with
BASB 113 polypeptides, fragments may be "free-standing," or comprised within a
larger
polypeptide of which they form a part or region, most preferably as a single
continuous
region in a single larger polypeptide.
Preferred fragments include, for example, truncation polypeptides having a
portion of an
amino acid sequence of SEQ ID N0:2 or 4 or of variants thereof, such as a
continuous series
of residues that includes an amino- and/or carboxyl-terminal amino acid
sequence.
Degradation forms of the polypeptides of the invention produced by or in a
host cell, are
also preferred. Further preferred are fragments characterized by structural or
functional
attributes such as fragments that comprise alpha-helix and alpha-helix forming
regions,
beta-sheet and beta-sheet-forming regions, turn and turn-forming regions, coil
and coil-
forming regions, hydrophilic regions, hydrophobic regions, alpha amphipathic
regions, beta
amphipathic regions, flexible regions, surface-forming regions, substrate
binding region, and
high antigenic index regions.
Further preferred fragments include an isolated polypeptide comprising an
amino acid
sequence having at least 15, 20, 30, 40, 50 or 100 contiguous amino acids from
the
amino acid sequence of SEQ ID N0:2 or 4, or an isolated polypeptide comprising
an
amino acid sequence having at least 15, 20, 30, 40, 50 or 100 contiguous amino
acids
truncated or deleted from the amino acid sequence of SEQ ID N0:2 or 4.
6

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Fragments of the polypeptides of the invention may be employed for producing
the
corresponding full-length polypeptide by peptide synthesis; therefore, these
fragments
may be employed as intermediates for producing the full-length polypeptides of
the
invention.
Particularly preferred are variants in which several, 5-10, 1-5, 1-3, 1-2 or 1
amino acids
are substituted, deleted, or added in any combination.
The polypeptides, or immunogenic fragments, of the invention may be in the
form of
the "mature" protein or may be a part of a larger protein such as a precursor
or a fusion
protein. It is often advantageous to include an additional amino acid sequence
which
contains secretory or leader sequences, pro-sequences, sequences which aid in
purification such as multiple histidine residues, or an additional sequence
for stability
during recombinant production. Furthermore, addition of exogenous polypeptide
or
lipid tail or polynucleotide sequences to increase the immunogenic potential
of the final
molecule is also considered.
In one aspect, the invention relates to genetically engineered soluble fusion
proteins
comprising a polypeptide of the present invention, or a fragment thereof, and
various
portions of the constant regions of heavy or light chains of immunoglobulins
of various
subclasses (IgG, IgM, IgA, IgE). Preferred as an immunoglobulin is the
constant part of
the heavy chain of human IgG, particularly IgGl, where fusion takes place at
the hinge
region. In a particular embodiment, the Fc part can be removed simply by
incorporation
of a cleavage sequence which can be cleaved with blood clotting factor Xa.
Furthermore, this invention relates to processes for the preparation of these
fusion
proteins by genetic engineering, and to the use thereof for drug screening,
diagnosis and
therapy. A further aspect of the invention also relates to polynucleotides
encoding such
7

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
fusion proteins. Examples of fusion protein technology can be found in
International
Patent Application Nos. W094/29458 and W094/22914.
The proteins may be chemically conjugated, or expressed as recombinant fusion
proteins allowing increased levels to be produced in an expression system as
compared
to non-fused protein. The fusion partner may assist in providing T helper
epitopes
(immunological fusion partner), preferably T helper epitopes recognised by
humans, or
assist in expressing the protein (expression enhancer) at higher yields than
the native
recombinant protein. Preferably the fusion partner will be both an
immunological
fusion partner and expression enhancing partner.
Fusion partners include protein D from Haemophilus influenzae and the non-
structural
protein from influenzae virus, NS 1 (hemagglutinin). Another fusion partner is
the
protein known as LytA. Preferably the C terminal portion of the molecule is
used. Lyta
is derived from Streptococcus pneumoniae which synthesize an N-acetyl-L-
alanine
amidase, amidase LytA, (coded by the lytA gene {Gene, 43 (1986) page 265-272})
an
autolysin that specifically degrades certain bonds in the peptidoglycan
backbone. The
C-terminal domain of the LytA protein is responsible for the affinity to the
choline or to
some choline analogues such as DEAF. This property has been exploited for the
development of E.coli C-LytA expressing plasmids useful for expression of
fusion
proteins. Purification of hybrid proteins containing the C-LytA fragment at
its amino
terminus has been described {Biotechnology: 10, (1992) page 795-798}. It is
possible
to use the repeat portion of the LytA molecule found in the C terminal end
starting at
residue 178, for example residues 188 - 305.
The present invention also includes variants of the aforementioned
polypeptides, that is
polypeptides that vary from the referents by conservative amino acid
substitutions,
whereby a residue is substituted by another with like characteristics. Typical
such
substitutions are among Ala, Val, Leu and Ile; among Ser and Thr; among the
acidic

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
residues Asp and Glu; among Asn and Gln; and among the basic residues Lys and
Arg; or
aromatic residues Phe and Tyr.
Polypeptides of the present invention can be prepared in any suitable manner.
Such
polypeptides include isolated naturally occurring polypeptides, recombinantly
produced
polypeptides, synthetically produced polypeptides, or polypeptides produced by
a
combination of these methods. Means for preparing such polypeptides are well
understood in the art.
It is most preferred that a polypeptide of the invention is derived from
Moraxella
catarrhalis, however, it may preferably be obtained from other organisms of
the same
taxonomic genus. A polypeptide of the invention may also be obtained, for
example, from
organisms of the same taxonomic family or order.
Polynucleotides
It is an obj ect of the invention to provide polynucleotides that encode BASB
113
polypeptides, particularly polynucleotides that encode the polypeptide herein
designated
BASB 113.
In a particularly preferred embodiment of the invention the polynucleotide
comprises a
region encoding BASB 113 polypeptides comprising a sequence set out in SEQ ID
NO:1 or
3 which includes a full length gene, or a variant thereof.
The BASB 113 polynucleotides provided in SEQ ID NO:1 or 3 are the BASB 113
polynucleotides from Moraxella catarrhalis strain Mc2931 (ATCC 43617).
As a further aspect of the invention there are provided isolated nucleic acid
molecules
encoding and/or expressing BASB 113 polypeptides and polynucleotides,
particularly
Moraxella catarrhalis BASB 113 polypeptides and polynucleotides, including,
for
9

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
example, unprocessed RNAs, ribozyme RNAs, mRNAs, cDNAs, genomic DNAs, B-
and Z-DNAs. Further embodiments of the invention include biologically,
diagnostically, prophylactically, clinically or therapeutically useful
polynucleotides and
polypeptides, and variants thereof, and compositions comprising the same.
Another aspect of the invention relates to isolated polynucleotides, including
at least one full
length gene, that encodes a BASB 113 polypeptide having a deduced amino acid
sequence of
SEQ ID N0:2 or 4 and polynucleotides closely related thereto and variants
thereof.
In another particularly preferred embodiment of the invention there is a BASB
113
polypeptide from Moraxella catarrhalis comprising or consisting of an amino
acid
sequence of SEQ ID N0:2 or 4 or a variant thereof.
Using the information provided herein, such as a polynucleotide sequence set
out in SEQ ID
NO:1 or 3, a polynucleotide of the invention encoding BASB 113 polypeptide may
be
obtained using standard cloning and screening methods, such as those for
cloning and
sequencing chromosomal DNA fragments from bacteria using Moraxella catarrhalis
Catlin
cells as starting material, followed by obtaining a full length clone. For
example, to obtain a
polynucleotide sequence of the invention, such as a polynucleotide sequence
given in
SEQ ID NO:1 or 3, typically a library of clones of chromosomal DNA of
Moraxella
catarrhalis Catlin in E.coli or some other suitable host is probed with a
radiolabeled
oligonucleotide, preferably a 17-mer or longer, derived from a partial
sequence. Clones
carrying DNA identical to that of the probe can then be distinguished using
stringent
hybridization conditions. By sequencing the individual clones thus identified
by
hybridization with sequencing primers designed from the original polypeptide
or
polynucleotide sequence it is then possible to extend the polynucleotide
sequence in both
directions to determine a full length gene sequence. Conveniently, such
sequencing is
performed, for example, using denatured double stranded DNA prepared from a
plasmid
clone. Suitable techniques are described by Maniatis, T., Fritsch, E.F. and
Sambrook et

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
al., MOLECULAR CLONING, A LABORATORYMANUAL, 2nd Ed.; Cold Spring Harbor
Laboratory Press, Cold Spring Harbor, New York (1989). (see in particular
Screening By
Hybridization 1.90 and Sequencing Denatured Double-Stranded DNA Templates
13.70).
Direct genomic DNA sequencing may also be performed to obtain a full length
gene
sequence. Illustrative of the invention, each polynucleotide set out in SEQ ID
NO:1 or 3
was discovered in a DNA library derived from Moraxella catarrhalis.
Moreover, each DNA sequence set out in SEQ ID NO:1 or 3 contains an open
reading frame
encoding a protein having about the number of amino acid residues set forth in
SEQ ID
N0:2 or 4 with a deduced molecular weight that can be calculated using amino
acid residue
molecular weight values well known to those skilled in the art.
The polynucleotide of SEQ ID NO:1, between the start codon at nucleotide
number l and
the stop codon which begins at nucleotide number 673 of SEQ ID NO:1, encodes
the
polypeptide of SEQ ID N0:2.
The polynucleotide of SEQ ID N0:3, between the start codon at nucleotide
number l and
the stop codon which begins at nucleotide number 670 of SEQ ID N0:3, encodes
the
polypeptide of SEQ ID N0:4.
In a further aspect, the present invention provides for an isolated
polynucleotide
comprising or consisting o~
(a) a polynucleotide sequence which has at least 85% identity, preferably at
least 90%
identity, more preferably at least 95% identity, even more preferably at least
97-99% or
exact identity to SEQ ID NO:1 or 3 over the entire length of SEQ ID NO: l or 3
respectively; or
(b) a polynucleotide sequence encoding a polypeptide which has at least 85%
identity,
preferably at least 90% identity, more preferably at least 95% identity, even
more
preferably at least 97-99% or 100% exact, to the amino acid sequence of SEQ ID
N0:2
or 4, over the entire length of SEQ ID N0:2 or 4 respectively.
11

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
A polynucleotide encoding a polypeptide of the present invention, including
homologs and
orthologs from species other than Moraxella catarrhalis, may be obtained by a
process
which comprises the steps of screening an appropriate library under stringent
hybridization
conditions (for example, using a temperature in the range of 45 - 65°C
and an SDS
concentration from 0.1 - 1 %) with a labeled or detectable probe consisting of
or comprising
the sequence of SEQ ID NO: l or 3 or a fragment thereof; and isolating a full-
length gene
and/or genomic clones containing said polynucleotide sequence.
The invention provides a polynucleotide sequence identical over its entire
length to a coding
sequence (open reading frame) in SEQ ID NO:1 or 3. Also provided by the
invention is a
coding sequence for a mature polypeptide or a fragment thereof, by itself as
well as a coding
sequence for a mature polypeptide or a fragment in reading frame with another
coding
sequence, such as a sequence encoding a leader or secretory sequence, a pre-,
or pro- or
prepro-protein sequence. The polynucleotide of the invention may also contain
at least one
non-coding sequence, including for example, but not limited to at least one
non-coding 5'
and 3' sequence, such as the transcribed but non-translated sequences,
termination signals
(such as rho-dependent and rho-independent termination signals), ribosome
binding sites,
Kozak sequences, sequences that stabilize mRNA, introns, and polyadenylation
signals.
The polynucleotide sequence may also comprise additional coding sequence
encoding
additional amino acids. For example, a marker sequence that facilitates
purification of the
fused polypeptide can be encoded. In certain embodiments of the invention, the
marker
sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen,
Inc.) and
described in Gentz et al., Proc. Natl. Acad. Sci., USA 86: 821-824 (1989), or
an HA peptide
tag (Wilson et al., Cell 37: 767 (1984), both of which may be useful in
purifying
polypeptide sequence fused to them. Polynucleotides of the invention also
include, but are
not limited to, polynucleotides comprising a structural gene and its naturally
associated
sequences that control gene expression.
12

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
The nucleotide sequence encoding BASB 113 polypeptide of SEQ ID N0:2 or 4 may
be
identical to the polypeptide encoding sequence contained in nucleotides 1 to
672 of SEQ
ID NO:1 or the polypeptide encoding sequence contained in nucleotides 1 to 669
of SEQ
ID N0:3 respectively. Alternatively it may be a sequence, which as a result of
the
redundancy (degeneracy) of the genetic code, also encodes the polypeptide of
SEQ ID
N0:2 or 4.
The term "polynucleotide encoding a polypeptide" as used herein encompasses
polynucleotides that include a sequence encoding a polypeptide of the
invention,
particularly a bacterial polypeptide and more particularly a polypeptide of
the Moraxella
catarrhalis BASB 113 having an amino acid sequence set out in SEQ ID N0:2 or
4. The
term also encompasses polynucleotides that include a single continuous region
or
discontinuous regions encoding the polypeptide (for example, polynucleotides
interrupted
by integrated phage, an integrated insertion sequence, an integrated vector
sequence, an
integrated transposon sequence, or due to RNA editing or genomic DNA
reorganization)
together with additional regions, that also may contain coding and/or non-
coding sequences.
The invention further relates to variants of the polynucleotides described
herein that encode
variants of a polypeptide having a deduced amino acid sequence of SEQ ID N0:2
or 4
Fragments of polynucleotides of the invention may be used, for example, to
synthesize full-
length polynucleotides of the invention.
Further particularly preferred embodiments are polynucleotides encoding BASB
113
variants, that have the amino acid sequence of BASB 113 polypeptide of SEQ ID
N0:2 or 4
in which several, a few, 5 to 10, 1 to 5, 1 to 3, 2, 1 or no amino acid
residues are substituted,
modified, deleted and/or added, in any combination. Especially preferred among
these are
silent substitutions, additions and deletions, that do not alter the
properties and activities of
BASB 113 polypeptide.
13

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Further preferred embodiments of the invention are polynucleotides that are at
least 85%
identical over their entire length to a polynucleotide encoding BASB 113
polypeptide having
an amino acid sequence set out in SEQ ID N0:2 or 4, and polynucleotides that
are
complementary to such polynucleotides. Alternatively, most highly preferred
are
polynucleotides that comprise a region that is at least 90% identical over its
entire length to
a polynucleotide encoding BASB 113 polypeptide and polynucleotides
complementary
thereto. In this regard, polynucleotides at least 95% identical over their
entire length to the
same are particularly preferred. Furthermore, those with at least 97% are
highly preferred
among those with at least 95%, and among these those with at least 98% and at
least 99%
are particularly highly preferred, with at least 99% being the more preferred.
Preferred embodiments are polynucleotides encoding polypeptides that retain
substantially
the same biological function or activity as the mature polypeptide encoded by
a DNA of
SEQ ID NO:1 or 3.
In accordance with certain preferred embodiments of this invention there are
provided
polynucleotides that hybridize, particularly under stringent conditions, to
BASB 113
polynucleotide sequences, such as those polynucleotides in SEQ ID NO: l or 3
The invention further relates to polynucleotides that hybridize to the
polynucleotide
sequences provided herein. In this regard, the invention especially relates to
polynucleotides
that hybridize under stringent conditions to the polynucleotides described
herein. As herein
used, the terms "stringent conditions" and "stringent hybridization
conditions" mean
hybridization occurring only if there is at least 95% and preferably at least
97% identity
between the sequences. A specific example of stringent hybridization
conditions is
overnight incubation at 42°C in a solution comprising: 50% formamide,
Sx SSC (150mM
NaCI, lSmM trisodium citrate), 50 mM sodium phosphate (pH7.6), Sx Denhardt's
solution, 10% dextran sulfate, and 20 micrograms/ml of denatured, sheared
salmon sperm
DNA, followed by washing the hybridization support in O.lx SSC at about
65°C.
14

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Hybridization and wash conditions are well known and exemplified in Sambrook,
et al.,
Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor,
N.Y.,
( 1989), particularly Chapter 11 therein. Solution hybridization may also be
used with the
polynucleotide sequences provided by the invention.
The invention also provides a polynucleotide consisting of or comprising a
polynucleotide
sequence obtained by screening an appropriate library containing the complete
gene for a
polynucleotide sequence set forth in SEQ ID NO:1 or 3 under stringent
hybridization
conditions with a probe having the sequence of said polynucleotide sequence
set forth in
SEQ ID NO:1 or 3 or a fragment thereof; and isolating said polynucleotide
sequence.
Fragments useful for obtaining such a polynucleotide include, for example,
probes and
primers fully described elsewhere herein.
As discussed elsewhere herein regarding polynucleotide assays of the
invention, for
instance, the polynucleotides of the invention, may be used as a hybridization
probe for
RNA, cDNA and genomic DNA to isolate full-length cDNAs and genomic clones
encoding
BASB 113 and to isolate cDNA and genomic clones of other genes that have a
high identity,
particularly high sequence identity, to the BASB 113 gene. Such probes
generally will
comprise at least 15 nucleotide residues or base pairs. Preferably, such
probes will have at
least 30 nucleotide residues or base pairs and may have at least 50 nucleotide
residues or
base pairs. Particularly preferred probes will have at least 20 nucleotide
residues or base
pairs and will have less than 30 nucleotide residues or base pairs.
A coding region of a BASB 113 gene may be isolated by screening using a DNA
sequence
provided in SEQ ID NO:1 or 3 to synthesize an oligonucleotide probe. A labeled
oligonucleotide having a sequence complementary to that of a gene of the
invention is then
used to screen a library of cDNA, genomic DNA or mRNA to determine which
members of
the library the probe hybridizes to.

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
There are several methods available and well known to those skilled in the art
to obtain
full-length DNAs, or extend short DNAs, for example those based on the method
of Rapid
Amplification of cDNA ends (RACE) (see, for example, Frohman, et al., PNAS USA
8~:
8998-9002, 1988). Recent modifications of the technique, exemplified by the
MarathonTM
technology (Clontech Laboratories Inc.) for example, have significantly
simplified the
search for longer cDNAs. In the MarathonTM technology, cDNAs have been
prepared
from mRNA extracted from a chosen tissue and an 'adaptor' sequence ligated
onto each
end. Nucleic acid amplification (PCR) is then carried out to amplify the
"missing" 5' end
of the DNA using a combination of gene specific and adaptor specific
oligonucleotide
primers. The PCR reaction is then repeated using "nested" primers, that is,
primers
designed to anneal within the amplified product (typically an adaptor specific
primer that
anneals further 3' in the adaptor sequence and a gene specific primer that
anneals further ~'
in the selected gene sequence). The products of this reaction can then be
analyzed by
DNA sequencing and a full-length DNA constructed either by joining the product
directly
to the existing DNA to give a complete sequence, or carrying out a separate
full-length
PCR using the new sequence information for the design of the 5' primer.
The polynucleotides and polypeptides of the invention may be employed, for
example, as
research reagents and materials for discovery of treatments of and diagnostics
for diseases,
particularly human diseases, as further discussed herein relating to
polynucleotide assays.
The polynucleotides of the invention that are oligonucleotides derived from a
sequence of
SEQ ID NOS:1 or 3 may be used in the processes herein as described, but
preferably for
PCR, to determine whether or not the polynucleotides identified herein in
whole or in part
are transcribed in bacteria in infected tissue. It is recognized that such
sequences will also
have utility in diagnosis of the stage of infection and type of infection the
pathogen has
attained.
16

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
The invention also provides polynucleotides that encode a polypeptide that is
the mature
protein plus additional amino or carboxyl-terminal amino acids, or amino acids
interior to
the mature polypeptide (when the mature form has more than one polypeptide
chain, for
instance). Such sequences may play a role in processing of a protein from
precursor to a
mature form, may allow protein transport, may lengthen or shorten protein half
life or may
facilitate manipulation of a protein for assay or production, among other
things. As
generally is the case in vivo, the additional amino acids may be processed
away from the
mature protein by cellular enzymes.
For each and every polynucleotide of the invention there is provided a
polynucleotide
complementary to it. It is preferred that these complementary polynucleotides
are fully
complementary to each polynucleotide with which they are complementary.
A precursor protein, having a mature form of the polypeptide fused to one or
more
prosequences may be an inactive form of the polypeptide. When prosequences are
removed
such inactive precursors generally are activated. Some or all of the
prosequences may be
removed before activation. Generally, such precursors are called proproteins.
In addition to the standard A, G, C, T/U representations for nucleotides, the
term "N" may
also be used in describing certain polynucleotides of the invention. "N" means
that any of
the four DNA or RNA nucleotides may appear at such a designated position in
the DNA
or RNA sequence, except it is preferred that N is not a nucleic acid that when
taken in
combination with adjacent nucleotide positions, when read in the correct
reading frame,
would have the effect of generating a premature termination codon in such
reading frame.
In sum, a polynucleotide of the invention may encode a mature protein, a
mature protein
plus a leader sequence (which may be referred to as a preprotein), a precursor
of a mature
protein having one or more prosequences that are not the leader sequences of a
preprotein,
or a preproprotein, which is a precursor to a proprotein, having a leader
sequence and one or
17

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
more prosequences, which generally are removed during processing steps that
produce
active and mature forms of the polypeptide.
In accordance with an aspect of the invention, there is provided the use of a
polynucleotide of the invention for therapeutic or prophylactic purposes, in
particular
genetic immunization.
The use of a polynucleotide of the invention in genetic immunization will
preferably
employ a suitable delivery method such as direct injection of plasmid DNA into
muscles
(Wolff et al., Hum Mol Genet (1992) 1: 363, Manthorpe et al., Hum. Gene Ther.
(1983) 4:
419), delivery of DNA complexed with specific protein carriers (Wu et al.,
JBiol Chem.
(1989) 264: 16985), coprecipitation of DNA with calcium phosphate (Benvenisty
&
Reshef, PNAS USA, (1986) 83: 9551), encapsulation of DNA in various forms of
liposomes (Kaneda et al., Science (1989) 243: 375), particle bombardment (Tang
et al.,
Nature (1992) 356:152, Eisenbraun et al., DNA Cell Biol (1993) 12: 791) and in
vivo
infection using cloned retroviral vectors (Seeger et al., PNAS USA (1984) 81:
5849).
Vectors, Host Cells, Expression Systems
The invention also relates to vectors that comprise a polynucleotide or
polynucleotides of
the invention, host cells that are genetically engineered with vectors of the
invention and the
production of polypeptides of the invention by recombinant techniques. Cell-
free
translation systems can also be employed to produce such proteins using RNAs
derived
from the DNA constructs of the invention.
Recombinant polypeptides of the present invention may be prepared by processes
well
known in those skilled in the art from genetically engineered host cells
comprising
expression systems. Accordingly, in a further aspect, the present invention
relates to
expression systems that comprise a polynucleotide or polynucleotides of the
present
18

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
invention, to host cells which are genetically engineered with such expression
systems, and
to the production of polypeptides of the invention by recombinant techniques.
For recombinant production of the polypeptides of the invention, host cells
can be
genetically engineered to incorporate expression systems or portions thereof
or
polynucleotides of the invention. Introduction of a polynucleotide into the
host cell can be
effected by methods described in many standard laboratory manuals, such as
Davis, et al.,
BASIC METHODSINMOLECULAR BIOLOGY, (1986) and Sambrook, et al.,
MOLECULAR CLONING: A LABORATORYMANUAL, 2nd Ed., Cold Spring Harbor
Laboratory Press, Cold Spring Harbor, N.Y. (1989), such as, calcium phosphate
transfection, DEAF-dextran mediated transfection, transvection,
microinjection, cationic
lipid-mediated transfection, electroporation, transduction, scrape loading,
ballistic
introduction and infection.
Representative examples of appropriate hosts include bacterial cells, such as
cells of
streptococci, staphylococci, enterococci, E coli, streptomyces, cyanobacteria,
Bacillus
subtilis, Neisseria meningitides and Moraxella catarrhalis; fungal cells, such
as cells of a
yeast, Kluveromyces, Saccharomyces, a basidiomycete, Candida albicans and
Aspergillus;
insect cells such as cells of Drosophila S2 and Spodoptera Sue; animal cells
such as CHO,
COS, HeLa, C 127, 3T3, BHK, 293, CV-l and Bowes melanoma cells; and plant
cells, such
as cells of a gymnosperm or angiosperm.
A great variety of expression systems can be used to produce the polypeptides
of the
invention. Such vectors include, among others, chromosomal-, episomal- and
virus-derived
vectors, for example, vectors derived from bacterial plasmids, from
bacteriophage, from
transposons, from yeast episomes, from insertion elements, from yeast
chromosomal
elements, from viruses such as baculoviruses, papova viruses, such as SV40,
vaccinia
viruses, adenoviruses, fowl pox viruses, pseudorabies viruses, picornaviruses,
retroviruses,
and alphaviruses and vectors derived from combinations thereof, such as those
derived from
19

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
plasmid and bacteriophage genetic elements, such as cosmids and phagemids. The
expression system constructs may contain control regions that regulate as well
as engender
expression. Generally, any system or vector suitable to maintain, propagate or
express
polynucleotides and/or to express a polypeptide in a host may be used for
expression in this
regard. The appropriate DNA sequence may be inserted into the expression
system by any
of a variety of well-known and routine techniques, such as, for example, those
set forth in
Sambrook et al., MOLECULAR CLONING, A LABORATORYMANUAL, (supra).
In recombinant expression systems in eukaryotes, for secretion of a translated
protein into
the lumen of the endoplasmic reticulum, into the periplasmic space or into the
extracellular
environment, appropriate secretion signals may be incorporated into the
expressed
polypeptide. These signals may be endogenous to the polypeptide or they may be
heterologous signals.
Polypeptides of the present invention can be recovered and purified from
recombinant
cell cultures by well-known methods including ammonium sulfate or ethanol
precipitation, acid extraction, anion or cation exchange chromatography,
phosphocellulose
chromatography, hydrophobic interaction chromatography, affinity
chromatography,
hydroxylapatite chromatography and lectin chromatography. Most preferably, ion
metal
amity chromatography (IMAC) is employed for purification. Well known
techniques
for refolding proteins may be employed to regenerate active conformation when
the
polypeptide is denatured during intracellular synthesis, isolation and or
purification.
The expression system may also be a recombinant live microorganism, such as a
virus
or bacterium. The gene of interest can be inserted into the genome of a live
recombinant
virus or bacterium. Inoculation and in vivo infection with this live vector
will lead to in
vivo expression of the antigen and induction of immune responses. Viruses and
bacteria
used for this purpose are for instance: poxviruses (e.g; vaccinia, fowlpox,
canarypox),
alphaviruses (Sindbis virus, Semliki Forest Virus, Venezuelian Equine
Encephalitis

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Virus), adenoviruses, adeno-associated virus, picornaviruses (poliovirus,
rhinovirus),
herpesviruses (varicella zoster virus, etc), Listeria, Salmonella , Shigella,
BCG. These
viruses and bacteria can be virulent, or attenuated in various ways in order
to obtain live
vaccines. Such live vaccines also form part of the invention.
Diagnostic, Prognostic, Serotyping and Mutation Assays
This invention is also related to the use of BASB 113 polynucleotides and
polypeptides of
the invention for use as diagnostic reagents. Detection of BASB 113
polynucleotides and/or
polypeptides in a eukaryote, particularly a mammal, and especially a human,
will provide a
diagnostic method for diagnosis of disease, staging of disease or response of
an infectious
organism to drugs. Eukaryotes, particularly mammals, and especially humans,
particularly
those infected or suspected to be infected with an organism comprising the
BASB 113 gene
or protein, may be detected at the nucleic acid or amino acid level by a
variety of well
known techniques as well as by methods provided herein.
Polypeptides and polynucleotides for prognosis, diagnosis or other analysis
may be obtained
from a putatively infected and/or infected individual's bodily materials.
Polynucleotides
from any of these sources, particularly DNA or RNA, may be used directly for
detection or
may be amplified enzymatically by using PCR or any other amplification
technique prior to
analysis. RNA, particularly mRNA, cDNA and genomic DNA may also be used in the
same ways. Using amplification, characterization of the species and strain of
infectious or
resident organism present in an individual, may be made by an analysis of the
genotype of a
selected polynucleotide of the organism. Deletions and insertions can be
detected by a
change in size of the amplified product in comparison to a genotype of a
reference sequence
selected from a related organism, preferably a different species of the same
genus or a
different strain of the same species. Point mutations can be identified by
hybridizing
amplified DNA to labeled BASB 113 polynucleotide sequences. Perfectly or
significantly
matched sequences can be distinguished from imperfectly or more significantly
mismatched
duplexes by DNase or RNase digestion, for DNA or RNA respectively, or by
detecting
21

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
differences in melting temperatures or renaturation kinetics. Polynucleotide
sequence
differences may also be detected by alterations in the electrophoretic
mobility of
polynucleotide fragments in gels as compared to a reference sequence. This may
be carned
out with or without denaturing agents. Polynucleotide differences may also be
detected by
direct DNA or RNA sequencing. See, for example, Myers et al., Science, 230:
1242 (1985).
Sequence changes at specific locations also may be revealed by nuclease
protection assays,
such as RNase, V l and S 1 protection assay or a chemical cleavage method.
See, for
example, Cotton et al., Proc. Natl. Acad. Sci., USA, 85: 4397-4401 (1985).
In another embodiment, an array of oligonucleotides probes comprising BASB I
13
nucleotide sequence or fragments thereof can be constructed to conduct
efficient screening
of, for example, genetic mutations, serotype, taxonomic classification or
identification.
Array technology methods are well known and have general applicability and can
be used to
address a variety of questions in molecular genetics including gene
expression, genetic
linkage, and genetic variability (see, for example, Chee et al., Science, 274:
610 (1996)).
Thus in another aspect, the present invention relates to a diagnostic kit
which comprises:
(a) a polynucleotide of the present invention, preferably the nucleotide
sequence of SEQ
ID NO:1 or 3, or a fragment thereof ;
(b) a nucleotide sequence complementary to that of (a);
(c) a polypeptide of the present invention, preferably the polypeptide of SEQ
ID N0:2 or
4 or a fragment thereof; or
(d) an antibody to a polypeptide of the present invention, preferably to the
polypeptide of
SEQ ID N0:2 or 4.
It will be appreciated that in any such kit, (a), (b), (c) or (d) may comprise
a substantial
component. Such a kit will be of use in diagnosing a disease or susceptibility
to a
Disease, among others.
22

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
This invention also relates to the use of polynucleotides of the present
invention as
diagnostic reagents. Detection of a mutated form of a polynucleotide of the
invention,
preferably SEQ ID NO:1 or 3, which is associated with a disease or
pathogenicity will
provide a diagnostic tool that can add to, or define, a diagnosis of a
disease, a prognosis of a
course of disease, a determination of a stage of disease, or a susceptibility
to a disease,
which results from under-expression, over-expression or altered expression of
the
polynucleotide. Organisms, particularly infectious organisms, carrying
mutations in such
polynucleotide may be detected at the polynucleotide level by a variety of
techniques, such
as those described elsewhere herein.
Cells from an organism carrying mutations or polymorphisms (allelic
variations) in a
polynucleotide and/or polypeptide of the invention may also be detected at the
polynucleotide or polypeptide level by a variety of techniques, to allow for
serotyping, for
example. For example, RT-PCR can be used to detect mutations in the RNA. It is
particularly preferred to use RT-PCR in conjunction with automated detection
systems, such
as, for example, GeneScan. RNA, cDNA or genomic DNA may also be used for the
same
purpose, PCR. As an example, PCR primers complementary to a polynucleotide
encoding
BASB 113 polypeptide can be used to identify and analyze mutations.
The invention further provides primers with l, 2, 3 or 4 nucleotides removed
from the 5'
and/or the 3' end. These primers may be used for, among other things,
amplifying
BASB 113 DNA and/or RNA isolated from a sample derived from an individual,
such as a
bodily material. The primers may be used to amplify a polynucleotide isolated
from an
infected individual, such that the polynucleotide may then be subject to
various techniques
for elucidation of the polynucleotide sequence. In this way, mutations in the
polynucleotide
sequence may be detected and used to diagnose and/or prognose the infection or
its stage or
course, or to serotype and/or classify the infectious agent.
23

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
The invention further provides a process for diagnosing, disease, preferably
bacterial
infections, more preferably infections caused by Moraxella catarrhalis,
comprising
determining from a sample derived from an individual, such as a bodily
material, an
increased level of expression of polynucleotide having a sequence of SEQ ID
NO:1 or 3.
Increased or decreased expression of a BASB 113 polynucleotide can be measured
using
any on of the methods well known in the art for the quantitation of
polynucleotides, such
as, for example, amplification, PCR, RT-PCR, RNase protection, Northern
blotting,
spectrometry and other hybridization methods.
In addition, a diagnostic assay in accordance with the invention for detecting
over-
expression of BASB 113 polypeptide compared to normal control tissue samples
may be
used to detect the presence of an infection, for example. Assay techniques
that can be used
to determine levels of a BASB 113 polypeptide, in a sample derived from a
host, such as a
bodily material, are well-known to those of skill in the art. Such assay
methods include
radioimmunoassays, competitive-binding assays, Western Blot analysis, antibody
sandwich
assays, antibody detection and ELISA assays.
The polynucleotides of the invention may be used as components of
polynucleotide
arrays, preferably high density arrays or grids. These high density arrays are
particularly useful for diagnostic and prognostic purposes. For example, a set
of spots
each comprising a different gene, and further comprising a polynucleotide or
polynucleotides of the invention, may be used for probing, such as using
hybridization
or nucleic acid amplification, using a probes obtained or derived from a
bodily sample,
to determine the presence of a particular polynucleotide sequence or related
sequence in
an individual. Such a presence may indicate the presence of a pathogen,
particularly
Moraxella catarrhalis, and may be useful in diagnosing and/or prognosing
disease or a
course of disease. A grid comprising a number of variants of the
polynucleotide
sequence of SEQ ID NO:1 or 3 are preferred. Also preferred is a comprising a
number
24

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
of variants of a polynucleotide sequence encoding the polypeptide sequence of
SEQ ID
N0:2 or 4.
Antibodies
The polypeptides and polynucleotides of the invention or variants thereof, or
cells
expressing the same can be used as immunogens to produce antibodies
immunospecific for
such polypeptides or polynucleotides respectively.
In certain preferred embodiments of the invention there are provided
antibodies against
BASB 113 polypeptides or polynucleotides.
Antibodies generated against the polypeptides or polynucleotides of the
invention can be
obtained by administering the polypeptides and/or polynucleotides of the
invention, or
epitope-bearing fragments of either or both, analogues of either or both, or
cells expressing
either or both, to an animal, preferably a nonhuman, using routine protocols.
For
preparation of monoclonal antibodies, any technique known in the art that
provides
antibodies produced by continuous cell line cultures can be used. Examples
include various
techniques, such as those in Kohler, G. and Milstein, C., Nature 256.' 495-497
(1975);
Kozbor et al., Immunology Today 4: 72 (1983); Cole et al., pg. 77-96 in
MONOCLONAL
ANTIBODIESAND CANCER THERAPY, Alan R. Liss, Inc. (1985).
Techniques for the production of single chain antibodies (U.S. Patent No.
4,946,778) can be
adapted to produce single chain antibodies to polypeptides or polynucleotides
of this
invention. Also, transgenic mice, or other organisms or animals, such as other
mammals,
may be used to express humanized antibodies immunospecific to the polypeptides
or
polynucleotides of the invention.
Alternatively, phage display technology may be utilized to select antibody
genes with
binding activities towards a polypeptide of the invention either from
repertoires of PCR

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
amplified v-genes of lymphocytes from humans screened for possessing anti-BASB
113 or
from naive libraries (McCafferty, et al., (1990), Nature 348, 552-554; Marks,
et al.,
(1992) Biotechnology 10, 779-783). The amity of these antibodies can also be
improved
by, for example, chain shuffling (Clackson et al., (1991) Nature 352: 628).
The above-described antibodies may be employed to isolate or to identify
clones expressing
the polypeptides or polynucleotides of the invention to purify the
polypeptides or
polynucleotides by, for example, affinity chromatography.
Thus, among others, antibodies against BASB 113-polypeptide or BASB 113-
polynucleotide
may be employed to treat infections, particularly bacterial infections.
Polypeptide variants include antigenically, epitopically or immunologically
equivalent
variants form a particular aspect of this invention.
Preferably, the antibody or variant thereof is modified to make it less
immunogenic in the
individual. For example, if the individual is human the antibody may most
preferably be
"humanized," where the complimentarity determining region or regions of the
hybridoma-
derived antibody has been transplanted into a human monoclonal antibody, for
example as
described in Jones et al. (1986), Nature 321, 522-52~ or Tempest et al.,
(1991)
Biotechnology 9, 266-273.
Antagonists and Agonists - Assays and Molecules
Polypeptides and polynucleotides of the invention may also be used to assess
the binding of
small molecule substrates and ligands in, for example, cells, cell-free
preparations, chemical
libraries, and natural product mixtures. These substrates and ligands may be
natural
substrates and ligands or may be structural or functional mimetics. See, e.g.,
Coligan et al.,
Current Protocols in Immunology 1 (2): Chapter 5 (1991).
26

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
The screening methods may simply measure the binding of a candidate compound
to the
polypeptide or polynucleotide, or to cells or membranes bearing the
polypeptide or
polynucleotide, or a fusion protein of the polypeptide by means of a label
directly or
indirectly associated with the candidate compound. Alternatively, the
screening method
may involve competition with a labeled competitor. Further, these screening
methods
may test whether the candidate compound results in a signal generated by
activation or
inhibition of the polypeptide or polynucleotide, using detection systems
appropriate to the
cells comprising the polypeptide or polynucleotide. Inhibitors of activation
are generally
assayed in the presence of a known agonist and the effect on activation by the
agonist by
the presence of the candidate compound is observed. Constitutively active
polypeptide
and/or constitutively expressed polypeptides and polynucleotides may be
employed in
screening methods for inverse agonists or inhibitors, in the absence of an
agonist or
inhibitor, by testing whether the candidate compound results in inhibition of
activation of
the polypeptide or polynucleotide, as the case may be. Further, the screening
methods
may simply comprise the steps of mixing a candidate compound with a solution
containing a polypeptide or polynucleotide of the present invention, to form a
mixture,
measuring BASB 113 polypeptide and/or polynucleotide activity in the mixture,
and
comparing the BASB 113 polypeptide and/or polynucleotide activity of the
mixture to a
standard. Fusion proteins, such as those made from Fc portion and BASB 113
polypeptide, as hereinbefore described, can also be used for high-throughput
screening
assays to identify antagonists of the polypeptide of the present invention, as
well as of
phylogenetically and and/or functionally related polypeptides (see D. Bermett
et al., J Mol
Recognition, 8:52-58 (1995); and K. Johanson et al., J Biol Chem, 270(16):9459-
9471
(1995)).
The polynucleotides, polypeptides and antibodies that bind to and/or interact
with a
polypeptide of the present invention may also be used to configure screening
methods for
detecting the effect of added compounds on the production of mRNA and/or
polypeptide
27

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
in cells. For example, an ELISA assay may be constructed for measuring
secreted or cell
associated levels of polypeptide using monoclonal and polyclonal antibodies by
standard
methods known in the art. This can be used to discover agents which may
inhibit or
enhance the production of polypeptide (also called antagonist or agonist,
respectively)
from suitably manipulated cells or tissues.
The invention also provides a method of screening compounds to identify those
which
enhance (agonist) or block (antagonist) the action of BASB 113 polypeptides or
polynucleotides, particularly those compounds that are bacteriostatic and/or
bactericidal.
The method of screening may involve high-throughput techniques. For example,
to screen
for agonists or antagonists, a synthetic reaction mix, a cellular compartment,
such as a
membrane, cell envelope or cell wall, or a preparation of any thereof,
comprising BASB 113
polypeptide and a labeled substrate or ligand of such polypeptide is incubated
in the absence
or the presence of a candidate molecule that may be a BASB 113 agonist or
antagonist. The
ability of the candidate molecule to agonize or antagonize the BASB 113
polypeptide is
reflected in decreased binding of the labeled ligand or decreased production
of product from
such substrate. Molecules that bind gratuitously, i.e., without inducing the
effects of
BASB 113 polypeptide are most likely to be good antagonists. Molecules that
bind well
and, as the case may be, increase the rate of product production from
substrate, increase
signal transduction, or increase chemical channel activity are agonists.
Detection of the rate
or level of, as the case may be, production of product from substrate, signal
transduction, or
chemical channel activity may be enhanced by using a reporter system. Reporter
systems
that may be useful in this regard include but are not limited to colorimetric,
labeled substrate
converted into product, a reporter gene that is responsive to changes in BASB
113
polynucleotide or polypeptide activity, and binding assays known in the art.
Another example of an assay for BASB 113 agonists is a competitive assay that
combines
BASB 113 and a potential agonist with BASB 113-binding molecules, recombinant
BASB I 13 binding molecules, natural substrates or ligands, or substrate or
ligand mimetics,
28

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
under appropriate conditions for a competitive inhibition assay. BASB 113 can
be labeled,
such as by radioactivity or a colorimetric compound, such that the number of
BASB 113
molecules bound to a binding molecule or converted to product can be
determined
accurately to assess the effectiveness of the potential antagonist.
Potential antagonists include, among others, small organic molecules,
peptides, polypeptides
and antibodies that bind to a polynucleotide and/or polypeptide of the
invention and thereby
inhibit or extinguish its activity or expression. Potential antagonists also
may be small
organic molecules, a peptide, a polypeptide such as a closely related protein
or antibody that
binds the same sites on a binding molecule, such as a binding molecule,
without inducing
BASB I 13-induced activities, thereby preventing the action or expression of
BASB 113
polypeptides and/or polynucleotides by excluding BASB 113 polypeptides and/or
polynucleotides from binding.
Potential antagonists include a small molecule that binds to and occupies the
binding site of
the polypeptide thereby preventing binding to cellular binding molecules, such
that normal
biological activity is prevented. Examples of small molecules include but are
not limited to
small organic molecules, peptides or peptide-like molecules. Other potential
antagonists
include antisense molecules (see Okano, J. Neurochem. 56: 560 (1991);
OLIGODEOXYNUCLEOTIDES AS ANTISENSE INHIBITORS OF GENE EXPRESSION,
CRC Press, Boca Raton, FL (1988), for a description of these molecules).
Preferred
potential antagonists include compounds related to and variants of BASB 113.
In a further aspect, the present invention relates to genetically engineered
soluble fusion
proteins comprising a polypeptide of the present invention, or a fragment
thereof, and
various portions of the constant regions of heavy or light chains of
immunoglobulins of
various subclasses (IgG, IgM, IgA, IgE). Preferred as an immunoglobulin is the
constant
part of the heavy chain of human IgG, particularly IgGI, where fusion takes
place at the
hinge region. In a particular embodiment, the Fc part can be removed simply by
29

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
incorporation of a cleavage sequence which can be cleaved with blood clotting
factor Xa.
Furthermore, this invention relates to processes for the preparation of these
fusion
proteins by genetic engineering, and to the use thereof for drug screening,
diagnosis and
therapy. A further aspect of the invention also relates to polynucleotides
encoding such
fusion proteins. Examples of fusion protein technology can be found in
International
Patent Application Nos. W094/29458 and W094/22914.
Each of the polynucleotide sequences provided herein may be used in the
discovery and
development of antibacterial compounds. The encoded protein, upon expression,
can be
used as a target for the screening of antibacterial drugs. Additionally, the
polynucleotide
sequences encoding the amino terminal regions of the encoded protein or Shine-
Delgarno
or other translation facilitating sequences of the respective mRNA can be used
to
construct antisense sequences to control the expression of the coding sequence
of interest.
The invention also provides the use of the polypeptide, polynucleotide,
agonist or
antagonist of the invention to interfere with the initial physical interaction
between a
pathogen or pathogens and a eukaryotic, preferably mammalian, host responsible
for
sequelae of infection. In particular, the molecules of the invention may be
used: in the
prevention of adhesion of bacteria, in particular gram positive and/or gram
negative
bacteria, to eukaryotic, preferably mammalian, extracellular matrix proteins
on in-
dwelling devices or to extracellular matrix proteins in wounds; to block
bacterial adhesion
between eukaryotic, preferably mammalian, extracellular matrix proteins and
bacterial
BASB 113 proteins that mediate tissue damage and/or; to block the normal
progression of
pathogenesis in infections initiated other than by the implantation of in-
dwelling devices
or by other surgical techniques.
In accordance with yet another aspect of the invention, there are provided
BASB 113
agonists and antagonists, preferably bacteristatic or bactericidal agonists
and antagonists.

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
The antagonists and agonists of the invention may be employed, for instance,
to prevent,
inhibit and/or treat diseases.
In a further aspect, the present invention relates to mimotopes of the
polypeptide of the
invention. A mimotope is a peptide sequence, sufficiently similar to the
native peptide
(sequentially or structurally), which is capable of being recognised by
antibodies which
recognise the native peptide; or is capable of raising antibodies which
recognise the
native peptide when coupled to a suitable carrier.
Peptide mimotopes may be designed for a particular purpose by addition,
deletion or
substitution of elected amino acids. Thus, the peptides may be modified for
the purposes
of ease of conjugation to a protein carrier. For example, it may be desirable
for some
chemical conjugation methods to include a terminal cysteine. In addition it
may be
desirable for peptides conjugated to a protein carrier to include a
hydrophobic terminus
distal from the conjugated terminus of the peptide, such that the free
unconjugated end
of the peptide remains associated with the surface of the carrier protein.
Thereby
presenting the peptide in a conformation which most closely resembles that of
the
peptide as found in the context of the whole native molecule. For example, the
peptides
may be altered to have an N-terminal cysteine and a C-terminal hydrophobic
amidated
tail. Alternatively, the addition or substitution of a D-stereoisomer form of
one or more
of the amino acids may be performed to create a beneficial derivative, for
example to
enhance stability of the peptide.
Alternatively, peptide mimotopes may be identified using antibodies which are
capable
themselves of binding to the polypeptides of the present invention using
techniques such
as phage display technology (EP 0 552 267 Bl). This technique, generates a
large number
of peptide sequences which mimic the structure of the native peptides and are,
therefore,
capable of binding to anti-native peptide antibodies, but may not necessarily
themselves
share significant sequence homology to the native polypeptide.
31

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Vaccines
Another aspect of the invention relates to a method for inducing an
immunological
response in an individual, particularly a mammal, preferably humans, which
comprises
inoculating the individual with BASB 113 polynucleotide and/or polypeptide, or
a
fragment or variant thereof, adequate to produce antibody and/ or T cell
immune response
to protect said individual from infection, particularly bacterial infection
and most
particularly Moraxella catarrhalis infection. Also provided are methods
whereby such
immunological response slows bacterial replication. Yet another aspect of the
invention
relates to a method of inducing immunological response in an individual which
comprises
delivering to such individual a nucleic acid vector, sequence or ribozyme to
direct
expression of BASB 113 polynucleotide and/or polypeptide, or a fragment or a
variant
thereof, for expressing BASB 113 polynucleotide and/or polypeptide, or a
fragment or a
variant thereof in vivo in order to induce an immunological response, such as,
to produce
antibody and/ or T cell immune response, including, for example, cytokine-
producing T
cells or cytotoxic T cells, to protect said individual, preferably a human,
from disease,
whether that disease is already established within the individual or not. One
example of
administering the gene is by accelerating it into the desired cells as a
coating on particles
or otherwise. Such nucleic acid vector may comprise DNA, RNA, a ribozyme, a
modified
nucleic acid, a DNA/RNA hybrid, a DNA-protein complex or an RNA-protein
complex.
A further aspect of the invention relates to an immunological composition that
when
introduced into an individual, preferably a human, capable of having induced
within it an
immunological response, induces an immunological response in such individual
to a
BASB 113 polynucleotide and/or polypeptide encoded therefrom, wherein the
composition
comprises a recombinant BASB 113 polynucleotide and/or polypeptide encoded
therefrom
and/or comprises DNA and/or RNA which encodes and expresses an antigen of said
BASB 113 polynucleotide, polypeptide encoded therefrom, or other polypeptide
of the
invention. The immunological response may be used therapeutically or
prophylactically
32

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
and may take the form of antibody immunity and/or cellular immunity, such as
cellular
immunity arising from CTL or CD4+ T cells.
A BASB 113 polypeptide or a fragment thereof may be fused with co-protein or
chemical
moiety which may or may not by itself produce antibodies, but which is capable
of
stabilizing the first protein and producing a fused or modified protein which
will have
antigenic and/or immunogenic properties, and preferably protective properties.
Thus
fused recombinant protein, preferably further comprises an antigenic co-
protein, such as
lipoprotein D from Haemophilus influenzae, Glutathione-S-transferase (GST) or
beta-
galactosidase, or any other relatively large co-protein which solubilizes the
protein and
facilitates production and purification thereof. Moreover, the co-protein may
act as an
adjuvant in the sense of providing a generalized stimulation of the immune
system of the
organism receiving the protein. The co-protein may be attached to either the
amino- or
carboxy-terminus of the first protein.
In a vaccine composition according to the invention, a BASB 113 polypeptide
and/or
polynucleotide, or a fragment, or a mimotope, or a variant thereof may be
present in a
vector, such as the live recombinant vectors described above for example live
bacterial
vectors.
Also suitable are non-live vectors for the BASB 113 polypeptide, for example
bacterial
outer-membrane vesicles or "blebs". OM blebs are derived from the outer
membrane of
the two-layer membrane of Gram-negative bacteria and have been documented in
many
Gram-negative bacteria (Zhou, L et al. 1998. FEMS Microbiol. Lett. 163:223-
228)
including C. trachomatis and C. psittaci. A non-exhaustive list of bacterial
pathogens
reported to produce blebs also includes: Bordetella pertussis, Borrelia
burgdorferi,
Brucella melitensis, Brucella ovis, Esherichia coli, Haemophilus influenza,
Legionella
pneumophila, Moraxella catarrhalis, Neisseria gonorrhoeae, Neisseria
meningitides,
Pseudomonas aeruginosa and Yersinia enterocolitica.
33

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Blebs have the advantage of providing outer-membrane proteins in their native
conformation and are thus particularly useful for vaccines. Blebs can also be
improved
for vaccine use by engineering the bacterium so as to modify the expression of
one or
more molecules at the outer membrane. Thus for example the expression of a
desired
immunogenic protein at the outer membrane, such as the BASB 113 polypeptide,
can be
introduced or upregulated (e.g. by altering the promoter). Instead or in
addition, the
expression of outer-membrane molecules which are either not relevant (e.g.
unprotective
antigens or immunodominant but variable proteins) or detrimental (e.g. toxic
molecules
such as LPS, or potential inducers of an autoimmune response) can be
downregulated.
These approaches are discussed in more detail below.
The non-coding flanking regions of the BASB 113 gene contain regulatory
elements
important in the expression of the gene. This regulation takes place both at
the
transcriptional and translational level. The sequence of these regions, either
upstream or
downstream of the open reading frame of the gene, can be obtained by DNA
sequencing.
This sequence information allows the determination of potential regulatory
motifs such as
the different promoter elements, terminator sequences, inducible sequence
elements,
repressors, elements responsible for phase variation, the shine-dalgarno
sequence, regions
with potential secondary structure involved in regulation, as well as other
types of
regulatory motifs or sequences. This sequence is a further aspect of the
invention.
This sequence information allows the modulation of the natural expression of
the
BASB 113 gene. The upregulation of the gene expression may be accomplished by
altering the promoter, the shine-dalgarno sequence, potential repressor or
operator
elements, or any other elements involved. Likewise, downregulation of
expression can be
achieved by similar types of modification. Alternatively, by changing phase
variation
sequences, the expression of the gene can be put under phase variation
control, or it may
be uncoupled from this regulation. In another approach, the expression of the
gene can be
34

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
put under the control of one or more inducible elements allowing regulated
expression.
Examples of such regulation include, but are not limited to, induction by
temperature
shift, addition of inductor substrates like selected carbohydrates or their
derivatives, trace
elements, vitamins, co-factors, metal ions, etc.
Such modifications as described above can be introduced by several different
means. The
modification of sequences involved in gene expression can be carried out in
vivo by
random mutagenesis followed by selection for the desired phenotype. Another
approach
consists in isolating the region of interest and modifying it by random
mutagenesis, or
site-directed replacement, insertion or deletion mutagenesis. The modified
region can then
be reintroduced into the bacterial genome by homologous recombination, and the
effect
on gene expression can be assessed. In another approach, the sequence
knowledge of the
region of interest can be used to replace or delete all or part of the natural
regulatory
sequences. In this case, the regulatory region targeted is isolated and
modified so as to
contain the regulatory elements from another gene, a combination of regulatory
elements
from different genes, a synthetic regulatory region, or any other regulatory
region, or to
delete selected parts of the wild-type regulatory sequences. These modified
sequences can
then be reintroduced into the bacterium via homologous recombination into the
genome.
A non-exhaustive list of preferred promoters that could be used for up-
regulation of gene
expression includes the promoters porA, porB, lbpB, tbpB, pl 13, 1st, hpuAB
from N.
meningitidis or N. gonorroheae; ompCD, copB, lbpB, ompE, UspAl; UspA2; TbpB
from
M. Catarrhalis; pl, p2, p4, p5, p6, lpD, tbpB, D15, Hia, Hmwl, Hmw2 from H.
influenzae.
In one example, the expression of the gene can be modulated by exchanging its
promoter
with a stronger promoter (through isolating the upstream sequence of the gene,
in vitro
modification of this sequence, and reintroduction into the genome by
homologous
recombination). Upregulated expression can be obtained in both the bacterium
as well as
in the outer membrane vesicles shed (or made) from the bacterium.

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
In other examples, the described approaches can be used to generate
recombinant bacterial
strains with improved characteristics for vaccine applications. These can be,
but are not
limited to, attenuated strains, strains with increased expression of selected
antigens,
strains with knock-outs (or decreased expression) of genes interfering with
the immune
response, strains with modulated expression of immunodominant proteins,
strains with
modulated shedding of outer-membrane vesicles.
Thus, also provided by the invention is a modified upstream region of the BASB
113 gene,
which modified upstream region contains a heterologous regulatory element
which alters
the expression level of the BASB 113 protein located at the outer membrane.
The
upstream region according to this aspect of the invention includes the
sequence upstream
of the BASB 113 gene. The upstream region starts immediately upstream of the
BASB 113
gene and continues usually to a position no more than about 1000 by upstream
of the gene
from the ATG start codon. In the case of a gene located in a polycistronic
sequence
(operon) the upstream region can start immediately preceding the gene of
interest, or
preceding the first gene in the operon. Preferably, a modified upstream region
according to
this aspect of the invention contains a heterologous promotor at a position
between 500 and
700 by upstream of the ATG.
Thus, the invention provides a BASB 113 polypeptide, in a modified bacterial
bleb. The
invention further provides modified host cells capable of producing the non-
live membrane-
based bleb vectors. The invention further provides nucleic acid vectors
comprising the
BASB 113 gene having a modified upstream region containing a heterologous
regulatory
element.
Further provided by the invention are processes to prepare the host cells and
bacterial blebs
according to the invention.
36

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Provided by this invention are compositions, particularly vaccine
compositions, and
methods comprising the polypeptides and/or polynucleotides of the invention
and
immunostimulatory DNA sequences, such as those described in Sato, Y. et al.
Science
273: 352 (1996).
Also, provided by this invention are methods using the described
polynucleotide or
particular fragments thereof, which have been shown to encode non-variable
regions of
bacterial cell surface proteins, in polynucleotide constructs used in such
genetic
immunization experiments in animal models of infection with Moraxella
catarrhalis.
Such experiments will be particularly useful for identifying protein epitopes
able to
provoke a prophylactic or therapeutic immune response. It is believed that
this approach
will allow for the subsequent preparation of monoclonal antibodies of
particular value,
derived from the requisite organ of the animal successfully resisting or
clearing infection,
for the development of prophylactic agents or therapeutic treatments of
bacterial infection,
particularly Moraxella catarrhalis infection, in mammals, particularly humans.
The invention also includes a vaccine formulation which comprises an
immunogenic
recombinant polypeptide and/or polynucleotide of the invention together with a
suitable
carrier, such as a pharmaceutically acceptable carrier. Since the polypeptides
and
polynucleotides may be broken down in the stomach, each is preferably
administered
parenterally, including, for example, administration that is subcutaneous,
intramuscular,
intravenous, or intradermal. Formulations suitable for parenteral
administration include
aqueous and non-aqueous sterile injection solutions which may contain anti-
oxidants,
buffers, bacteriostatic compounds and solutes which render the formulation
isotonic with
the bodily fluid, preferably the blood, of the individual; and aqueous and non-
aqueous
sterile suspensions which may include suspending agents or thickening agents.
The
formulations may be presented in unit-dose or mufti-dose containers, for
example, sealed
ampoules and vials and may be stored in a freeze-dried condition requiring
only the
addition of the sterile liquid carrier immediately prior to use.
37

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
The vaccine formulation of the invention may also include adjuvant systems for
enhancing the immunogenicity of the formulation. Preferably the adjuvant
system
raises preferentially a TH1 type of response.
An immune response may be broadly distinguished into two extreme catagories,
being a
humoral or cell mediated immune responses (traditionally characterised by
antibody and
cellular effector mechanisms of protection respectively). These categories of
response
have been termed TH 1-type responses (cell-mediated response), and TH2-type
immune
responses (humoral response).
Extreme TH1-type immune responses may be characterised by the generation of
antigen
specific, haplotype restricted cytotoxic T lymphocytes, and natural killer
cell responses.
In mice TH1-type responses are often characterised by the generation of
antibodies of
the IgG2a subtype, whilst in the human these correspond to IgGI type
antibodies. TH2-
type immune responses are characterised by the generation of a broad range of
immunoglobulin isotypes including in mice IgGI, IgA, and IgM.
It can be considered that the driving force behind the development of these
two types of
immune responses are cytokines. High levels of THl-type cytokines tend to
favour the
induction of cell mediated immune responses to the given antigen, whilst high
levels of
TH2-type cytokines tend to favour the induction of humoral immune responses to
the
antigen.
The distinction of TH1 and TH2-type immune responses is not absolute. In
reality an
individual will support an immune response which is described as being
predominantly
TH 1 or predominantly TH2. However, it is often convenient to consider the
families of
cytokines in terms of that described in marine CD4 +ve T cell clones by
Mosmann and
Coffman (Mosmann, T.R. and Coffman, R.L. (1989) THl and TH2 cells: different
38

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
patterns of lymphokine secretion lead to different functional properties.
Annual Review
oflmmunology, 7, p145-173). Traditionally, THl-type responses are associated
with
the production of the INF-y and IL-2 cytokines by T-lymphocytes. Other
cytokines
often directly associated with the induction of THl-type immune responses are
not
produced by T-cells, such as IL-12. In contrast, TH2- type responses are
associated with
the secretion of IL-4, IL-5, IL-6 and IL-13.
It is known that certain vaccine adjuvants are particularly suited to the
stimulation of
either TH1 or TH2 - type cytokine responses. Traditionally the best indicators
of the
TH1:TH2 balance of the immune response after a vaccination or infection
includes
direct measurement of the production of THl or TH2 cytokines by T lymphocytes
in
vitro after restimulation with antigen, and/or the measurement of the IgGl
:IgG2a ratio
of antigen specific antibody responses.
Thus, a TH1-type adjuvant is one which preferentially stimulates isolated T-
cell
populations to produce high levels of TH1-type cytokines when re-stimulated
with
antigen in vitro, and promotes development of both CD8+ cytotoxic T
lymphocytes arid
antigen specific immunoglobulin responses associated with TH1-type isotype.
Adjuvants which are capable of preferential stimulation of the TH1 cell
response are
described in International Patent Application No. WO 94/00153 and WO 95/17209.
3 De-O-acylated monophosphoryl lipid A (3D-MPL) is one such adjuvant. This is
known from GB 2220211 (Ribi). Chemically it is a mixture of 3 De-O-acylated
monophosphoryl lipid A with 4, 5 or 6 acylated chains and is manufactured by
Ribi
Immunochem, Montana. A preferred form of 3 De-O-acylated monophosphoryl lipid
A is disclosed in European Patent 0 689 454 B 1 (SmithKline Beecham
Biologicals SA).
39

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Preferably, the particles of 3D-MPL are small enough to be sterile filtered
through a
0.22micron membrane (European Patent number 0 689 454).
3D-MPL will be present in the range of 10~,g - 100~,g preferably 25-50~.g per
dose
wherein the antigen will typically be present in a range 2-50~,g per dose.
Another preferred adjuvant comprises QS21, an Hplc purified non-toxic fraction
derived
from the bark of Quillaja Saponaria Molina. Optionally this may be admixed
with 3
De-O-acylated monophosphoryl lipid A (3D-MPL), optionally together with an
carrier.
The method of production of QS21 is disclosed in US patent No. 5,057,540.
Non-reactogenic adjuvant formulations containing QS21 have been described
previously (WO 96/33739). Such formulations comprising QS21 and cholesterol
have
been shown to be successful TH1 stimulating adjuvants when formulated together
with
an antigen.
Further adjuvants which are preferential stimulators of TH1 cell response
include
immunomodulatory oligonucleotides, for example unmethylated CpG sequences as
disclosed in WO 96/02555.
Combinations of different TH1 stimulating adjuvants, such as those mentioned
hereinabove, are also contemplated as providing an adjuvant which is a
preferential
stimulator of TH1 cell response. For example, QS21 can be formulated together
with
3D-MPL. The ratio of QS21 : 3D-MPL will typically be in the order of 1 : 10 to
10 : l;
preferably 1:5 to 5 : l and often substantially 1 : 1. The preferred range for
optimal
synergy is 2.5 : 1 to 1 : 1 3D-MPL: QS21.

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Preferably a Garner is also present in the vaccine composition according to
the
invention. The carrier may be an oil in water emulsion, or an aluminium salt,
such as
aluminium phosphate or aluminium hydroxide.
A preferred oil-in-water emulsion comprises a metabolisible oil, such as
squalene, alpha
tocopherol and Tween 80. In a particularly preferred aspect the antigens in
the vaccine
composition according to the invention are combined with QS21 and 3D-MPL in
such
an emulsion. Additionally the oil in water emulsion may contain span 85 and/or
lecithin
and/or tricaprylin.
Typically for human administration QS21 and 3D-MPL will be present in a
vaccine in
the range of l~.g - 200~.g, such as 10-100~g, preferably 10~.g - SO~.g per
dose.
Typically the oil in water will comprise from 2 to 10% squalene, from 2 to 10%
alpha
tocopherol and from 0.3 to 3% tween 80. Preferably the ratio of squalene:
alpha
tocopherol is equal to or less than 1 as this provides a more stable emulsion.
Span 85
may also be present at a level of 1%. In some cases it may be advantageous
that the
vaccines of the present invention will further contain a stabiliser.
Non-toxic oil in water emulsions preferably contain a non-toxic oil, e.g.
squalane or
squalene, an emulsifier, e.g. Tween 80, in an aqueous carrier. The aqueous
carrier may
be, for example, phosphate buffered saline.
A particularly potent adjuvant formulation involving QS21, 3D-MPL and
tocopherol
in an oil in water emulsion is described in WO 95/17210.
The present invention also provides a polyvalent vaccine composition
comprising a
vaccine formulation of the invention in combination with other antigens, in
particular
antigens useful for treating cancers, autoimmune diseases and related
conditions. Such a
41

CA 02377536 2001-12-20
WO 01/00836 PCTlEP00/05851
polyvalent vaccine composition may include a TH-1 inducing adjuvant as
hereinbefore
described.
While the invention has been described with reference to certain BASB 113
polypeptides
and polynucleotides, it is to be understood that this covers fragments of the
naturally
occurnng polypeptides and polynucleotides, and similar polypeptides and
polynucleotides
with additions, deletions or substitutions which do not substantially affect
the
immunogenic properties of the recombinant polypeptides or polynucleotides.
Compositions, kits and administration
In a further aspect of the invention there are provided compositions
comprising a BASB 113
polynucleotide and/or a BASB 113 polypeptide for administration to a cell or
to a
multicellular organism.
The invention also relates to compositions comprising a polynucleotide and/or
a
polypeptides discussed herein or their agonists or antagonists. The
polypeptides and
polynucleotides of the invention may be employed in combination with a non-
sterile or
sterile Garner or carriers for use with cells, tissues or organisms, such as a
pharmaceutical
carrier suitable for administration to an individual. Such compositions
comprise, for
instance, a media additive or a therapeutically effective amount of a
polypeptide and/or
polynucleotide of the invention and a pharmaceutically acceptable carrier or
excipient. Such
Garners may include, but are not limited to, saline, buffered saline,
dextrose, water, glycerol,
ethanol and combinations thereof. The formulation should suit the mode of
administration.
The invention further relates to diagnostic and pharmaceutical packs and kits
comprising
one or more containers filled with one or more of the ingredients of the
aforementioned
compositions of the invention.
Polypeptides, polynucleotides and other compounds of the invention may be
employed
alone or in conjunction with other compounds, such as therapeutic compounds.
42

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
The pharmaceutical compositions may be administered in any effective,
convenient manner
including, for instance, administration by topical, oral, anal, vaginal,
intravenous,
intraperitoneal, intramuscular, subcutaneous, intranasal or intradermal routes
among others.
In therapy or as a prophylactic, the active agent may be administered to an
individual as
an injectable composition, for example as a sterile aqueous dispersion,
preferably
isotonic.
In a further aspect, the present invention provides for pharmaceutical
compositions
comprising a therapeutically effective amount of a polypeptide and/or
polynucleotide, such
as the soluble form of a polypeptide and/or polynucleotide of the present
invention, agonist
or antagonist peptide or small molecule compound, in combination with a
pharmaceutically
acceptable carrier or excipient. Such Garners include, but are not limited to,
saline, buffered
saline, dextrose, water, glycerol, ethanol, and combinations thereof. The
invention fiu~ther
relates to pharmaceutical packs and kits comprising one or more containers
filled with one
or more of the ingredients of the aforementioned comrpositions of the
invention.
Polypeptides, polynucleotides and other compounds of the present invention may
be
employed alone or in conjunction with other compounds, such as therapeutic
compounds.
The composition will be adapted to the route of administration, for instance
by a systemic or
an oral route. Preferred forms of systemic administration include injection,
typically by
intravenous injection. Other injection routes, such as subcutaneous,
intramuscular, or
intraperitoneal, can be used. Alternative means for systemic administration
include
transmucosal and transdermal administration using penetrants such as bile
salts or fusidic
acids or other detergents. In addition, if a polypeptide or other compounds of
the present
invention can be formulated in an enteric or an encapsulated formulation, oral
administration may. also be possible. Administration of these compounds may
also be
topical and/or localized, in the form of salves, pastes, gels, solutions,
powders and the like.
43

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
For administration to mammals, and particularly humans, it is expected that
the daily
dosage level of the active agent will be from 0.01 mg/kg to 10 mg/kg,
typically around 1
mg/kg. The physician in any event will determine the actual dosage which will
be most
suitable for an individual and will vary with the age, weight and response of
the particular
individual. The above dosages are exemplary of the average case. There can, of
course,
be individual instances where higher or lower dosage ranges are merited, and
such are
within the scope of this invention.
The dosage range required depends on the choice of peptide, the route of
administration, the
nature of the formulation, the nature of the subject's condition, and the
judgment of the
attending practitioner. Suitable dosages, however, are in the range of 0.1-100
pg/kg of
subj ect.
A vaccine composition is conveniently in injectable form. Conventional
adjuvants may be
employed to enhance the immune response. A suitable unit dose for vaccination
is 0.5-5
microgram/kg of antigen, and such dose is preferably administered 1-3 times
and with an
interval of 1-3 weeks. With the indicated dose range, no adverse toxicological
effects will
be observed with the compounds of the invention which would preclude their
administration to suitable individuals.
Wide variations in the needed dosage, however, are to be expected in view of
the variety of
compounds available and the differing efficiencies of various routes of
administration. For
example, oral administration would be expected to require higher dosages than
administration by intravenous injection. Variations in these dosage levels can
be adjusted
using standard empirical routines for optimization, as is well understood in
the art.
Sequence Databases, Sequences in a Tangible Medium, and Algorithms
44

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Polynucleotide and polypeptide sequences form a valuable information resource
with which
to determine their 2- and 3-dimensional structures as well as to identify
further sequences of
similar homology. These approaches are most easily facilitated by storing the
sequence in a
computer readable medium and then using the stored data in a known
macromolecular
structure program or to search a sequence database using well known searching
tools, such
as the GCG program package.
Also provided by the invention are methods for the analysis of character
sequences or
strings, particularly genetic sequences or encoded protein sequences.
Preferred methods
of sequence analysis include, for example, methods of sequence homology
analysis, such
as identity and similarity analysis, DNA, RNA and protein structure analysis,
sequence
assembly, cladistic analysis, sequence motif analysis, open reading frame
determination,
nucleic acid base calling, codon usage analysis, nucleic acid base trimming,
and
sequencing chromatogram peak analysis.
A computer based method is provided for performing homology identification.
This
method comprises the steps of: providing a first polynucleotide sequence
comprising the
sequence of a polynucleotide of the invention in a computer readable medium;
and
comparing said first polynucleotide sequence to at least one second
polynucleotide or
polypeptide sequence to identify homology.
A computer based method is also provided for performing homology
identification, said
method comprising the steps of: providing a first polypeptide sequence
comprising the
sequence of a polypeptide of the invention in a computer readable medium; and
comparing said first polypeptide sequence to at least one second
polynucleotide or
polypeptide sequence to identify homology.
All publications and references, including but not limited to patents and
patent
applications, cited in this specification are herein incorporated by reference
in their

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
entirety as if each individual publication or reference were specifically and
individually
indicated to be incorporated by reference herein as being fully set forth. Any
patent
application to which this application claims priority is also incorporated by
reference
herein in its entirety in the manner described above for publications and
references.
DEFINITIONS
"Identity," as known in the art, is a relationship between two or more
polypeptide sequences
or two or more polynucleotide sequences, as the case may be, as determined by
comparing
the sequences. In the art, "identity" also means the degree of sequence
relatedness between
polypeptide or poiynucleotide sequences, as the case may be, as determined by
the match
between strings of such sequences. "Identity" can be readily calculated by
known
methods, including but not limited to those described in (Computational
Molecular
Biology, Lesk, A.M., ed., Oxford University Press, New York, 1988;
Biocomputing.~
Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York,
1993;
Computer Analysis of Sequence Data, Part I, Griffin, A.M., and Griffin, H.G.,
eds.,
Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von
Heine,
G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and
Devereux, J.,
eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM
J.
Applied Math., 48: 1073 (1988). Methods to determine identity are designed to
give the
largest match between the sequences tested. Moreover, methods to determine
identity are
codified in publicly available computer programs. Computer program methods to
determine identity between two sequences include, but are not limited to, the
GAP
program in the GCG program package (Devereux, J., et al., Nucleic Acids
Research 12(1):
387 (1984)), BLASTP, BLASTN (Altschul, S.F. et al., J. Molec. Biol. 21~: 403-
410
(1990), and FASTA( Pearson and Lipman Proc. Natl. Acad. Sci. USA 85; 2444-2448
(1988). The BLAST family of programs is publicly available from NCBI and other
sources (BLAST Manual, Altschul, S., et al., NCBI NLM NIH Bethesda, MD 20894;
46

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Altschul, S., et al., J. Mol. Biol. 215: 403-410 (1990). The well known Smith
Waterman
algorithm may also be used to determine identity.
Parameters for polypeptide sequence comparison include the following:
Algorithm: Needleman and Wunsch, J. Mol Biol. 48: 443-453 (1970)
Comparison matrix: BLOSSUM62 from Henikoff and Henikoff,
Proc. Natl. Acad. Sci. USA. 89:10915-10919 (1992)
Gap Penalty: 8
Gap Length Penalty: 2
A program useful with these parameters is publicly available as the "gap"
program from
Genetics Computer Group, Madison WI. The aforementioned parameters are the
default
parameters for peptide comparisons (along with no penalty for end gaps).
Parameters for polynucleotide comparison include the following:
Algorithm: Needleman and Wunsch, J. Mol Biol. 48: 443-453 (1970)
Comparison matrix: matches = +10, mismatch = 0
Gap Penalty: 50
Gap Length Penalty: 3
Available as: The "gap" program from Genetics Computer Group, Madison WI.
These
are the default parameters for nucleic acid comparisons.
A preferred meaning for "identity" for polynucleotides and polypeptides, as
the case may
be, are provided in ( 1 ) and (2) below.
(1) Polynucleotide embodiments further include an isolated polynucleotide
comprising a polynucleotide sequence having at least a 50, 60, 70, 80, 85, 90,
95, 97 or
100% identity to the reference sequence of SEQ ID NO:l, wherein said
polynucleotide
sequence may be identical to the reference sequence of SEQ ID NO:1 or may
include up
to a certain integer number of nucleotide alterations as compared to the
reference
47

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
sequence, wherein said alterations are selected from the group consisting of
at least one
nucleotide deletion, substitution, including transition and transversion, or
insertion, and
wherein said alterations may occur at the 5' or 3' terminal positions of the
reference
nucleotide sequence or anywhere between those terminal positions, interspersed
either
individually among the nucleotides in the reference sequence or in one or more
contiguous groups within the reference sequence, and wherein said number of
nucleotide
alterations is determined by multiplying the total number of nucleotides in
SEQ ID NO:1
by the integer defining the percent identity divided by 100 and then
subtracting that
product from said total number of nucleotides in SEQ ID NO:1, or:
nn ~ xn ' ~xn' Y)
wherein nn is the number of nucleotide alterations, xn is the total number of
nucleotides
in SEQ ID NO:1, y is 0.50 for 50%, 0.60 for 60%, 0.70 for 70%, 0.80 for 80%,
0.85 for
85%, 0.90 for 90%, 0.95 for 95%, 0.97 for 97% or 1.00 for 100%, and ~ is the
symbol for
the multiplication operator, and wherein any non-integer product of xn and y
is rounded
down to the nearest integer prior to subtracting it from xn. Alterations of a
polynucleotide
sequence encoding the polypeptide of SEQ ID N0:2 may create nonsense, missense
or
frameshift mutations in this coding sequence and thereby alter the polypeptide
encoded by
the polynucleotide following such alterations.
By way of example, a polynucleotide sequence of the present invention may be
identical
to the reference sequence of SEQ ID NO:1, that is it may be 100% identical, or
it may
include up to a certain integer number of nucleic acid alterations as compared
to the
reference sequence such that the percent identity is less than 100% identity.
Such
alterations are selected from the group consisting of at least one nucleic
acid deletion,
substitution, including transition and transversion, or insertion, and wherein
said
alterations may occur at the 5' or 3' terminal positions of the reference
polynucleotide
sequence or anywhere between those terminal positions, interspersed either
individually
48

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
among the nucleic acids in the reference sequence or in one or more contiguous
groups
within the reference sequence. The number of nucleic acid alterations for a
given percent
identity is determined by multiplying the total number of nucleic acids in SEQ
ID NO: l
by the integer defining the percent identity divided by 100 and then
subtracting that
product from said total number of nucleic acids in SEQ ID NO:1, or:
nn ~ xn - ~xn' Y)
wherein nn is the number of nucleic acid alterations, xn is the total number
of nucleic
acids in SEQ ID NO:1, y is, for instance 0.70 for 70%, 0.80 for 80%, 0.85 for
85% etc.,
is the symbol for the multiplication operator, and wherein any non-integer
product of xn
and y is rounded down to the nearest integer prior to subtracting it from xn.
(2) Polypeptide embodiments further include an isolated polypeptide comprising
a
polypeptide having at least a 50,60, 70, 80, 85, 90, 95, 97 or 100% identity
to a
polypeptide reference sequence of SEQ ID N0:2, wherein said polypeptide
sequence may
be identical to the reference sequence of SEQ ID N0:2 or may include up to a
certain
integer number of amino acid alterations as compared to the reference
sequence, wherein
said alterations are selected from the group consisting of at least one amino
acid deletion,
substitution, including conservative and non-conservative substitution, or
insertion, and
wherein said alterations may occur at the amino- or carboxy-terminal positions
of the
reference polypeptide sequence or anywhere between those terminal positions,
interspersed either individually among the amino acids in the reference
sequence or in one
or more contiguous groups within the reference sequence, and wherein said
number of
amino acid alterations is determined by multiplying the total number of amino
acids in
SEQ ID N0:2 by the integer defining the percent identity divided by 100 and
then
subtracting that product from said total number of amino acids in SEQ ID N0:2,
or:
na ~ xa - ~xa' Y)
49

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
wherein na is the number of amino acid alterations, xa is the total number of
amino acids
in SEQ ID N0:2, y is 0.50 for 50%, 0.60 for 60%, 0.70 for 70%, 0.80 for 80%,
0.85 for
85%, 0.90 for 90%, 0.95 for 95%, 0.97 for 97% or 1.00 for 100%, and ~ is the
symbol for
the multiplication operator, and wherein any non-integer product of xa and y
is rounded
down to the nearest integer prior to subtracting it from xa.
By way of example, a polypeptide sequence of the present invention may be
identical to
the reference sequence of SEQ ID N0:2, that is it may be 100% identical, or it
may
include up to a certain integer number of amino acid alterations as compared
to the
reference sequence such that the percent identity is less than 100% identity.
Such
alterations are selected from the group consisting of at least one amino acid
deletion,
substitution, including conservative and non-conservative substitution, or
insertion, and
wherein said alterations may occur at the amino- or carboxy-terminal positions
of the
reference polypeptide sequence or anywhere between those terminal positions,
interspersed either individually among the amino acids in the reference
sequence or in one
or more contiguous groups within the reference sequence. The number of amino
acid
alterations for a given % identity is determined by multiplying the total
number of amino
acids in SEQ ID N0:2 by the integer defining the percent identity divided by
100 and
then subtracting that product from said total number of amino acids in SEQ ID
N0:2, or:
na ~ xa - ~xa' Y)
wherein na is the number of amino acid alterations, xa is the total number of
amino acids
in SEQ ID N0:2, y is, for instance 0.70 for 70%, 0.80 for 80%, 0.85 for 85%
etc., and ~ is
the symbol for the multiplication operator, and wherein any non-integer
product of xa and
y is rounded down to the nearest integer prior to subtracting it from xa.

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
"Individual(s)," when used herein with reference to an organism, means a
multicellular
eukaryote, including, but not limited to a metazoan, a mammal, an ovid, a
bovid, a simian,
a primate, and a human.
"Isolated" means altered "by the hand of man" from its natural state, i.e., if
it occurs in
nature, it has been changed or removed from its original environment, or both.
For example,
a polynucleotide or a polypeptide naturally present in a living organism is
not "isolated," but
the same polynucleotide or polypeptide separated from the coexisting materials
of its natural
state is "isolated", as the term is employed herein. Moreover, a
polynucleotide or
polypeptide that is introduced into an organism by transformation, genetic
manipulation or
by any other recombinant method is "isolated" even if it is still present in
said organism,
which organism may be living or non-living.
"Polynucleotide(s)" generally refers to any polyribonucleotide or
polydeoxyribonucleotide,
which may be unmodified RNA or DNA or modified RNA or DNA including single and
double-stranded regions.
"Variant" refers to a polynucleotide or polypeptide that differs from a
reference
polynucleotide or polypeptide, but retains essential properties. A typical
variant of a
polynucleotide differs in nucleotide sequence from another, reference
polynucleotide.
Changes in the nucleotide sequence of the variant may or may not alter the
amino acid
sequence of a polypeptide encoded by the reference polynucleotide. Nucleotide
changes
may result in amino acid substitutions, additions, deletions, fusions and
truncations in
the polypeptide encoded by the reference sequence, as discussed below. A
typical
variant of a polypeptide differs in amino acid sequence from another,
reference
polypeptide. Generally, differences are limited so that the sequences of the
reference
polypeptide and the variant are closely similar overall and, in many regions,
identical.
A variant and reference polypeptide may differ in amino acid sequence by one
or more
substitutions, additions, deletions in any combination. A substituted or
inserted amino
51

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
acid residue may or may not be one encoded by the genetic code. A variant of a
polynucleotide or polypeptide may be a naturally occurring such as an allelic
variant, or
it may be a variant that is not known to occur naturally. Non-naturally
occurring
variants of polynucleotides and polypeptides may be made by mutagenesis
techniques
or by direct synthesis.
"Disease(s)" means any disease caused by or related to infection by a
bacteria, including,
for example, otitis media in infants and children, pneumonia in elderlies,
sinusitis,
nosocomial infections and invasive diseases, chronic otitis media with hearing
loss, fluid
accumulation in the middle ear, auditive nerve damage, delayed speech
learning, infection
of the upper respiratory tract and inflammation of the middle ear.
52

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
EXAMPLES:
The examples below are carried out using standard techniques, which are well
known and
routine to those of skill in the art, except where otherwise described in
detail. The examples
are illustrative, but do not limit the invention.
Example 1: DNA sequencing of the BASB113 gene from Moraxella catarrhalis
strain ATCC 43617.
A: BASB 113 in Moraxella catarrhalis strain.
The BASB 113 gene of SEQ ID NO:1 is from Moraxella catarrhalis strain ATCC
43617. The translation of the BASB 113 polynucleotide sequence is showed in
SEQ ID
N0:2.
B: BASB 113 in Moraxella Catarrhalis strain 43617.
The sequence of the BASB 113 gene was confirmed in Moraxella Catarrhalis
strain
ATCC 43617. For this purpose, plasmid DNA (see example 2A) containing the gene
region encoding the mature BASB 113 from Moraxella Catarrhalis. strain ATCC
43617
used as a PCR template. This material was then submitted to Polymerase Chain
Reaction DNA amplification using primers Moraxella catarrhalis MC-Lip4-Fn/t-RI
(5'-AGG CAG AGG GAA TTC ATG AAA ATT AAA GCA TTG GGT GTT G -3')
[SEQ ID NO:S] and reverse MC-Lip4-RCh/t-Sal ( 5'-AGG CAG AGG GTC GAC TTA
ATG GTG ATG GTG ATG GTG CAT ACC CTG CGG TGC TAA AAT CAT CA-3')
[SEQ ID N0:6] specific for the BASB 113 gene. The PCR amplicon was then
submitted
to DNA sequencing using the Big Dyes kit (Applied biosystems) and analyzed on
a ABI
373/A DNA sequencer in the conditions described by the supplier. As a result,
the
polynucleotide and deduced polypeptide sequences, referred to as SEQ ID N0:3
and
SEQ ID N0:4 respectively, were obtained. These sequences do not comprise the
signal
sequence as the signal sequence was from the plasmid.
53

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Using the MegAlign program from the DNASTAR software package, an alignment of
the polynucleotide sequences of SEQ ID NO:1 and 3 was performed, and is
displayed in
Figure 1; a pairwise comparison of identities shows that the two BASB 113
polynucleotide gene sequences are 99.9% identical in the region coding for the
mature
protein. Using the same MegAlign program, an alignment of the polypeptide
sequences
of SEQ ID N0:2 and 4 was performed, and is displayed in Figure 2; a pairwise
comparison of identities shows that the two BASB 113 protein sequences are
99.9%
identical in the region of the mature protein.
Example 2: Construction of Plasmid to Express Recombinant BASB113
A: Cloning of BASB 113.
The EcoRI and SaII restriction sites engineered into the MC-Lip4-Fn/t-RI (5'-
AGG
CAG AGG GAA TTC ATG AAA ATT AAA GCA TTG GGT GTT G-3') [SEQ ID
NO:S] forward and MC-Lip4-RCh/t-Sal (5'- AGG CAG AGG GTC GAC TTA ATG
GTG ATG GTG ATG GTG CAT ACC CTG CGG TGC TAA AAT CAT CA - 3')
[SEQ ID N0:6] reverse amplification primers, respectively, permitted
directional
cloning a PCR product into the E.coli expression plasmid pTLZ2 such that a
mature
BASB 113 protein could be expressed as a fusion protein containing a (His)6
affinity
chromatography tag at the C-terminus. The BASB 113 PCR product was purified
from
the amplification reaction using silica gel-based spin columns (QiaGen)
according to the
manufacturers instructions. To produce the required EcoRI and SaII termini
necessary
for cloning, purified PCR product was sequentially digested to completion with
EcoRI
and SalI restriction enzymes as recommended by the manufacturer (Life
Technologies).
Following the first restriction digestion, the PCR product was purified via
spin column
as above to remove salts and eluted in sterile water prior to the second
enzyme
digestion. The digested DNA fragment was again purified using silica gel-based
spin
columns prior to ligation with the pTLZ2 plasmid.
54

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
B: Production of Expression Vector.
To prepare the expression plasmid pTLZ2 for ligation, it was similarly
digested to
completion with both EcoRI and SaII and then treated with calf intestinal
phosphatase
(CIP, 0.02 units / pmole of 5' end, Life Technologies) as directed by the
manufacturer
to prevent self ligation. An approximately 5-fold molar excess of the digested
fragment
to the prepared vector was used to program the ligation reaction. A standard
~20 ~1
ligation reaction (~16°C, ~16 hours), using methods well known in the
art, was
performed using T4 DNA ligase (~2.0 units / reaction, Life Technologies). An
aliquot
of the ligation (~5 ~l) was used to transform electro-competent JM 109 cells
according
to methods well known in the art. Following a ~2-3 hour outgrowth period at
37°C in
~1.0 ml of LB broth, transformed cells were plated on LB agar plates
containing
ampicillin (100 pg/ml). Antibiotic was included in the selection. Plates were
incubated
overnight at 37°C for ~16 hours. Individual ampicillin resistant
colonies were picked
with sterile toothpicks and used to "patch" inoculate fresh LB ApR plates as
well as a
~1.0 ml LB ApR broth culture. Both the patch plates and the broth culture were
incubated overnight at 37°C in either a standard incubator (plates) or
a shaking water
bath. A whole cell-based PCR analysis was employed to verify that
transformants
contained the BASB113 DNA insert. Here, the ~1.0 ml overnight LB Ap broth
culture
was transferred to a 1.5 ml polypropylene tube and the cells collected by
centrifugation
in a Beckmann microcentrifuge (~3 min., room temperature, 12,000 X g). The
cell
pellet was suspended in ~200~1 of sterile water and a ~10 pl aliquot used to
program a
~50~1 final volume PCR reaction containing both BASB113 forward and reverse
amplification primers. Final concentrations of the PCR reaction components
were
essentially the same as those specified in example 2 except ~5.0 units of Taq
polymerase was used. The initial 95°C denaturation step was increased
to 3 minutes to
ensure thermal disruption of the bacterial cells and liberation of plasmid
DNA. An ABI
Model 9700 thermal cycler and a 32 cycle, three-step thermal amplification
profile, i.e.
95°C, 45sec; 55-58°C, 45sec, 72°C, lmin., were used to
amplify the BASB113

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
fragment from the lysed transformant samples. Following thermal amplification,
a
~20~.1 aliquot of the reaction was analyzed by agarose gel electrophoresis
(0.8
agarose in a Tris-acetate-EDTA (TAE) buffer). DNA fragments were visualized by
UV
illumination after gel electrophoresis and ethidium bromide staining. A DNA
molecular
size standard ( 1 Kb ladder, Life Technologies) was electrophoresed in
parallel with the
test samples and was used to estimate the size of the PCR products.
Transformants that
produced the expected size PCR product were identified as strains containing a
BASB 113 expression construct. Expression plasmid containing strains were then
analyzed for the inducible expression of recombinant BASB 113.
C: Expression Analysis of PCR-Positive Transformants.
For each PCR-positive transformant identified above, ~5.0 ml of LB broth
containing
ampicillin (Ap) (100 pg/ml) was inoculated with cells from the patch plate and
grown
overnight at 37 °C with shaking 0250 rpm). An aliquot of the overnight
seed culture
(~1.0 ml) was inoculated into a 125 ml erlenmeyer flask containing ~25 of LB
Ap broth
and grown at 37 °C with shaking 0250 rpm) until the culture turbidity
reached O.D.600
of ~0.5, i.e. mid-log phase (usually about 1.5 - 2.0 hours). At this time
approximately
half of the culture 012.5 ml) was transferred to a second 125 ml flask and
expression of
recombinant BASBl 13 protein induced by the addition of IPTG (1.0 M stock
prepared
in sterile water, Sigma) to a final concentration of 1.0 mM. Incubation of
both the
IPTG-induced and non-induced cultures continued for an additional ~4 hours at
37 °C
with shaking. Samples (~1.0 ml) of both induced and non-induced cultures were
removed after the induction period and the cells collected by centrifugation
in a
microcentrifuge at room temperature for ~3 minutes. Individual cell pellets
were
suspended in ~50~1 of sterile water, then mixed with an equal volume of 2X
Laemelli
SDS-PAGE sample buffer containing 2-mercaptoethanol, and placed in boiling
water
bath for ~3 min to denature protein. Equal volumes (~15~.1) of both the crude
IPTG-
induced and the non-induced cell lysates were loaded onto duplicate 12%
Tris/glycine
polyacrylamide gel (1 mm thick Mini-gels, Novex). The induced and non-induced
56

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
lysate samples were electrophoresed together with prestained molecular weight
markers
(SeeBlue, Novex) under conventional conditions using a standard
SDS/Tris/glycine
running buffer (BioRad). Following electrophoresis, one gel was stained with
commassie brilliant blue 8250 (BioRad) and then destained to visualize novel
BASB113 IPTG-inducible protein(s). The second gel was electroblotted onto a
PVDF
membrane (0.45 micron pore size, Novex) for ~2 hrs at 4 °C using a
BioRad Mini-
Protean II blotting apparatus and Towbin's methanol (20 %) transfer buffer.
Blocking
of the membrane and antibody incubations were performed according to methods
well
known in the art. A monoclonal anti-RGS (His)3 antibody, followed by a second
rabbit
anti-mouse antibody conjugated to HRP (QiaGen), was used to confirm the
expression
and identity of the BASB 113 recombinant protein. Visualization of the anti-
His
antibody reactive pattern was achieved using either an ABT insoluble substrate
or using
Hyperfilm with the Amersham ECL chemiluminescence system.
Example 3: Production of Recombinant BASB113
Bacterial strain
A recombinant expression strain of E. coli JM109 containing a plasmid (pTLZ2)
encoding BASB113 from M. catarrhalis. was used to produce cell mass for
purification
of recombinant protein. The expression strain was cultivated on LB agar plates
containing 100~g/ml Ap to ensure that the pTLZ2 was maintained. For
cryopreservation at -80 °C, the strain was propagated in LB broth
containing the same
concentration of antibiotics then mixed with an equal volume of LB broth
containing
30% (w/v) glycerol.
Media
The fermentation medium used for the production of recombinant protein
consisted of
2X YT broth (Difco) containing 100~g/ml Ap. Antifoam was added to medium for
the
fermentor at 0.25 ml/L (Antifoam 204, Sigma). To induce expression of the BASB
113
recombinant protein, IPTG (Isopropyl 13-D-Thiogalactopyranoside) was added to
the
57

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
fermentor ( 1 mM, final).
Fermentation
A 500-ml erlenmeyer seed flask, containing SOmI working volume, was inoculated
with
0.3 ml of rapidly thawed frozen culture, or several colonies from a selective
agar plate
culture, and incubated for approximately 12 hours at 37 ~ 1 °C on a
shaking platform at
150 rpm (Innova 2100, New Brunswick Scientific). This seed culture was then
used to
inoculate a 5-L working volume fermentor containing 2X YT broth and both Ap
antibiotics. The fermentor (Bioflo 3000, New Brunswick Scientific) was
operated at 37
~ 1°C, 0.2 - 0.4 VVM air sparge, 250 rpm in Rushton impellers. The pH
was not
controlled in either the flask seed culture or the fermentor. During
fermentation, the pH
ranged 6.5 to 7.3 in the fermentor. IPTG ( 1.0 M stock, prepared in sterile
water) was
added to the fermentor when the culture reached mid-log of growth (~0.7
O.D.600
units). Cells were induced for 2 - 4 hours then harvested by centrifugation
using either a
28RS Heraeus (Sepatech) or RCSC superspeed centrifuge (Sorvall Instruments).
Cell
paste was stored at -20 C until processed.
Chemicals and Materials
Imidazole and Triton X-100 were purchased from Merck. Guanidine hydrochloride
was
from Fluka. Aprotinin was obtained from Sigma Chemical Company. Urea and
AEBSF were from ICN-Biochemicals. All other chemicals were reagent grade or
better.
Ni-NTA Superflow resin and penta-His Antibody, BSA free were obtained from
QiaGen. MicroBCA assay was obtained from Pierce; Amicon 3 filters from
Millipore.
Dialysis membrane (MWC012-14000) were from MFPI, USA. Molecular mass marker
(BenchMark ladder) was from Life-technologies.
Example 4: Purification of recombinant BASB113 from E. coli
58

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Extraction-Purification
Cell paste from 750 ml IPTG induced culture (~4 hours, OD620= 0.5) was
resuspended
in 60 ml of phosphate buffer pH 7.5 containing 1mM AEBSF and 1mM Aprotinin as
protease inhibitors. Cells were lysed in a cell disruptor. Lysate was
centrifuged at
27,OOOg for 20 minutes. Pellet was washed once with phosphate buffer pH 7.5
and
centrifuged again at 27,OOOg for 20 minutes. Pellet was suspended in 100 mM
NaH2P04, 10 mM Tris-HCl buffer pH 8 containing 6M Guanidium Chloride (buffer
A)
and left for 1 hour at room temperature. Total extract was centrifuged at
27,OOOg for 20
minutes. Supernatant was incubated for 1 hour at room temperature with Ni-NTA
superflow resin equilibrated in buffer A. Resin was washed twice with 100 mM
NaH2P04, 10 mM Tris-HCl buffer pH 6.3, containing 8M Urea (buffer B). Elution
was
performed successively with buffer B adjusted to pH 5.9 then pH 4.5. Fractions
containing BASB 113 antigen were neutralized with 25% volume of 0.2M phosphate
buffer pH 7.5. Pooled fractions were dialysed successively against 100 mM
NaH2P04
containing 8M Urea, then 4M Urea, then 2M Urea and finally against PBS pH 7.4
containing 0.1% Triton X-100.
Purified BASB 113 antigen was quantified using Micro BCA assay reagent. 1.5 mg
of
purified antigen were obtained , at a final concentration of 125 ~g/ml.
As shown in figure 3-A, purified BASB 113 protein appeared in SDS-PAGE
analysis as
a major band migrating at around 25 kDa (estimated relative molecular mass).
Purity
was estimated to more than 90 %. BASB 113 protein was reactive against a mouse
monoclonal antibody raised against the 6-Histidine motif (figure 3-B).
Example 5: Production of Antisera to Recombinant BASB113
Polyvalent antisera directed against the BASB 113 protein are generated by
vaccinating
rabbits with the purified recombinant BASB 113 protein. Animals are bled prior
to the
first immunization ("pre-bleed") and after the last immunization.
59

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Anti-BASB 113 protein titres are measured by an ELISA using purified
recombinant
BASB 113 protein. The titre is defined as mid-point titers calculated by 4-
parameter
logistic model using the XL Fit software.
The antisera are also used as the first antibody to identify the protein in a
western blot as
described in example 7 below. The western-blot is used to demonstrate the
presence of
anti-BASB 113 antibody in the sera of immunized animals.
Example 6: Immunological characterization: Surface exposure of BASB113
Anti-BASB 113 protein titres are determined by an ELISA using formalin-killed
whole
cells of Moraxella catarrhalis. The titre is defined as mid-point titers
calculated by 4-
parameter logistic model using the XL Fit software.
The titre observed with the rabbit or mouse immune sera demonstrates that the
BASB 113 protein is present at the surface of M. catarrhalis cells.
Example 7. Immunological Characterisation: Western Blot Analysis
Several strains of M. catarrhalis including ATCC 43617, as well as clinical
isolates
from various geographic regions, are grown on Muller Hinton agar plates for 24
hours at
36°C. Several colonies are used to inoculate broth. Cultures are grown
until the A620
is approximately 0.6 and cells are collected by centrifugation. Cells are then
concentrated and solubilized in PAGE sample buffer. The solubilized cells are
then
resolved on 4-20% polyacrylamide gels and the separated proteins are
electrophoretically transferred to PVDF membranes. The PVDF membranes are then
pretreated with saturation buffer. All subsequent incubations are carried out
using this
pretreatment buffer.
PVDF membranes are incubated with preimmune serum or rabbit or mouse immune

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
seru. PVDF membranes are then washed.
PVDF membranes are incubated with biotin-labeled sheep anti-rabbit or mouse
Ig.
PVDF membranes are then washed 3 times with wash buffer, and incubated with
streptavidin-peroxydase. PVDF membranes are then washed 3 times with wash
buffer
and developed with 4-chloro-1-naphtol.
Detection of a protein corresponding to BASB 113 expected molecular weight
that is
reactive with the antisera is used to demonstrate that this protein is
produced by and
conserved in all Moraxella strains tested.
Example 8: Immunological characterization: Bactericidal Activity
Complement-mediated cytotoxic activity of anti-BASB 113 antibodies is examined
to
determine the vaccine potential of BASB 113 protein antiserum that is prepared
as
described above. The activities of the pre-immune serum and the anti-BASB 113
antiserum in mediating complement killing of M. catarrhalis are examined.
Strains of M. catarrhalis are grown on plates. Several colonies are added to
liquid
medium. Cultures are grown and collected until the A620 is approximately 0.4.
After
one wash step, the pellet is suspended and diluted.
Preimmune sera and the anti-BASB 113 sera is deposited into the first well of
a 96-wells
plate and serial dilutions are deposited in the other wells of the same line.
Live diluted
M.catarrahlis is subsequently added and the mixture is incubated. Complement
is added
into each well at a working dilution defined beforehand in a toxicity assay.
Each test includes a complement control (wells without serum containing active
or
inactivated complement source), a positive control (wells containing serum
with a know
titer of bactericidal antibodies), a culture control (wells without serum and
complement)
and a serum control (wells without complement).
Bactericidal activity of rabbit or mice antiserum (SO% killing of homologous
strain) is
61

<IMG>

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Example 9: Presence of Antibody to BASB113 in Human Convalescent Sera
Western blot analysis of purified recombinant BASB 113 is performed as
described in
Example 7 above, except that a pool of human sera from children infected by M.
catarrhalis is used as the first antibody preparation. This is used to show
that antisera
from naturally infected individuals react to the purified recombinant protein.
Example 10: Efficacy of BASB113 vaccine: enhancement of lung clearance of M.
catarrhalis in mice.
This mouse model is based on the analysis of the lung invasion by M.
catarrhalis
following a standard intranasal challenge to vaccinated mice.
Groups of mice are immunized with BASB 113 vaccine. After the booster, the
mice are
challenged by instillation of bacterial suspension into the nostril under
anaesthesia.
Mice are killed between 30 minutes and 24 hours after challenge and the lungs
are
removed aseptically and homogenized individually. The 1og10 weighted mean
number
of CFU/lung is determined by counting the colonies grown on agar plates after
plating
of dilutions of the homogenate. The arithmetic mean of the 1og10 weighted mean
number of CFU/lung and the standard deviations are calculated for each group.
Results are analysed statistically.
In this experiment groups of mice are immunized either with BASB 113 or with a
killed
whole cells (kwc) preparation of M. catarrhalis or sham immunized.
This is used to show that the kwc preparation and the BASB 113 vaccine induce
significant lung clearance as compared to the control group.
Example 11: Inhibition of M. catarrhalis adhesion onto cells by anti-BASB113
antiserum.
This assay measures the capacity of anti BASB 113 sera to inhibit the adhesion
of
63

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Moraxella bacteria to epithelial cells. This activity could prevent
colonization of f.i. the
nasopharynx by Moraxella.
One volume of bacteria is incubated on ice with one volume of pre-immune or
anti-
BASB 113 immune serum dilution. This mixture is subsequently added in the
wells of a
24 well plate containing a confluent cells culture that is washed once with
culture
medium to remove traces of antibiotic. The plate is centrifuged and incubated.
Each well is then gently washed. After the last wash, sodium glycocholate is
added to
the wells. After incubation, the cell layer is scraped and homogenised.
Dilutions of the
homogenate are plated on agar plates and incubated. The number of colonies on
each
plate is counted and the number of bacteria present in each well calculated.
This is used to show that bacteria incubated with anti-BASB 113 antiserum are
inhibited
in their adherence capacity to the Hep-2 cells.
64

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
Deposited materials
A deposit containing a Moraxella catarrhalis Catlin strain has been deposited
with the
American Type Culture Collection (herein "ATCC") on June 21, 1997 and assigned
deposit
number 43617. The deposit was described as Branhamella catarrhalis (Frosch and
Kolle)
and is a freeze-dried, 1.5-2.9 kb insert library constructed from M.
catarrhalis isolate
obtained from a transtracheal aspirate of a coal miner with chronic
bronchitits. The deposit
is described in Antimicrob. Agents Chemother. 21: 506-508 (1982).
The Moraxella catarrhalis strain deposit is referred to herein as "the
deposited strain" or as
"the DNA of the deposited strain."
The deposited strain contains a full length BASB 113 gene.
A deposit of the vector pMC-D15 consisting of Moraxella catarrhalis DNA
inserted in
pQE30 has been deposited with the American Type Culture Collection (ATCC) on
February
12 1999 and assigned deposit number 207105.
The sequence of the polynucleotides contained in the deposited strain / clone,
as well as the
amino acid sequence of any polypeptide encoded thereby, are controlling in the
event of any
conflict with any description of sequences herein.
The deposit of the deposited strains have been made under the terms of the
Budapest Treaty
on the International Recognition of the Deposit of Micro-organisms for
Purposes of Patent
Procedure. The deposited strains will be irrevocably and without restriction
or condition
released to the public upon the issuance of a patent. The deposited strains
are provided
merely as convenience to those of skill in the art and are not an admission
that a deposit is
required for enablement, such as that required under 35 U.S.C. ~ 112.
6~

CA 02377536 2001-12-20
PCT/EP00/05851
INDICATIONS RELATING TO DEPOSITED MICROORGANISM
OR OTHER BIOLOGICAL MATERIAL
(PCT Rule 136is)
A. The indications made blow relate
to the deposited microorganism
or other biological material referred
to in the description
on page fi5 , line 1-29
B. IDENTIFICATION OF DEPOSIT Further
deposits are idemified on an additional
sheet
Name of depositary institution
AMERICAN TYPE CULTURE COLLECTION
Address of depositary institution
(including postal code and counrrv/
10801 UNIVERSITY BLVD, MANASSAS,
VIRGINIA 20110-2209,
UNITED STATES OF AMERICA
Date of deposit 21 June 1997 ( 21. Accession Number
06. 97 )
and 12 Februar 1999 (12.02.99) 43617 and 207105
C. ADDITIONAL INDICATIONS (leave
blank ifnot applicable) This information
is continued on an additional sheet
In respect of those designations
where a European Patent is sought,
a sample
of the deposited microorganism will
be made available until the publication
of the mention of the grant of the
European Patent or until the date
on which
the application has been refused
or withdrawn, only by issue of
such a sample
to an expert nominated by the person
requesting the sample.
D. DESIGNATED STATES FOR WHICH INDICATIONS
ARE MADE (if the indications are
not for all designated States
E. SEPARATE FURNISHING OF INDICATIONS
(leave blank if not applicable)
The indications listed below will
be submitted to the International
Bureau later (spec~thegeneral naawe
ofthe indicationse.g.. 'accession
;Vumber of Deparit')
For receiving Office use only ~ For International Bureau use only
This sheet wa ~ cw ~Iw~ ~ i~ez~ ti~nal application ~ ~ a This sheet was
received by the International Bureau on:
P~ 'i~~
Authorized officer Authorized officer
'~:''.: i' L.=~' iV.y
Fnrm PCT/Rn/13:1 (Julvl99gl
66

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
SEQUENCE INFORMATION
BASB113 Polynucleotide and Polypeptide Sequences
SEQ ID NO:1
Moraxella catarrlzalis BASB113 polynucleotide sequence from strain ATCC43617
ATGAAAATTAAAGCATTGGGTGTTGTGCTGTTGGCATCAAGTATGGCTTTGGCAGGTTGTGCAAATACAGGCACAACTG
G
CAATGGCACAGGATTTGGTGGTGCTAATGTCAATAAGGCGGTGATTGGGGCTGTGGCAGGTGCACTTGGCGGTACTGCC
A
TTTCAAAAGCAACTGGTGGCGAAAAAACAGGTCGTGATGCCATTTTGGGGGCGGCAGTTGGTGCAGCAGCAGGGGCGTA
T
ATGGAGCGTCAAGCAAAGCAGATTGAGCAACAAATGCAAGGAACGGGCGTGACTGTAACCCACGATACCGACACGGGTA
A
TATTAATCTAACTATGCCAGGTAATATTACTTTTGCTCATGATGACGATACTTTAAACAGTGCATTTTTGGGTCGTTTA
A
ACCAGCTGGCTAATACGATGAATCAGTATCATGAAACAACGATTGTCATTGTAGGACATACAGACTCAACGGGTCAAGC
G
GCTTATAATCAAGAGCTGTCTGAGCGTCGAGCGGATTCAGTGCGTTATTACTTGATTAATCAAGGCGTTGATCCATATC
G
TATTCAGACAGTGGGGTATGGTATGCGACAACCGATTGCATCGAATGCAACCGAAGCAGGTCGTGCTCAAAATCGCCGT
G
TTGAGCTGATGATTTTAGCACCGCAGGGTATGTAA
SEQ ID N0:2
Moraxella catarrhalis BASB113 polypeptide sequence deduced from the
polynucleotide of
SeQ ID NO:1
MKIKALGVVLLASSMALAGCANTGTTGNGTGFGGANVNKAVIGAVAGALGGTAISKATGGEKTGRDAILGAAVGAAAGA
Y
MERQAKQIEQQMQGTGVTVTHDTDTGNINLTMPGNITFAHDDDTLNSAFLGRLNQLANTMNQYHETTIVIVGHTDSTGQ
A
AYNQELSERRADSVRYYLINQGVDPYRIQTVGYGMRQPIASNATEAGRAQNRRVELMILAPQGM
SEQ ID N0:3
Moraxella catarrhalis BASB113 polynucleotide sequence from strain ATCC43617
ATGAAAATTAAAGCATTGGGTGTTGTgCTGTTGGCATCAAG.TATGGCTTTGGCAGGTTGTGCAAATACAGGCACAACT
GG
CAATGGCACAGGATTTGGTGGTGCTAATGTCAATAAGGCGGTGATTGGGGCTGTGGCAGGTGCACTTGGCGGTACTGCC
A
TTTCAAAAGCAACTGGTGGCGAAAAAACAGGTCGTGATGCCATTTTGGGGGCGGCAGTTGGTGCAGCAGCAGGGGCGTA
T
ATGGAGCGTCAAGCAAAGCAGATTGAGCAACAAATGCAAGGAACGGGCGTGACTGTAACCCACGATACCGACACGGGTA
A
TATTAATCTAACTATGCCAGGTAATATTACTTTTGCTCATGATGACGATACTTTAAACAGTGCATTTTTGGGTCGTTTA
A
ACCAGCTGGCTAATaCGATGAATCAGTATCATGAAACaACGATTGTCATTGTAGGACATACAGACTCAACGGGTCAAGC
G
GCTTATAATCAAGAGCTGTCTGAGCGTCGAGCGGATTCAGTGCGTTATTACTTGATTAATCAAGGCGTTGATCCATATC
G
TATTCAGACAGTGGGGTATGGTATGCGACAACCGATTGCATCGAATGCAACCGAAGCAGGTCGTGCTCAAAATCGCCGT
G
TTGAGCTgATGATTTTAGCACCGCAGGGTATG
SEQ ID N0:4
Moraxella catarrhalis BASB113 polypeptide sequence deduced from the
polynucleotide of
SeQ ID N0:3
MKIKALGVVLLASSMALAGCANTGTTGNGTGFGGANVNKAVIGAVAGALGGTAISKATGGEKTGRDAILGAAVGAAAGA
Y
MERQAKQIEQQMQGTGVTVTHDTDTGNINLTMPGNITFAHDDDTLNSAFLGRLNQLANTMNQYHETTIVIVGHTDSTGQ
A
AYNQELSERRADSVRYYLINQGVDPYRIQTVGYGMRQPIASNATEAGRAQNRRVELMILAPQGM
67

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
SEQ ID NO:S
AGG CAG AGG GAA TTC ATG AAA ATT AAA GCA TTG GGT GTT G
SEQ ID N0:6
AGG CAG AGG GTC GAC TTA ATG GTG ATG GTG ATG GTG CAT ACC
CTG CGG TGC TAA AAT CAT CA
68

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
SEQUENCE LISTING
<110> SmithKline Beecham Biologicals S.A.
<120> Novel Compounds
<130> BM45396
<160> 6
<170> FastSEQ for Windows Version 3.0
<210> 1
<211> 675
<212> DNA
<213> Moraxella catarrhalis
<400>
1
atgaaaattaaagcattgggtgttgtgctgttggcatcaagtatggctttggcaggttgt60
gcaaatacaggcacaactggcaatggcacaggatttggtggtgctaatgtcaataaggcg120
gtgattggggctgtggcaggtgcacttggcggtactgccatttcaaaagcaactggtggc180
gaaaaaacaggtcgtgatgccattttgggggcggcagttggtgcagcagcaggggcgtat240
atggagcgtcaagcaaagcagattgagcaacaaatgcaaggaacgggcgtgactgtaacc300
cacgataccgacacgggtaatattaatctaactatgccaggtaatattacttttgctcat360
gatgacgatactttaaacagtgcatttttgggtcgtttaaaccagctggctaatacgatg420
aatcagtatcatgaaacaacgattgtcattgtaggacatacagactcaacgggtcaagcg480
gcttataatcaagagctgtctgagcgtcgagcggattcagtgcgttattacttgattaat540
caaggcgttgatccatatcgtattcagacagtggggtatggtatgcgacaaccgattgca600
tcgaatgcaaccgaagcaggtcgtgctcaaaatcgccgtgttgagctgatgattttagca660
ccgcagggtatgtaa 675
<210> 2
<211> 224
<212> PRT
<213> Moraxella catarrhalis
<400> 2
Met Lys Ile Lys Ala Leu Gly Val Val Leu Leu Ala Ser Ser Met Ala
1 5 10 15
Leu Ala Gly Cys Ala Asn Thr Gly Thr Thr Gly Asn Gly Thr Gly Phe
20 25 30
Gly Gly Ala Asn Val Asn Lys Ala Val Ile Gly Ala Val Ala Gly Ala
35 40 45
Leu Gly Gly Thr Ala Ile Ser Lys Ala Thr Gly Gly Glu Lys Thr Gly
50 55 60
Arg Asp A1a Ile Leu Gly Ala Ala Val Gly Ala Ala Ala Gly Ala Tyr
65 70 75 80
Met Glu Arg Gln Ala Lys Gln Ile Glu Gln Gln Met Gln Gly Thr Gly
85 90 95
Val Thr Val Thr His Asp Thr Asp Thr Gly Asn Ile Asn Leu Thr Met
100 105 110
Pro Gly Asn Ile Thr Phe Ala His Asp Asp Asp Thr Leu Asn Ser Ala
115 120 125
Phe Leu Gly Arg Leu Asn Gln Leu Ala Asn Thr Met Asn Gln Tyr His
130 135 140
Glu Thr Thr Ile Val Ile Val Gly His Thr Asp Ser Thr Gly Gln Ala
1

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
145 150 155 160
Ala Tyr Asn Gln Glu Leu Ser Glu Arg Arg Ala Asp Ser Va1 Arg Tyr
165 170 175
Tyr Leu Ile Asn Gln Gly Val Asp Pro Tyr Arg Ile Gln Thr Val Gly
180 185 190
Tyr Gly Met Arg Gln Pro Ile Ala Ser Asn Ala Thr Glu Ala Gly Arg
195 200 205
Ala Gln Asn Arg Arg Val Glu Leu Met Ile Leu Ala Pro Gln Gly Met
210 215 220
<210> 3
<211> 672
<212> DNA
<213> Moraxella catarrhalis
<400>
3
atgaaaattaaagcattgggtgttgtgctgttggcatcaagtatggctttggcaggttgt60
gcaaatacaggcacaactggcaatggcacaggatttggtggtgctaatgtcaataaggcg120
gtgattggggctgtggcaggtgcacttggcggtactgccatttcaaaagcaactggtggc180
gaaaaaacaggtcgtgatgccattttgggggcggcagttggtgcagcagcaggggcgtat240
atggagcgtcaagcaaagcagattgagcaacaaatgcaaggaacgggcgtgactgtaacc300
cacgataccgacacgggtaatattaatctaactatgccaggtaatattacttttgctcat360
gatgacgatactttaaacagtgcatttttgggtcgtttaaaccagctggctaatacgatg420
aatcagtatcatgaaacaacgattgtcattgtaggacatacagactcaacgggtcaagcg480
gcttataatcaagagctgtctgagcgtcgagcggattcagtgcgttattacttgattaat540
caaggcgttgatccatatcgtattcagacagtggggtatggtatgcgacaaccgattgca600
tcgaatgcaaccgaagcaggtcgtgctcaaaatcgccgtgttgagctgatgattttagca660
ccgcagggtatg 672
<210> 4
<211> 224
<212> PRT
<213> Moraxella catarrhalis
<400> 4
Met Lys Ile Lys Ala Leu Gly Val Val Leu Leu Ala Ser Ser Met Ala
1 5 10 15
Leu Ala Gly Cys Ala Asn Thr Gly Thr Thr Gly Asn Gly Thr Gly Phe
20 25 30
Gly Gly Ala Asn Val Asn Lys Ala Val Ile Gly Ala Val Ala Gly Ala
35 40 45
Leu Gly Gly Thr Ala Ile Ser Lys Ala Thr Gly Gly Glu Lys Thr Gly
50 55 60
Arg Asp Ala Ile Leu Gly Ala Ala Val Gly Ala Ala Ala Gly Ala Tyr
65 70 75 80
Met Glu Arg Gln Ala Lys Gln Ile Glu Gln Gln Met Gln Gly Thr Gly
85 90 95
Val Thr Val Thr His Asp Thr Asp Thr Gly Asn Ile Asn Leu Thr Met
100 105 110
Pro Gly Asn Ile Thr Phe Ala His Asp Asp Asp Thr Leu Asn Ser A1a
115 120 125
Phe Leu Gly Arg Leu Asn Gln Leu Ala Asn Thr Met Asn Gln Tyr His
130 135 140
Glu Thr Thr Ile Val Ile Val Gly His Thr Asp Ser Thr Gly Gln Ala
145 150 - 155 160
Ala Tyr Asn Gln Glu Leu Ser Glu Arg Arg Ala Asp Ser Val Arg Tyr
165 170 175
Tyr Leu Ile Asn Gln Gly Val Asp Pro Tyr Arg Ile Gln Thr Val Gly
2

CA 02377536 2001-12-20
WO 01/00836 PCT/EP00/05851
180 185 190
Tyr Gly Met Arg Gln Pro Ile Ala Ser Asn Ala Thr Glu Ala Gly Arg
195 200 205
Ala Gln Asn Arg Arg Val Glu Leu Met Ile Leu Ala Pro Gln Gly Met
210 215 220
<210> 5
<211> 40
<212> DNA
<213> Artificial Sequence
<220>
<223> Primer
<400> 5
aggcagaggg aattcatgaa aattaaagca ttgggtgttg 40
<210> 6
<211> 62
<212> DNA
<213> Artificial Sequence
<220>
<223> Primer
<400> 6
aggcagaggg tcgacttaat ggtgatggtg atggtgcata ccctgcggtg ctaaaatcat 60
ca 62
3

Dessin représentatif

Désolé, le dessin représentatif concernant le document de brevet no 2377536 est introuvable.

États administratifs

2024-08-01 : Dans le cadre de la transition vers les Brevets de nouvelle génération (BNG), la base de données sur les brevets canadiens (BDBC) contient désormais un Historique d'événement plus détaillé, qui reproduit le Journal des événements de notre nouvelle solution interne.

Veuillez noter que les événements débutant par « Inactive : » se réfèrent à des événements qui ne sont plus utilisés dans notre nouvelle solution interne.

Pour une meilleure compréhension de l'état de la demande ou brevet qui figure sur cette page, la rubrique Mise en garde , et les descriptions de Brevet , Historique d'événement , Taxes périodiques et Historique des paiements devraient être consultées.

Historique d'événement

Description Date
Inactive : CIB de MCD 2006-03-12
Demande non rétablie avant l'échéance 2005-06-23
Le délai pour l'annulation est expiré 2005-06-23
Réputée abandonnée - omission de répondre à un avis sur les taxes pour le maintien en état 2004-06-23
Inactive : Demandeur supprimé 2002-09-24
Inactive : Correspondance - Transfert 2002-06-19
Lettre envoyée 2002-05-06
Lettre envoyée 2002-05-06
Inactive : Page couverture publiée 2002-04-30
Inactive : CIB en 1re position 2002-04-28
Inactive : Notice - Entrée phase nat. - Pas de RE 2002-04-26
Demande reçue - PCT 2002-04-23
Modification reçue - modification volontaire 2002-01-28
Inactive : Correspondance - Poursuite 2002-01-28
Inactive : Transfert individuel 2002-01-22
Exigences pour l'entrée dans la phase nationale - jugée conforme 2001-12-20
Demande publiée (accessible au public) 2001-01-04

Historique d'abandonnement

Date d'abandonnement Raison Date de rétablissement
2004-06-23

Taxes périodiques

Le dernier paiement a été reçu le 2003-03-31

Avis : Si le paiement en totalité n'a pas été reçu au plus tard à la date indiquée, une taxe supplémentaire peut être imposée, soit une des taxes suivantes :

  • taxe de rétablissement ;
  • taxe pour paiement en souffrance ; ou
  • taxe additionnelle pour le renversement d'une péremption réputée.

Les taxes sur les brevets sont ajustées au 1er janvier de chaque année. Les montants ci-dessus sont les montants actuels s'ils sont reçus au plus tard le 31 décembre de l'année en cours.
Veuillez vous référer à la page web des taxes sur les brevets de l'OPIC pour voir tous les montants actuels des taxes.

Historique des taxes

Type de taxes Anniversaire Échéance Date payée
Taxe nationale de base - générale 2001-12-20
Enregistrement d'un document 2002-01-22
TM (demande, 2e anniv.) - générale 02 2002-06-25 2002-05-06
TM (demande, 3e anniv.) - générale 03 2003-06-23 2003-03-31
Titulaires au dossier

Les titulaires actuels et antérieures au dossier sont affichés en ordre alphabétique.

Titulaires actuels au dossier
SMITHKLINE BEECHAM BIOLOGICALS S.A.
Titulaires antérieures au dossier
JOELLE THONNARD
Les propriétaires antérieurs qui ne figurent pas dans la liste des « Propriétaires au dossier » apparaîtront dans d'autres documents au dossier.
Documents

Pour visionner les fichiers sélectionnés, entrer le code reCAPTCHA :



Pour visualiser une image, cliquer sur un lien dans la colonne description du document. Pour télécharger l'image (les images), cliquer l'une ou plusieurs cases à cocher dans la première colonne et ensuite cliquer sur le bouton "Télécharger sélection en format PDF (archive Zip)" ou le bouton "Télécharger sélection (en un fichier PDF fusionné)".

Liste des documents de brevet publiés et non publiés sur la BDBC .

Si vous avez des difficultés à accéder au contenu, veuillez communiquer avec le Centre de services à la clientèle au 1-866-997-1936, ou envoyer un courriel au Centre de service à la clientèle de l'OPIC.


Description du
Document 
Date
(aaaa-mm-jj) 
Nombre de pages   Taille de l'image (Ko) 
Description 2001-12-19 71 3 135
Description 2002-01-27 70 3 093
Dessins 2001-12-19 7 106
Abrégé 2001-12-19 1 50
Revendications 2001-12-19 4 135
Rappel de taxe de maintien due 2002-04-28 1 111
Avis d'entree dans la phase nationale 2002-04-25 1 194
Courtoisie - Certificat d'enregistrement (document(s) connexe(s)) 2002-05-05 1 114
Courtoisie - Certificat d'enregistrement (document(s) connexe(s)) 2002-05-05 1 112
Courtoisie - Lettre d'abandon (taxe de maintien en état) 2004-08-17 1 175
Rappel - requête d'examen 2005-02-23 1 117
PCT 2001-12-19 14 520

Listes de séquence biologique

Sélectionner une soumission LSB et cliquer sur le bouton "Télécharger la LSB" pour télécharger le fichier.

Si vous avez des difficultés à accéder au contenu, veuillez communiquer avec le Centre de services à la clientèle au 1-866-997-1936, ou envoyer un courriel au Centre de service à la clientèle de l'OPIC.

Soyez avisé que les fichiers avec les extensions .pep et .seq qui ont été créés par l'OPIC comme fichier de travail peuvent être incomplets et ne doivent pas être considérés comme étant des communications officielles.

Fichiers LSB

Pour visionner les fichiers sélectionnés, entrer le code reCAPTCHA :